Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G009603.489ON70070028720.0
NCAS0E008303.489ON67171118250.0
Suva_7.4163.489ON71374514980.0
Skud_7.4393.489ON71374614380.0
Smik_6.2243.489ON70574014340.0
YGR128C (UTP8)3.489ON71374614120.0
Kpol_480.163.489ON65571313710.0
SAKL0F02838g3.489ON65465813680.0
TDEL0D055703.489ON64971113581e-179
KLTH0F14762g3.489ON65066013021e-171
TBLA0C044603.489ON69874312991e-170
ZYRO0D10054g3.489ON66471612871e-168
AFR307C3.489ON65066212721e-166
KLLA0E04665g3.489ON64765512711e-166
TPHA0D042303.489ON65266012211e-159
CAGL0I10560g3.489ON67868712021e-155
Kwal_55.212223.489ON3733687547e-93
KAFR0C019403.489ON6096627372e-87
KNAG0B008303.489ON6074606218e-71
Kwal_55.21225singletonOFF2152274499e-51
NCAS0E039305.74ON27854732.8
Skud_9.1247.230ON53655699.5
TPHA0H020906.292ON33358699.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00960
         (700 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...  1110   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   707   0.0  
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   581   0.0  
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   558   0.0  
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   556   0.0  
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   548   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   532   0.0  
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   531   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   527   e-179
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   506   e-171
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   504   e-170
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   500   e-168
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   494   e-166
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   494   e-166
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   474   e-159
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   467   e-155
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   295   7e-93
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   288   2e-87
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   243   8e-71
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   177   9e-51
NCAS0E03930 Chr5 (770838..771674) [837 bp, 278 aa] {ON}                33   2.8  
Skud_9.124 Chr9 (240000..241610) [1611 bp, 536 aa] {ON} YIL045W ...    31   9.5  
TPHA0H02090 Chr8 (493355..494356) [1002 bp, 333 aa] {ON} Anc_6.292     31   9.5  

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score = 1110 bits (2872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/700 (83%), Positives = 585/700 (83%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATMX 120
           PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATM 
Sbjct: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATME 120

Query: 121 XXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXMIVLENGLIQFFNSSLKLLN 180
                           FN                      MIVLENGLIQFFNSSLKLLN
Sbjct: 121 DDEDVVDVIDTTIKDEFNVKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLKLLN 180

Query: 181 TVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQINNDSAIELNSIIMENFNG 240
           TVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQINNDSAIELNSIIMENFNG
Sbjct: 181 TVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQINNDSAIELNSIIMENFNG 240

Query: 241 QNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPISTNRILLTI 300
           QNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPISTNRILLTI
Sbjct: 241 QNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPISTNRILLTI 300

Query: 301 NNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIGKGENNNKTITIGVSTKFGVNPTSSL 360
           NNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIGKGENNNKTITIGVSTKFGVNPTSSL
Sbjct: 301 NNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIGKGENNNKTITIGVSTKFGVNPTSSL 360

Query: 361 EIINVDVGSNTLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNTXXXXXXXXXXXXVTKE 420
           EIINVDVGSNTLKDSLGKCF           STQALKPLFDPNT            VTKE
Sbjct: 361 EIINVDVGSNTLKDSLGKCFQNLNLQNQIQISTQALKPLFDPNTDGDKDDDLFKKLVTKE 420

Query: 421 QFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKF 480
           QFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKF
Sbjct: 421 QFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKF 480

Query: 481 GSTATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLFKQAIVTCXXXXXXXXX 540
           GSTATTAQTNEYPK            MERTQSLLSRFANHPRLFKQAIVTC         
Sbjct: 481 GSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVTCPNLPLPELL 540

Query: 541 XXXXTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDEIKDDQNSPQ 600
               TIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDEIKDDQNSPQ
Sbjct: 541 NELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDEIKDDQNSPQ 600

Query: 601 LFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSHXXXXX 660
           LFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSH     
Sbjct: 601 LFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSHNKKDN 660

Query: 661 XXXXXXXXXXXXXXXXXXXXXXXFTQKEALPMYSVDYLEL 700
                                  FTQKEALPMYSVDYLEL
Sbjct: 661 SFSSASASTNSKSNNISSNNKKSFTQKEALPMYSVDYLEL 700

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/711 (53%), Positives = 481/711 (67%), Gaps = 51/711 (7%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPSLSQPFRLT+LPKIASLSN++LQ DYIQV  STF+PTTNK+ IG+SGS++SQYI+NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATMX 120
           PKLIFN+PIPSTNIVTAC+V E     ++ E WCF  +ANKT TL LI K++ +++    
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFEQKG--SSEETWCFATMANKTSTLNLINKNQYQTNE--- 115

Query: 121 XXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXMIVLENGLIQFFNSSLKLLN 180
                                                   ++VL+NG IQ ++  LKLLN
Sbjct: 116 ----EESGDSAPSDSSVTSEFKIKADDHVVDIKILNKKKIIVVLKNGKIQTYDFELKLLN 171

Query: 181 TVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQIN------NDSAIELNSII 234
           ++ + Y NV+FVEHF ED KDFMF +CDL +N+KVC+KLFQIN      NDSAIEL S I
Sbjct: 172 SINMAYNNVRFVEHFHEDGKDFMFVLCDL-ENDKVCLKLFQINENIETINDSAIELTSTI 230

Query: 235 MENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMI---KTDDQIVSMKPI 291
           +ENF  +NAKFCYQFGKFYKLT++ ++VYSLPQFQ +++ T+PMI   K  +++VS KPI
Sbjct: 231 LENFPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPI 290

Query: 292 STNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIGKGENNNKTITIGVSTK 351
           S NRILLT+NNKIYLLDLIHNSILSERELTHLK+ QLL++AV+    N N+T+ IGVSTK
Sbjct: 291 SPNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNRTLAIGVSTK 350

Query: 352 FGVNPTSSLEIINVDVGSNTLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNTXXXXXXX 411
           FG NPTSSLE++NVDVG++T+KDSLGK F           + Q+LK LFD          
Sbjct: 351 FGSNPTSSLELLNVDVGTSTIKDSLGKSF----QTSSTENNVQSLKSLFDDENDYSDKKK 406

Query: 412 XXXXXVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLK 471
                   + FNY++I  +L ++ ND+ KFD+IFF+SF+IKKE+YTE DRFIYNHEF ++
Sbjct: 407 QV------KNFNYEKIYKELVDSKNDVTKFDDIFFKSFDIKKEYYTEKDRFIYNHEFLVQ 460

Query: 472 LIDLIFEKFGSTATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLFKQAIVTC 531
           +IDLIFE F          EYPK            +ERT+ LL+R  NHPRLFKQAIVTC
Sbjct: 461 IIDLIFETFKE--------EYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTC 512

Query: 532 XXXXXXXXXXXXXTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDE 591
                        TI N ELSLDISLRILQDY++DSIK+EL+ LP++E+ENFI+FI+++E
Sbjct: 513 PNLPLNELLAELFTISNGELSLDISLRILQDYTRDSIKKELKKLPKIEVENFIEFIIDEE 572

Query: 592 --IKDDQNSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSN 649
             IKD  N+P LFQLL+LV+DSIGLFAL + +LE LS YID QV+I + NTELW+L+D  
Sbjct: 573 SDIKDTTNAPHLFQLLSLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDY- 631

Query: 650 NNIFSHXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTQKEALPMYSVDYLEL 700
           +N+ ++                              Q+E LP YSV+YL+L
Sbjct: 632 SNVLAYKNDKFVTSTSKDSNTSLKL-----------QEEVLPKYSVEYLDL 671

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/745 (45%), Positives = 450/745 (60%), Gaps = 77/745 (10%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPSLSQPFRL  LPKIASLSN+SLQ DY+QV    FN  TN + +G+SGS+ISQYIINPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 61  PKLIFNYPIPSTNIVTACDV------LENDNDNTNN----------------EVWCFGLV 98
           PKL F+YPIPSTNI+TAC+       +END  N++N                E+W FGL+
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVTNFQSKRDVEIWSFGLM 120

Query: 99  ANKT-YTLTLITK---DKQKSSATMXXXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXX 154
            NK  YTL +ITK   D   +S                     +                
Sbjct: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180

Query: 155 XXXXXXMIVLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNK 214
                 + VL+NGL++F++  LKLL++  I+Y N+K+ + F E+  +F+F +C L D+ K
Sbjct: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDD-K 239

Query: 215 VCIKLFQINN-----DSAI-ELNSIIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQF 268
           VC KLF++++      S I EL+S I+E F+ +++KFCYQFGK YKL    + VYSLP  
Sbjct: 240 VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHC 299

Query: 269 QLEHTTTIPMIK---TDDQIVSMKPISTNRILLTINNKIYLLDLIHNSILSERELTHLKS 325
           QL+    +P+I    +++ ++S +P+S NRILLT+NN IYLLDL+H SIL++RELTH+++
Sbjct: 300 QLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRT 359

Query: 326 LQLLRSAVI-GKGENNNKTITIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFXXXX 384
            QLLRSAVI  +   N+KTI IG+STK G NPTSSLEIIN+DVG+NTLKDSLGK F    
Sbjct: 360 FQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGK 419

Query: 385 XXXXXXXSTQALKPLFDPNTXXXXXXXX--XXXXVTKEQFNYDEILTKLSE-NTNDIGKF 441
                  S+  LKPLFD                 ++   F YDEI+ K+S    ND+  F
Sbjct: 420 NDT----SSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASF 475

Query: 442 DEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGSTATTAQTNEYPKXXXXXXX 501
           D+IFF+   +K+EHYTE DRFI + EF  +++DLIFEKF         N+YPK       
Sbjct: 476 DDIFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNG-------NDYPKALTFLLT 528

Query: 502 XXXXXMERTQSLLSRFANHPRLFKQAIVTCXXXXXXXXXXXXXTIKNNELSLDISLRILQ 561
                + RT +LLSR  + PRLFKQAIVTC             +I+N EL LDIS RILQ
Sbjct: 529 HPLFPLNRTHNLLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQ 588

Query: 562 DYSKDSIKQELRNLPRLEIENFIDFILN-DEIKDDQN-----SPQLFQLLALVLDSIGLF 615
           D+++DSIKQE++NL +L+I+NFIDFI N DE    +N     S QLFQLL+LVLDSIGLF
Sbjct: 589 DFTRDSIKQEMKNLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLF 648

Query: 616 ALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSHXXXXXXXXXXXXXXXXXXXX 675
           +L   +L+NL++YID+QV I E+NTELW L+++  +                        
Sbjct: 649 SLEGALLDNLASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRT----------- 697

Query: 676 XXXXXXXXFTQKEALPMYSVDYLEL 700
                    +QK+ALP Y+++YLE+
Sbjct: 698 ---------SQKQALPTYTMEYLEI 713

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/746 (44%), Positives = 437/746 (58%), Gaps = 79/746 (10%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPSLSQPFRL  LPKIASLSN+SLQ DY+QV   TFN +TN + +G+SGS+ISQYIINPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLIFNYPIPSTNIVTACDVLE------------NDNDN-----------TNNEVWCFGL 97
           PKL F+YPIPSTN++TAC   E            ND+ N            N E+W FG 
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 98  VANKT-YTLTLITK--DKQKSSATMXXXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXX 154
           + NK  YTL + TK  +  K+++                   F                 
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180

Query: 155 XXXXXXMI-VLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDNN 213
                 +I VL+NGLI+F++  LKLL +  I+Y N+K+ + F E+  DF+F +C L D+ 
Sbjct: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDD- 239

Query: 214 KVCIKLFQI------NNDSAIELNSIIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQ 267
           KVC K+ ++      +N    EL+S I+E F+ +++K CYQFGK YKL    + VYSLP 
Sbjct: 240 KVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPH 299

Query: 268 FQLEHTTTIPMIK---TDDQIVSMKPISTNRILLTINNKIYLLDLIHNSILSERELTHLK 324
            QL+    +P+I    ++D ++S +P+S NRILLT+NN IYLLDL+H SIL+ RELTH+K
Sbjct: 300 CQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVK 359

Query: 325 SLQLLRSAVI-GKGENNNKTITIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFXXX 383
           + QLL+SA+I  +  +N+KTI IG+STK G NPTSSLEIIN+DVG+NTLKDSLGK F   
Sbjct: 360 TFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419

Query: 384 XXXXXXXXSTQALKPLFDPN--TXXXXXXXXXXXXVTKEQFNYDEILTKLSE-NTNDIGK 440
                   ++  LKPLFD    T            +    F+YDE++ KLS    NDI  
Sbjct: 420 KND-----ASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIAS 474

Query: 441 FDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGSTATTAQTNEYPKXXXXXX 500
           FDEIFF    +K+EHYTE DRFI +  F  K++DLIF KFG        N+YPK      
Sbjct: 475 FDEIFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGG-------NDYPKALTFLL 527

Query: 501 XXXXXXMERTQSLLSRFANHPRLFKQAIVTCXXXXXXXXXXXXXTIKNNELSLDISLRIL 560
                 + RT  LLS   + PRLFKQAIVTC             +I+N EL LDIS R+L
Sbjct: 528 THPLFPLNRTHGLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVL 587

Query: 561 QDYSKDSIKQELRNLPRLEIENFIDFILNDEIK------DDQNSPQLFQLLALVLDSIGL 614
           QD+++DSIKQE++ L +L+I+NFI+ I N E        +  +S QLFQLL+LVLDSIGL
Sbjct: 588 QDFTRDSIKQEMKKLSKLDIQNFIECITNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGL 647

Query: 615 FALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSHXXXXXXXXXXXXXXXXXXX 674
           F+L   +LENL+ YID+QV I E+NTELW LID   +                       
Sbjct: 648 FSLEGALLENLTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTT---------- 697

Query: 675 XXXXXXXXXFTQKEALPMYSVDYLEL 700
                     +QK+ALP Y+++YL++
Sbjct: 698 ----------SQKQALPAYAMEYLDI 713

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/740 (44%), Positives = 443/740 (59%), Gaps = 75/740 (10%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPSLSQPFRL  LPKIASLSN+SLQ +Y+QV   TFN +TN + +G+SGS++SQYIINPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 61  PKLIFNYPIPSTNIVTACDVLE-----NDNDN----------TNNEVWCFGLVANKT-YT 104
           PKLIF+YPIPSTNI+TAC+  E      D DN           N E+W FGL+ NK  YT
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120

Query: 105 LTLITKDKQKS---SATMXXXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXM 161
           L +ITK  + +   +                     +                      +
Sbjct: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180

Query: 162 IVLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQ 221
            +L+NGLI+F++  LKLL++  I+Y N+K+ + F E+  +F+F +C L D+ KVC KL +
Sbjct: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDD-KVCYKLLE 239

Query: 222 I------NNDSAIELNSIIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTT 275
           +       N    EL+S I+E F+  ++K CYQFGK YKL    + VYSLP  QL+    
Sbjct: 240 LTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIE 299

Query: 276 IPMIKTDD---QIVSMKPISTNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSA 332
           +P+I   D    ++S +P+S NR+LLT+NN +YLLDL+H S L +REL+H+K+ QLL +A
Sbjct: 300 LPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTA 359

Query: 333 VI-GKGENNNKTITIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFXXXXXXXXXXX 391
           VI  +  +++KTI IG+STK G NPTSSLEIIN+DVG+NTLKDSLGK F           
Sbjct: 360 VINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKD----- 414

Query: 392 STQALKPLFDPN--TXXXXXXXXXXXXVTKEQFNYDEILTKLSE-NTNDIGKFDEIFFQS 448
           S+  LKPLFD    T            ++   F YDEI+ KLS   +NDI  FD+IFF+ 
Sbjct: 415 SSVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKD 474

Query: 449 FNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGSTATTAQTNEYPKXXXXXXXXXXXXME 508
             IK+EHYTE DRFI +  F  K++DLIFEKF         N+YPK            ++
Sbjct: 475 LKIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNG-------NDYPKTLTFLLTHPLFPLD 527

Query: 509 RTQSLLSRFANHPRLFKQAIVTCXXXXXXXXXXXXXTIKNNELSLDISLRILQDYSKDSI 568
           RT++LLS   + PRLFKQAIVTC             +I+N EL LDIS RILQD+++DSI
Sbjct: 528 RTRNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSI 587

Query: 569 KQELRNLPRLEIENFIDFILNDEIKDD------QNSPQLFQLLALVLDSIGLFALSDNIL 622
           KQE++ L +L+I+NFI+F+ + E  +         S QLFQLL+LVLDSIGLF+L   +L
Sbjct: 588 KQEMKRLSKLDIQNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALL 647

Query: 623 ENLSAYIDRQVSIVEKNTELWYLID--SNNNIFSHXXXXXXXXXXXXXXXXXXXXXXXXX 680
           E+L++YID+QV I E+NTELW LID  S+ + F++                         
Sbjct: 648 ESLTSYIDKQVKIAERNTELWNLIDIKSSQHGFTNLAFESAS------------------ 689

Query: 681 XXXFTQKEALPMYSVDYLEL 700
               +QK+ALP Y+++YL++
Sbjct: 690 ----SQKQALPTYTMEYLDI 705

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/746 (43%), Positives = 434/746 (58%), Gaps = 79/746 (10%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPSLSQPFRL  LPKIASLSN+SLQ DY+QV   TFN +TN + +G+SGS+ISQYIINPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLIFNYPIPSTNIVTACD-----------VLENDNDNTNNE------------VWCFGL 97
           PKL F+YPIPSTNI+TAC+           +  + +D  NNE            +W FGL
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 98  VANKT-YTLTLITK---DKQKSSATMXXXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXX 153
           + NK  YTL +ITK   D   +S                     +               
Sbjct: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180

Query: 154 XXXXXXXMIVLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDNN 213
                  + +L+NGLI+ F+  L LL++  I+Y N+K+ + F E+  +++F +C L D+ 
Sbjct: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDD- 239

Query: 214 KVCIKLFQINN-----DSAI-ELNSIIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQ 267
           KVC KL ++ +      S I EL+S I+E F+ +N+K CYQFGK YKL    + +YSLP 
Sbjct: 240 KVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPH 299

Query: 268 FQLEHTTTIPMI---KTDDQIVSMKPISTNRILLTINNKIYLLDLIHNSILSERELTHLK 324
            QL+     PM+      D ++S +P+S NR+LLT+NN IYLLDL+H S LS+RELTH+K
Sbjct: 300 CQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVK 359

Query: 325 SLQLLRSAVI-GKGENNNKTITIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFXXX 383
           + QLL+SAVI  +  +N+KTI IG+STK G NPTSSLEIIN+DVG+NTLKDSLGK F   
Sbjct: 360 TFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419

Query: 384 XXXXXXXXSTQALKPLFDPN--TXXXXXXXXXXXXVTKEQFNYDEILTKLSE-NTNDIGK 440
                   S+  LKPLFD                  +    + +E++ KLS    NDI  
Sbjct: 420 NND-----SSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITS 474

Query: 441 FDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGSTATTAQTNEYPKXXXXXX 500
           FD+IFF+   IK+EHYTE DR+I +  F  K++DLIF KF         N+YPK      
Sbjct: 475 FDDIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSG-------NDYPKTLTFLL 527

Query: 501 XXXXXXMERTQSLLSRFANHPRLFKQAIVTCXXXXXXXXXXXXXTIKNNELSLDISLRIL 560
                 + RT++LLS   + PRLFKQAIVTC             +I+N EL LDIS RIL
Sbjct: 528 THPLFPLSRTRNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRIL 587

Query: 561 QDYSKDSIKQELRNLPRLEIENFIDFILND------EIKDDQNSPQLFQLLALVLDSIGL 614
           QD+++DSIKQE++ L +L+++NFI+FI +       E  +   S QLFQLL+LVLDSIGL
Sbjct: 588 QDFTRDSIKQEMKKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGL 647

Query: 615 FALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSHXXXXXXXXXXXXXXXXXXX 674
           F+L   +LENL+ YID+QV I E+NTELW LID+    F H                   
Sbjct: 648 FSLEGALLENLTLYIDKQVEIAERNTELWNLIDTKG--FQHGFASSTFDNGT-------- 697

Query: 675 XXXXXXXXXFTQKEALPMYSVDYLEL 700
                     +QK ALP Y+++YL++
Sbjct: 698 ----------SQKRALPTYTMEYLDI 713

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/713 (44%), Positives = 425/713 (59%), Gaps = 71/713 (9%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPS SQPFRL VLPKI SLSN   Q   +Q+    F+  +NK+ IG+SGS ISQYIINPT
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADD-FSLESNKITIGISGSTISQYIINPT 59

Query: 61  PKLIFNYPIPSTNIVTACDV--LENDNDNTNNEVWCFGLVANKTYTLTLITK----DKQK 114
           P L+FN PIPSTN VTAC++    +D D +  E W +GL  NK +TL +  K    DK  
Sbjct: 60  PSLVFNVPIPSTNNVTACNIGHFVSDTDGSKLECWAYGLSYNKNHTLNISIKTSDDDKYA 119

Query: 115 SSATMXXXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXMIVLENGLIQFFNS 174
           +S                     N                      ++VL+NGLIQF++ 
Sbjct: 120 TSGGEVVETYSQKCDDKIEHIKINEKEKVI----------------VVVLKNGLIQFYDF 163

Query: 175 SLKLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQI--NNDSAI-ELN 231
           +LKLL +V + Y ++ FVEHF+ED K F   + ++ +  K+  KL+++  N+ ++I EL+
Sbjct: 164 TLKLLKSVNVMYSDISFVEHFEEDGKQFAIILSNI-EGKKISFKLYELFTNDKTSINELS 222

Query: 232 SIIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMI-KTDDQIVSMKP 290
           S I+E+ +   ++ CYQFGK Y+L  + L +Y+LPQ QL+ T  +P I K D  ++S  P
Sbjct: 223 STILEDADLGESQICYQFGKIYRLFEDRLYIYNLPQCQLQQTIELPFIQKKDSDVLSFSP 282

Query: 291 ISTNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVI-GKGEN-NNKTITIGV 348
           I+ NRILLT+NNKIYLLDL+HNSIL+ER+L+H+K  QLL+S V+  KGEN N+KTI IGV
Sbjct: 283 IANNRILLTVNNKIYLLDLVHNSILAERDLSHVKVYQLLKSIVVPSKGENKNSKTIAIGV 342

Query: 349 STKFGVNPTSSLEIINVDVGSNTLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNTXXXX 408
           S K G +P SSLE+INVDVGS TLKDSLGK F               L+ LF  +     
Sbjct: 343 SIKNGPSPISSLEVINVDVGSGTLKDSLGKSFQVANVKKNI-----PLQSLFPEDETIYA 397

Query: 409 XXXXXXXXVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEF 468
                     ++ F+Y  IL +L  N NDI KFD+IFF+  NI KE+YTE DRFIY+ +F
Sbjct: 398 KG-------EQKSFDYKNILQELQNNKNDINKFDDIFFKKLNIMKEYYTEQDRFIYDQKF 450

Query: 469 FLKLIDLIFEKFGSTATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLFKQAI 528
              ++DLIF  F          +YP+            +  T++LL++F N PRLFKQA+
Sbjct: 451 LSDVLDLIFSAF--------KKDYPRALTFLLTHPLFPISHTRNLLTKFRNQPRLFKQAV 502

Query: 529 VTCXXXXXXXXXXXXXTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFIL 588
           VTC             TI N EL LDISLRILQDY++DSIKQEL+ L +++I+NFI+F++
Sbjct: 503 VTCPNLPLKELLAELFTITNGELCLDISLRILQDYTRDSIKQELKTLSKVDIQNFIEFVI 562

Query: 589 NDEIKD-DQNSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLID 647
           + + +D  Q +PQLFQLL+LVLD+ GLFAL +  LE LSAYID QV++ E+N  LW+L+D
Sbjct: 563 DTDSEDKSQFNPQLFQLLSLVLDASGLFALEEETLEKLSAYIDNQVNVAERNNRLWHLLD 622

Query: 648 SNNNIFSHXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTQKEALPMYSVDYLEL 700
            N++  S                               Q ++L  YSV+YLEL
Sbjct: 623 ENSDKRS--------------------TLNQANDQNVLQTKSLSAYSVEYLEL 655

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/658 (46%), Positives = 410/658 (62%), Gaps = 47/658 (7%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           M S+SQPFRLT LPKIASL+N+S Q DY+QV  +T  P+ NK+ IGVSGS+ISQYIINPT
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVA-NTLTPSANKINIGVSGSSISQYIINPT 59

Query: 61  PKLIFNYPIPSTNIVTACDVLE---NDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSA 117
           PKL+ N  IPST+IVTACDV E   N+ D    EVWC+ LVANK++TL  I K     + 
Sbjct: 60  PKLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAP 119

Query: 118 TMXXXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXMIVLENGLIQFFNSSLK 177
           ++                 F                       + VL+NGL+Q F+  LK
Sbjct: 120 SVNSTQT------------FENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLK 167

Query: 178 LLNTVKINYKNVKFVEHFK-EDNKDFMFTICDLGDNNKVCIKLFQI-NNDSAI---ELNS 232
           LL++  I+Y N+  V++F  E  +DFM  + DL D+ KVC KLF+I ++DS +   ELNS
Sbjct: 168 LLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDD-KVCYKLFEIIHHDSNVPLKELNS 226

Query: 233 IIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPIS 292
           +I+E F+ QN+K  YQFGK Y L+N  + +YSLP FQL +T  +P + T + +VS KPIS
Sbjct: 227 VILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFV-THENVVSFKPIS 285

Query: 293 TNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVI-GKGENNNKTITIGVSTK 351
           TNR LLT++N+IYLLDL+HN+ILS+RELTH+K+ QLL +A+I G    NNKTI IGVSTK
Sbjct: 286 TNRALLTVDNRIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTK 345

Query: 352 FGVNPTSSLEIINVDVGSNTLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNTXXXXXXX 411
              N TS+L+I+N++VGS TLKDS+ K F           + + L  LF           
Sbjct: 346 SDNNATSALDIVNINVGSGTLKDSMSKGFLTQDA------TEEVLNSLF-------DEQD 392

Query: 412 XXXXXVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLK 471
                    QF+Y++IL++L +  +   KFD +FF+S NIKKE+YTE DRF  +  F  K
Sbjct: 393 DELDEDGTSQFDYNQILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDK 452

Query: 472 LIDLIFEKFGSTATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLFKQAIVTC 531
           ++ LIFE F          EYP+             +    LLS+F  HPRLF+QAIVTC
Sbjct: 453 VLSLIFENFNK--------EYPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTC 504

Query: 532 XXXXXXXXXXXXXTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDE 591
                        T+ N+EL LD+SLRILQD++KDSIKQ ++ + +++I NFI F++N++
Sbjct: 505 PNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVINED 564

Query: 592 IKDDQN--SPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLID 647
             +++N   PQLFQLL LVLDSIGLFAL    LENL  +I+ QV IVE+N EL  L+D
Sbjct: 565 DDEERNKSKPQLFQLLNLVLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLD 622

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  527 bits (1358), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 304/711 (42%), Positives = 415/711 (58%), Gaps = 73/711 (10%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPSLSQ F+L VLP++ASLSN++ Q +++QV      PT+N++ IG+S SAISQY++NPT
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNPT 59

Query: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATMX 120
           PKL+ + PIPSTNIVTACDV  +D      E+WC+ L A K  TL + +K     +    
Sbjct: 60  PKLVLSIPIPSTNIVTACDVARSDE----QEIWCYALQAGKVCTLNVASKVSHAENGVNS 115

Query: 121 XXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXMIVLENGLIQFFNSSLKLLN 180
                            N                      ++VL+NGLIQF++  LKLL+
Sbjct: 116 DDVLKVKVDDQAVGVHVNGKDKTI----------------VVVLKNGLIQFYDFQLKLLH 159

Query: 181 TVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQI-----NNDSAIELNSIIM 235
           ++ ++Y +V   + F E   DF+F +C L ++ KVC KLF++     N     EL+SII+
Sbjct: 160 SLDVSYSDVSVTKFFTEGANDFLFILCSLPED-KVCFKLFELSLPNYNQVPIKELSSIIL 218

Query: 236 ENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPISTNR 295
           E+F+   +K CYQ G+ Y+L  + ++VY+LPQ QL    T+PM++  D ++SMKPIS+NR
Sbjct: 219 EDFSLATSKICYQSGRLYRLIGHEVLVYALPQCQLVQAVTLPMVQGAD-VISMKPISSNR 277

Query: 296 ILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIGKGEN----NNKTITIGVSTK 351
           IL+T +NKIYLL+L HNSIL +RELTHLKS QLL+SAVI    +    N KT  IGV TK
Sbjct: 278 ILVTADNKIYLLNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTK 337

Query: 352 FGVNPTSSLEIINVDVGSNTLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNTXXXXXXX 411
            G NPTSSLEI+NVDVG+ TLKDSLGK F            +Q LKPLF           
Sbjct: 338 HGKNPTSSLEIVNVDVGTGTLKDSLGKGFTVSNEPI-----SQVLKPLFSDEDNEAEDED 392

Query: 412 XXXXXVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLK 471
                   E F++++I   L +N   I  FD IF +  NIK+EHYTE DRFI + +F   
Sbjct: 393 NKF-----EHFDFNQIYQHLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSN 447

Query: 472 LIDLIFEKFGSTATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLFKQAIVTC 531
           ++ LI + F          EYPK            ++ T  LLSR   HPRLFKQAIVTC
Sbjct: 448 VVHLILQNF--------QEEYPKALTFLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTC 499

Query: 532 XXXXXXXXXXXXXTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFIL--N 589
                        +I+N ELSLDISLRILQDY+ D IKQE+R L +++++NFI+F++  N
Sbjct: 500 PNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEVRKLNKIDVQNFIEFVISSN 559

Query: 590 DEIKDDQNSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSN 649
           DE    ++S QLFQLL+LVLDSIGLFAL   +L+ L+ YI  +V+I E+N++L +L+D  
Sbjct: 560 DE-NAIRSSHQLFQLLSLVLDSIGLFALDGVLLDRLADYIQERVAIAERNSKLCHLLDDK 618

Query: 650 NNIFSHXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTQKEALPMYSVDYLEL 700
            N                                 + +EA+P Y+V+YL+L
Sbjct: 619 QN--------------------SRGFAKSGAGSVGSTREAVPKYTVEYLDL 649

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  506 bits (1302), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 284/660 (43%), Positives = 408/660 (61%), Gaps = 50/660 (7%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPS+SQPFRLT LPKIASL+NY+ QG+Y+QV   T  PTTN + +GVSGSA+SQYIINPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVA-DTLTPTTNNINVGVSGSAVSQYIINPT 59

Query: 61  PKLIFNYPIPSTNIVTACDVLE--NDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSAT 118
           PKL++N PI STN+V+AC V E    ++  + EV C+G+ +N+ Y+L    K    +++ 
Sbjct: 60  PKLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASD 119

Query: 119 MXXXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXMIVLENGLIQFFNSSLKL 178
                              N                      + VL +GLIQFF+  LKL
Sbjct: 120 SSFGETYAAHKVSVSDQIVNLKVFPDTKSI------------VAVLRSGLIQFFDFELKL 167

Query: 179 LNTVKINYKNVKFVEHF-KEDNKDFMFTICDLGDNNKVCIKLFQIN-NDSAI---ELNSI 233
            +++  +YKNV +V+HF  E  + + F + D+ D +KV  KLF+I  +DSA    EL+S+
Sbjct: 168 QHSLDSSYKNVSYVQHFTSESGQRYTFLLSDI-DGHKVSFKLFEIGQSDSATPATELSSV 226

Query: 234 IMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPIST 293
           I+EN   ++++  YQFG+ Y+L  N + +Y+LP FQ   T  +P +   + I+S KPIST
Sbjct: 227 ILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPHFQHSRTIELPFL-APESIISFKPIST 285

Query: 294 NRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVI-GKGENNNKTITIGVSTKF 352
           NR LLT +NKI+LLDL+HN+ILS+RE+ H+K  QLL +AVI G    NNKTI +GVS K 
Sbjct: 286 NRALLTSDNKIFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIKH 345

Query: 353 GVNPTSSLEIINVDVGSNTLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNTXXXXXXXX 412
           G NP+SSL+IIN+DVG+ TL+DS+GK F            +Q L+PL             
Sbjct: 346 GSNPSSSLDIINIDVGTGTLRDSMGKGFMSREN------KSQHLQPLIS----------- 388

Query: 413 XXXXVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKL 472
                   +FNYD IL +LS+  ++I  FD +FF+   IK  +YT++DRF+ + EF   +
Sbjct: 389 TLNDTEAAEFNYDRILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDV 448

Query: 473 IDLIFEKFGSTATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLFKQAIVTCX 532
             LIF+ F S        EYPK            +  T +LL +  +HPRLFKQAIVTC 
Sbjct: 449 STLIFKSFKS--------EYPKALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCP 500

Query: 533 XXXXXXXXXXXXTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDEI 592
                       T+ N+EL LD+SLRILQD++KDSIK+ ++   ++++ NFI+F++++  
Sbjct: 501 NLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISENF 560

Query: 593 KDDQ--NSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNN 650
           ++D+  N P+LFQLL+LVLDS+GLFAL + +LE L+ YID+Q+S+V++N EL+ L++  N
Sbjct: 561 EEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVEEKN 620

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  504 bits (1299), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 304/743 (40%), Positives = 416/743 (55%), Gaps = 88/743 (11%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPSLSQPFRL VLPKIASLSNYSLQ DY+QV   TF   TNKV +G+SGS ISQYIINPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 61  PKLIFNYPIPSTNIVTAC---------------------DVLENDNDNTNNEV------- 92
           PKL+FN  IPSTN VTA                      D+++ DN  +  EV       
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 93  --------WCFGLVANKTYTLTLITKDKQKSSATMXXXXXXXXXXXXXXXXXFNXXXXXX 144
                   W +GLVANK+ TL +  K       +                   N      
Sbjct: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180

Query: 145 XXXXXXXXXXXXXXXXMIVLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKDFMF 204
                           ++VL+NGL++ F+  L L +++ I Y +V+FV+HF E  ++F+ 
Sbjct: 181 FKTI------------VVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLL 228

Query: 205 TICDLGDN-NKVCIKLFQINNDS----AIELNSIIMENFNGQNAKFCYQFGKFYKLTNNN 259
            + ++ +  + VC KL+Q+  DS      EL+  I+++F+   +K  YQFGK Y+LT + 
Sbjct: 229 ILSNIDEEKSSVCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSE 288

Query: 260 LMVYSLPQFQLEHTTTIPMIKTDD-QIVSMKPISTNRILLTINNKIYLLDLIHNSILSER 318
           L VYSLPQ QL    ++  I  +   + S+KP++ NR++L INN +YL+D +H SIL+ER
Sbjct: 289 LFVYSLPQCQLLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAER 348

Query: 319 ELTHLKSLQLLRSAVIGKGENNNKTITIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGK 378
           E TH+K+ QLL+SA IG      +TI IGVSTK G    S+LE+IN++VGS TLKDSLGK
Sbjct: 349 EFTHVKTFQLLQSATIGDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGK 408

Query: 379 CFXXXXXXXXXXXSTQALKPLFDPNTXXXXXXXXXXXXVTKEQFNYDEILTKLSENTNDI 438
                        S   LKPLFD N                + FN+++IL  L ++++ I
Sbjct: 409 GV----SKKLSEGSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADL-KSSDTI 463

Query: 439 GKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGSTATTAQTNEYPKXXXX 498
             FD+ FF+S  IK+ HYTENDRFI + +F    IDLIF+KF +        E+PK    
Sbjct: 464 SDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFDT--------EFPKAFTF 515

Query: 499 XXXXXXXXMERTQSLLSRFANHPRLFKQAIVTCXXXXXXXXXXXXXTIKNNELSLDISLR 558
                   ++ T  LL +  +HPRLFKQAIVTC             T+KN EL+LDISLR
Sbjct: 516 LLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLR 575

Query: 559 ILQDYSKDSIKQELRNLPRLEIENFIDFILNDEIKDDQ-NSPQLFQLLALVLDSIGLFAL 617
           +LQDYS++ +KQE++ L  ++IENFI+FI+    ++ Q N+PQLFQLL+LVLDSIGLFAL
Sbjct: 576 VLQDYSRNDVKQEIKKLDNVDIENFIEFIITPTTEEIQTNTPQLFQLLSLVLDSIGLFAL 635

Query: 618 SDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSHXXXXXXXXXXXXXXXXXXXXXX 677
              +LE LS YI+ QV+I E+++ELW+L+D++                            
Sbjct: 636 KGPLLERLSNYINEQVTIAERSSELWHLLDTSTT--------------------PRPFKN 675

Query: 678 XXXXXXFTQKEALPMYSVDYLEL 700
                    KE L +YSVDYL++
Sbjct: 676 AYLKSVIGNKETLSVYSVDYLDI 698

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  500 bits (1287), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 290/716 (40%), Positives = 414/716 (57%), Gaps = 68/716 (9%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPS+ QPFRL+VLP+I +LSNY +Q DY++V+ S  +P +NK+ IG+S SAISQYI+NPT
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVS-SDISPNSNKITIGISESAISQYILNPT 59

Query: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATMX 120
           PKL+ N  IPSTN+V+ACDV    +D    E+WC+ + + K++ L    K     +    
Sbjct: 60  PKLLSNISIPSTNVVSACDVATLADDK---EIWCYCVKSGKSHFLNASVKPVDADTV--- 113

Query: 121 XXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXMIVLENGLIQFFNSSLKLLN 180
                                                   ++VLE+GLIQ+++  L+ L+
Sbjct: 114 --------LDTDGGDKTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLS 165

Query: 181 TVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQI------NNDSAIELNSII 234
           ++ I+Y+NVK V +F E+ ++FMF +    +NNKVC KLF++       +    EL++ I
Sbjct: 166 SLDISYQNVKVVNYFSENGQNFMFVLSGF-ENNKVCFKLFELLYHDGKRHTPIKELSTTI 224

Query: 235 MENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMI-KTDDQIVSMKPIST 293
           +ENFN   +K CYQ GK Y+L  + +  Y+LPQ  L  TT +PMI   + Q VS+ P+ST
Sbjct: 225 LENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVST 284

Query: 294 NRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIG-----KG-ENNNKTITIG 347
           NRILLT+NN++YLLDL+H+S+LSER LTH K+ QLLRSA +      KG E   +T+ IG
Sbjct: 285 NRILLTVNNQVYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIG 344

Query: 348 VSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNTXXX 407
           V+TK G NPTS+LE+INVDVG+ TLKDSLGK F            T  L+PLF  +    
Sbjct: 345 VTTKNGNNPTSALEVINVDVGTGTLKDSLGKSFQSINDS-----KTHNLQPLFSDDESDA 399

Query: 408 XXXXXXXXXVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHE 467
                    V    F Y++I  +LS+N   I KFD  F +  NI++EHYT+ +RFI + E
Sbjct: 400 GDNADSDEVVA---FAYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQE 456

Query: 468 FFLKLIDLIFEKFGSTATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLFKQA 527
           F  K++ LI + F          EYP+             + T+ LL RF NHPRLFKQA
Sbjct: 457 FLSKVVRLILDSFD--------QEYPRALTFLLTHPLFPTDCTRGLLERFRNHPRLFKQA 508

Query: 528 IVTCXXXXXXXXXXXXXTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFI 587
           IVTC             +I N EL LDISLRILQD++ D IK E++ L ++++ NF++F+
Sbjct: 509 IVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFL 568

Query: 588 L---NDEIKDDQNSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWY 644
           +   ++E+  ++++ +LFQLL+LV+D+IGLFAL   +L+ LS YID QV + E+N  LW 
Sbjct: 569 ISPKDEELIQNKSTYELFQLLSLVIDAIGLFALDGALLQRLSDYIDEQVYLAERNARLWN 628

Query: 645 LIDSNNNIFSHXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTQKEALPMYSVDYLEL 700
           L+D+ N                                   +++ LP Y+V+YLEL
Sbjct: 629 LLDTRNK--------------------NRGATGSLAGSSRAKEQTLPKYTVEYLEL 664

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  494 bits (1272), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 279/662 (42%), Positives = 399/662 (60%), Gaps = 56/662 (8%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           M  ++QPFRL  LPKI+SL+NY+ Q  Y+QV      PT+N V +GVSGS+ISQY+INPT
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVA-DVLEPTSNTVTVGVSGSSISQYVINPT 59

Query: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVAN-KTYTLTLITKDKQKSSATM 119
           PKL++N PIPSTN+VT CDVL   +     E+W + L AN K +TL  + +   K+ A  
Sbjct: 60  PKLVYNIPIPSTNVVTGCDVLAMSD---GAELWSYALTANGKVHTLHAVLR---KAGAAP 113

Query: 120 XXXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXMIVLENGLIQFFNSSLKLL 179
                                                    M+VL+ GLIQ ++  L+LL
Sbjct: 114 QETGLDASED--------EHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLL 165

Query: 180 NTVKINYKNVKFVEHFKED-NKDFMFTICDLGDNNKVCIKLFQINNDSA----IELNSII 234
           +++ I+Y NV  VE+F +   KD+MF +CD+  N K C KLFQ+N+ +      ELNS+I
Sbjct: 166 HSLDISYTNVGLVEYFTDSAGKDYMFVLCDI-QNKKTCYKLFQLNHSAENLPITELNSVI 224

Query: 235 MENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPISTN 294
           +E+F    +K  YQFGK Y+L ++ + VYSLP FQL H   +P ++ DDQ VS++ ISTN
Sbjct: 225 LEDFALAESKMVYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQ-VSLQAISTN 283

Query: 295 RILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIG---KGENNNKTITIGVSTK 351
           R+LLT  NKI+LLDL+HN+IL EREL+++K  QLLR+AVI     GE+N +T  IGVSTK
Sbjct: 284 RLLLTCCNKIFLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESN-RTFAIGVSTK 342

Query: 352 FGVNPTSSLEIINVDVGSNTLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNTXXXXXXX 411
            G NP+S+L+++ + VG+ TLKDSLGK F            T+ALKPLF  +        
Sbjct: 343 QGSNPSSALDVVTIAVGTGTLKDSLGKGFLSGEHR-----RTEALKPLFGTDDDE----- 392

Query: 412 XXXXXVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLK 471
                      ++  IL +L+  T     FD IF++    KKE+YTE+DRFI N EF   
Sbjct: 393 -------SPNIDFAAILAELTSRTTP-KAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAG 444

Query: 472 LIDLIFEKFGSTATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLFKQAIVTC 531
           ++D IF  F         +E+PK               T+ LL +   HPRLFKQA+VTC
Sbjct: 445 ILDHIFATFA--------DEFPKALIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTC 496

Query: 532 XXXXXXXXXXXXXTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILND- 590
                        T+ N+ELSLD+SLR+LQ+++K+ IKQ +R L R+++ NF++F++ D 
Sbjct: 497 PNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDS 556

Query: 591 -EIKDDQNS-PQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDS 648
            ++++ Q + PQLFQLL+LV+D++GL AL  +IL  LSA+ID QV++ ++  EL YL+++
Sbjct: 557 TDVEERQKAKPQLFQLLSLVIDAVGLLALEGDILHRLSAFIDSQVAVADQLVELLYLLEN 616

Query: 649 NN 650
           ++
Sbjct: 617 SS 618

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  494 bits (1271), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 280/655 (42%), Positives = 399/655 (60%), Gaps = 51/655 (7%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           M S+SQPFRL+ LPKI SL+NY+ Q DY+QV  +  +P+ NKV IG+SGS+ISQY+INPT
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINPT 59

Query: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATMX 120
           PKL+FN PIPSTNIVTACDV+E   D  N EVWC+GL A K   L L TK   + + +  
Sbjct: 60  PKLVFNLPIPSTNIVTACDVVE---DAANTEVWCYGLEARKVSHLHLATKPMIQDAVSSS 116

Query: 121 XXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXMIVLENGLIQFFNSSLKLLN 180
                            +                      +++L NGLIQ F+  LKL N
Sbjct: 117 NAEITSQFKYKLKSEVVSIKIYSKAEKV------------LVILRNGLIQTFDYELKLSN 164

Query: 181 TVKINYKNVKFVEHFKE-DNKDFMFTICDLGDNNKVCIKLFQINNDS--AIELNSIIMEN 237
           T+ I+Y +++FV+ F++    DF F +C L D  K+C KLFQ+ ++S   IELNSII+EN
Sbjct: 165 TIDISYDDIRFVQFFQDGQGNDFFFVLCQLSDE-KICYKLFQVRSESVSCIELNSIILEN 223

Query: 238 FNGQNAKFCYQFGKFYKLTNNN-LMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPISTNRI 296
           +  +NAK C++FGK Y L N+N L +Y LP  QL+ +  +P I + D +VS+KP+S+NR+
Sbjct: 224 YTLENAKLCFEFGKLYVLKNSNELSIYQLPHLQLQTSIQLPFI-SKDAVVSIKPVSSNRV 282

Query: 297 LLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIGK-GENNNKTITIGVSTKFGVN 355
           LLT +N IYL+DL++N+IL +++L ++K++QLL +AV+ +  E+N KTI + V+TK G N
Sbjct: 283 LLTADNTIYLVDLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGAN 342

Query: 356 PTSSLEIINVDVGSNTLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNTXXXXXXXXXXX 415
           PTS L++IN+DVG+ TLKD++GK F             Q L+ LF+ +            
Sbjct: 343 PTSYLDVINIDVGTGTLKDAMGKGFMVK--------QKQKLQKLFEESNEDDD------- 387

Query: 416 XVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDL 475
            V     +Y+ I+ +L      I  FD IFF+  ++ KE+YT+NDRF+ + +   ++ID 
Sbjct: 388 -VELPSPDYERIIKQL-HICKKIENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDC 445

Query: 476 IFEKFGSTATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLFKQAIVTCXXXX 535
           +F  F         +EYPK                + LL++  N+PRLFKQAIVTC    
Sbjct: 446 LFLNFK--------DEYPKALTYLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVP 497

Query: 536 XXXXXXXXXTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDEIKDD 595
                     I N EL  DI+LR+LQDY K+SIK  +R + +++I NF+D ILN    D 
Sbjct: 498 LDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKMDITNFLDMILNSNKADS 557

Query: 596 Q---NSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLID 647
               N PQ+FQL++L++DSIGLFAL D  LE LS+++D QVS+V +N EL +L +
Sbjct: 558 DLKLNKPQIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAE 612

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  474 bits (1221), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 282/660 (42%), Positives = 388/660 (58%), Gaps = 52/660 (7%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPSLSQPFRL +LPKIA LS+Y++Q   +QV    F   +NK+ IGVSG A+SQY+INPT
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINPT 59

Query: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNN--EVWCFGLVANKTYTLTLITK--DKQKSS 116
           P +    PIPSTN VTAC+V +  + +T    E+W + L  NK  TL +  K  D  K S
Sbjct: 60  PNVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFS 119

Query: 117 ATMXXXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXMIVLENGLIQFFNSSL 176
            T                                          ++ L NG IQ F+  L
Sbjct: 120 TTQSDA--------------LETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKL 165

Query: 177 KLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQI---NNDSAIELNSI 233
           KLLN+V  +Y N+ F EHF E+ K F   +  + + NK+  KL+++   +  S  EL+S 
Sbjct: 166 KLLNSVNTSYDNIYFSEHFVENKKSFAIILSTI-EGNKLSYKLYELFGQDKTSIKELSST 224

Query: 234 IMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIK-TDDQIVSMKPIS 292
           I+E+   +++K  YQFGK Y+L  N + VYSLPQ QL  T T+P I     Q +S KP+S
Sbjct: 225 ILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVS 284

Query: 293 TNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVI--GKGENNNKTITIGVST 350
            NRILLT++NKI++LDL+H + L+ER L H+K  QLL+S VI      NN+KTI IGVS 
Sbjct: 285 NNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSV 344

Query: 351 KFGVNPTSSLEIINVDVGSNTLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNTXXXXXX 410
           K G +P ++LEIIN +VG+ TLKDSLG  F            +  L+PLF  +       
Sbjct: 345 KNGPSPITALEIINANVGTGTLKDSLGNSFDVSKSF-----KSNILQPLFTDDANL---- 395

Query: 411 XXXXXXVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFL 470
                 V +  F Y+ IL KLS   NDI KFD+IFF    I++ +YT+N+RFI++  F  
Sbjct: 396 ------VKRHDFKYEAILKKLSSTENDIKKFDDIFFGDLYIQQNYYTDNERFIFDVTFLS 449

Query: 471 KLIDLIFEKFGSTATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLFKQAIVT 530
            +IDLIF+ F          EYP             + +T++LL +   HPRLFKQA+VT
Sbjct: 450 DVIDLIFKNF--------QKEYPSALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVT 501

Query: 531 CXXXXXXXXXXXXXTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFIL-- 588
           C             +I N ELS+DISLRILQDY+KDSIK EL+NL +++I+NFIDF++  
Sbjct: 502 CPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDP 561

Query: 589 NDEIKDDQNSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDS 648
           N+E ++ +++ QLF LL+LVLD+ GLF++   +L  LS YID+QV ++EK+ +LW+LID 
Sbjct: 562 NNE-EEKKHNEQLFVLLSLVLDASGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDG 620

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  467 bits (1202), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 272/687 (39%), Positives = 404/687 (58%), Gaps = 79/687 (11%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPSLSQPFRL VLPKIASL N+S +  YI+V  S F P +N V++G+SGS+IS+Y+I PT
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADS-FTPDSNSVLLGISGSSISKYVITPT 59

Query: 61  PKLIFNYPIPSTNIVTACDV--------LENDNDNTNNE-------------------VW 93
           P+LIFN PIPST++V+AC++        + +D   T +E                   +W
Sbjct: 60  PRLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIW 119

Query: 94  CFGLVAN-KTYTLTLITKDKQKSSATMXXXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXX 152
           C+ L AN KT+TL  + ++   ++ ++                 FN              
Sbjct: 120 CYALSANNKTHTLNCLIREVDNNNTSITENNPQ-----------FNAKFKEQIINIEVDT 168

Query: 153 XXXXXXXXMIVLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDN 212
                   +I+ E GL+QF++  LKLLN++   Y+++K V+ F+E+  ++M  I DL D 
Sbjct: 169 KHKVI---VILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQ 225

Query: 213 NKVCIKLFQINNDS--AIELNSIIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQL 270
            KV ++L++++ +     EL S I+ENFN Q++  CYQFG+ Y+L  + + VYS+P  QL
Sbjct: 226 -KVALQLYEVSTEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQL 284

Query: 271 EHTTTIPM---IKTDDQIVSMKPISTNRILLTINNKIYLLDLIHNSILSERELTHLKSLQ 327
                IP    I+  + ++S+KPI+TNR+LLT+ NKIYLLDL+H SILSERE++H+K+ Q
Sbjct: 285 NSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQ 344

Query: 328 LLRSAVIGKGENNNKTITIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFXXXXXXX 387
           +L++A+   G  +  T+ +G+STK G NPTS+LEIIN+DVGSN+LKDSLGK F       
Sbjct: 345 ILKTAMNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQI 404

Query: 388 XXXXSTQALKPLFDPNTXXXXXXXXXXXXVTKEQFNYDEILTKLSENTNDIGKFDEIFFQ 447
                    +P ++  +                  N+ EIL KL +N N   KFDE FF 
Sbjct: 405 QGQLKNLFPEPKYELPS-----------------INFPEILGKL-KNANSAEKFDETFFN 446

Query: 448 SFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGSTATTAQTNEYPKXXXXXXXXXXXXM 507
             NIK+E +TEN RF+ +  F   ++DLIF K     +       P+             
Sbjct: 447 LLNIKEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSC------PRSLMFLLTHPLFPK 500

Query: 508 ERTQSLLSRFANHPRLFKQAIVTCXXXXXXXXXXXXXTIKNNELSLDISLRILQDYSKDS 567
           E+   LL++  ++ RLFKQAIVTC             TIKN+EL +DIS+RILQDY+KD+
Sbjct: 501 EKAIGLLTKVKSNSRLFKQAIVTCPNLPLQELLQELFTIKNSELVVDISMRILQDYTKDA 560

Query: 568 IKQELRNLPRLEIENFIDFILNDEIKDDQNS------PQLFQLLALVLDSIGLFALSDNI 621
           IK+E++ L ++ +ENF++FI+    ++   S      PQ+F+LL+L+LDSIGLF L ++I
Sbjct: 561 IKEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGLEESI 620

Query: 622 LENLSAYIDRQVSIVEKNTELWYLIDS 648
           L  LS+ I+++V I E+N ELW ++D+
Sbjct: 621 LIQLSSIIEKEVKIAERNVELWNIMDA 647

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  295 bits (754), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 165/368 (44%), Positives = 228/368 (61%), Gaps = 28/368 (7%)

Query: 286 VSMKPISTNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVI-GKGENNNKTI 344
           +S  PIS NR LLT +NK+YLLDL+HN+ILS+RE TH+K+ QLL +AVI G   +NN TI
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 345 TIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNT 404
            IGV+TK G   TSSL+++N+DVG+ TLKDS+GK F           S      L  PN 
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSL-----LGTPND 115

Query: 405 XXXXXXXXXXXXVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIY 464
                          ++ NY +IL  L++  ++  KFD +FF+  NIK ++YT++DRF+ 
Sbjct: 116 TEV------------QEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLN 163

Query: 465 NHEFFLKLIDLIFEKFGSTATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLF 524
           + EF    + LIFE F S        EYPK            +  T  LL +  +HPRLF
Sbjct: 164 DQEFLGNSLKLIFENFQS--------EYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLF 215

Query: 525 KQAIVTCXXXXXXXXXXXXXTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFI 584
           KQAIVTC             T+ N+EL LD+SLRILQD+SKDSIK  ++   ++++  FI
Sbjct: 216 KQAIVTCPNLPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFI 275

Query: 585 DFILNDEIKDDQ--NSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTEL 642
           +F++N+ + +D+  N P+LFQLL LVLDS+GLFAL D  L+ LS YIDRQ+S+V++N +L
Sbjct: 276 NFVMNENVDEDRVKNKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQL 335

Query: 643 WYLIDSNN 650
           + L+D  N
Sbjct: 336 YNLVDERN 343

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  288 bits (737), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 226/662 (34%), Positives = 341/662 (51%), Gaps = 102/662 (15%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPS+SQPF +T +PK +S S        I V+  +    +N + + +S  A+S+++INPT
Sbjct: 1   MPSISQPFAITTVPKQSSTSP-------IIVSSHSLTANSNSLDVAISKYAVSKFVINPT 53

Query: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATMX 120
           PKLI + PIPS  +VTA           ++ V+    V N+ YTL L  K     S  M 
Sbjct: 54  PKLINSIPIPSNEVVTAF----------HDTVFATATV-NQKYTLHLNGKKVPIQSKIMK 102

Query: 121 XXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXMIVLENGLIQFFNSSLKLLN 180
                                                   + +LENG I+ ++S+L + +
Sbjct: 103 LFSDESQT--------------------------------ITILENGTIEKYDSNL-IKS 129

Query: 181 TVKINYK---NVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQINNDSAIELNS----- 232
           T K  +K   NV+F+E        +   I       +  I L+ IN  + IEL +     
Sbjct: 130 TYKTPHKDLVNVEFIE------SKYALLIS------QNSISLYDIN--TMIELRNVANVQ 175

Query: 233 -IIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMI-KTDDQIVSMKP 290
            I+  +F   + K  YQF +  KL+  +  ++ +    + +  TIP I   +  +VS   
Sbjct: 176 DIVDSDFKSLDGKL-YQFNQ--KLSKFD--IWEISSMTIVNIITIPFINDVEKDVVSFTV 230

Query: 291 ISTNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIGKGENNNKTITIGVST 350
           +  N +++ +N+ IY L+L  +S++S  EL +LK  +L+        +N +    +G+S 
Sbjct: 231 VDDNCVVMAVNSTIYALNLHLSSVISMSELLNLKWFKLI--------DNLSNQFVLGLSF 282

Query: 351 KFGVNPTSSLEIINVDVGSN-TLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNTXXXXX 409
               N     E+IN+D+ SN  LKDSLGK F            T  LK LF  +      
Sbjct: 283 N---NENYKFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDL 339

Query: 410 XXXXXXXVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFF 469
                  V +  FNYD+I+  L++   +  KFD+IFF+ FNIKKEHYTE DRF+ N +F 
Sbjct: 340 HNDSDSDV-EHTFNYDKIIVDLNKAVKNPSKFDKIFFEKFNIKKEHYTEADRFLVNQDFL 398

Query: 470 LKLIDLIFE--KFGSTATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLFKQA 527
            K+I+LI +  KF +       N YPK            +  T++LL +F   PRL+KQA
Sbjct: 399 AKVIELILQNYKFDTDG-----NNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQA 453

Query: 528 IVTCXXXXXXXXXXXXXTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFI 587
           IVTC             TI+NNELSLDISLR+LQDY+KDSIK++++ LP+++I NFI+F+
Sbjct: 454 IVTCPNLPLGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFV 513

Query: 588 LNDEIKDDQNSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLID 647
             DE  D Q S QLFQLL+L++DSIGLFAL  +IL  +S +I+ +  + ++N+EL +L+D
Sbjct: 514 TQDE--DQQVSSQLFQLLSLIIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLHLLD 571

Query: 648 SN 649
            N
Sbjct: 572 YN 573

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  243 bits (621), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 157/460 (34%), Positives = 229/460 (49%), Gaps = 51/460 (11%)

Query: 248 QFGKFYK--LTNNNLMVYSLPQFQLEHTTTIPMIKTDDQI-VSMKPISTNRILLTINNKI 304
             GK Y+  L  N+  ++ L          IP +       ++   +  +R+ L + N+I
Sbjct: 192 HLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLALANEI 251

Query: 305 YLLDLIHNSILSERELTHLKSLQLLRSAVIGKGENNNKTITIGVSTKFGVNPTS-SLEII 363
           YLLDL   S+LS  +   LK ++L+  A  G         +  ++   G    + SL+II
Sbjct: 252 YLLDLHLGSVLSHNKFAQLKQVELIAGARDG---------SFAIALSHGPQDNAVSLDII 302

Query: 364 NVDVGSNTLKDSLGKCFXXXXXXXXXXXSTQALKPLFDPNTXXXXXXXXXXXXVTKEQFN 423
           N+++GS ++KDSLGK F           S   L+P+ D                TK  F+
Sbjct: 303 NLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDK------------TKRSFD 350

Query: 424 YDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGST 483
           Y  IL KL+    D  KFD+IFF+   I +E YTE DRFI +  F  + + +I + +   
Sbjct: 351 YASILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNY--- 407

Query: 484 ATTAQTNEYPKXXXXXXXXXXXXMERTQSLLSRFANHPRLFKQAIVTCXXXXXXXXXXXX 543
            +   +++YP              ++T+ LLS+    PRL+KQ IVTC            
Sbjct: 408 -SFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTES 466

Query: 544 XTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDEIKDDQNS---PQ 600
             I+NNELSLD+SL+ILQDY+KDSIK+E++ LPR+ + NFI F++ +    D++S   PQ
Sbjct: 467 FVIENNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQ 526

Query: 601 LFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSHXXXXX 660
           LFQLL+LV+DSIGLFAL   +L  L+ YID  V I E NTELW L++   N  S      
Sbjct: 527 LFQLLSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNR 586

Query: 661 XXXXXXXXXXXXXXXXXXXXXXXFTQKEALPMYSVDYLEL 700
                                   TQK+  P Y VD+LE+
Sbjct: 587 SKYVK-------------------TQKKVFPPYLVDHLEI 607

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 53/97 (54%), Gaps = 12/97 (12%)

Query: 3  SLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPTPK 62
          S+SQPF +  +P+ AS +        + +++ +     N + + VS  +ISQYIINPTPK
Sbjct: 4  SISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56

Query: 63 LIFNYPIPSTNIVTACDVLEND--NDNTNNEVWCFGL 97
          L+ +  IPS   VTA D   N      +NN+ +C  L
Sbjct: 57 LVNSKAIPSNLTVTAFD---NGVYATQSNNKSFCLYL 90

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  177 bits (449), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 133/227 (58%), Gaps = 20/227 (8%)

Query: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60
           MPS+SQPFRLT LPKIASL+NY+ QG Y+QV   T  P TN+V +G+SGSAISQY+INPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVAD-TLTPATNRVNVGISGSAISQYVINPT 59

Query: 61  PKLIFNYPIPSTNIVTACDVLE-----NDNDNTNNEVWCFGLVANKTYTLTLITKDKQKS 115
           PKL++N PI STN+VTACDV E     N+     +EV C+ L ANKT+++  + K    S
Sbjct: 60  PKLVYNLPISSTNVVTACDVAEVAGTNNEGTAEAHEVLCYALQANKTFSICAV-KKPIPS 118

Query: 116 SATMXXXXXXXXXXXXXXXXXFNXXXXXXXXXXXXXXXXXXXXXXMIVLENGLIQFFNSS 175
           +AT                  +                       + VL +GLIQFF+  
Sbjct: 119 AAT-----------DSSFGETYATHKVALANQAVNVKVFPATKSIVAVLSSGLIQFFDYD 167

Query: 176 LKLLNTVKINYKNVKFVEHF-KEDNKDFMFTICDLGDNNKVCIKLFQ 221
           LKL +++  +Y NV+FV+HF  E  +DFMF + DL D  KV  KL +
Sbjct: 168 LKLQHSIDSSYGNVQFVQHFVSESKQDFMFLLSDL-DGRKVSFKLLK 213

>NCAS0E03930 Chr5 (770838..771674) [837 bp, 278 aa] {ON} 
          Length = 278

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%)

Query: 169 IQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQI 222
           I+ F    K++N  ++N +  KF+E+  ED ++F  ++ D G  ++  I+L ++
Sbjct: 180 IEQFEPERKMVNDEEVNKQFSKFIENMNEDIQEFTESLADTGVPHEQIIELKRV 233

>Skud_9.124 Chr9 (240000..241610) [1611 bp, 536 aa] {ON} YIL045W
           (REAL)
          Length = 536

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 41  NKVVIGVSGSAISQYIIN--PTPKLIFNYPIPSTNIVTACDVLENDNDNTNNEVW 93
           N+  I VS   I Q ++N    P   F  PI STN V   D+L  DN N   + W
Sbjct: 209 NEKPIDVSKQMIQQDVLNFQHKPLTRFGGPIGSTNSVPIEDLLSEDNRNEYEDTW 263

>TPHA0H02090 Chr8 (493355..494356) [1002 bp, 333 aa] {ON} Anc_6.292
          Length = 333

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 247 YQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPISTNRILLTINNKI 304
           +++    K T + L  YSLP F L+H + +P    D  I+  +P ST R   T+NN+I
Sbjct: 192 FEYDSSIKKTIHYLNTYSLPNFNLKHYSRLPEGYIDYVILQPQP-STIRTCNTLNNEI 248

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,100,050
Number of extensions: 3156643
Number of successful extensions: 10540
Number of sequences better than 10.0: 55
Number of HSP's gapped: 10727
Number of HSP's successfully gapped: 74
Length of query: 700
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 583
Effective length of database: 40,065,477
Effective search space: 23358173091
Effective search space used: 23358173091
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)