Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G009503.490ON2132139691e-134
NCAS0E008203.490ON2022012794e-30
TDEL0D055803.490ON1932032522e-26
ZYRO0D10032g3.490ON2092132507e-26
KLTH0F14784g3.490ON1952052313e-23
SAKL0F02816g3.490ON1921982252e-22
YGR129W (SYF2)3.490ON2152212263e-22
Skud_7.4403.490ON2132192169e-21
Smik_6.2253.490ON2132152045e-19
Kwal_55.212263.490ON1962051931e-17
AFR308W3.490ON1921961782e-15
Kpol_480.153.490ON2071991792e-15
CAGL0I10538g3.490ON2002001782e-15
KLLA0E04643g3.490ON2212051741e-14
Suva_7.4173.490ON2122081661e-13
Ecym_12393.490ON1932041572e-12
TPHA0D042403.490ON2092061194e-07
KNAG0B008203.490ON2071711106e-06
TBLA0C044703.490ON2221871106e-06
Smik_14.3536.322ON56644665.2
SAKL0G07832g5.390ON69057649.6
NOTE: 1 genes in the same pillar as NDAI0G00950 were not hit in these BLAST results
LIST: KAFR0C01950

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00950
         (213 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...   377   e-134
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...   112   4e-30
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....   101   2e-26
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...   100   7e-26
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    94   3e-23
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...    91   2e-22
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...    92   3e-22
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...    88   9e-21
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...    83   5e-19
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    79   1e-17
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    73   2e-15
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    74   2e-15
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    73   2e-15
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    72   1e-14
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...    69   1e-13
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    65   2e-12
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    50   4e-07
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    47   6e-06
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    47   6e-06
Smik_14.353 Chr14 (628425..630125) [1701 bp, 566 aa] {ON} YNR023...    30   5.2  
SAKL0G07832g Chr7 (656128..658200) [2073 bp, 690 aa] {ON} simila...    29   9.6  

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score =  377 bits (969), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 192/213 (90%)

Query: 1   MKQEELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHT 60
           MKQEELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHT
Sbjct: 1   MKQEELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHT 60

Query: 61  DYDGLGDFSNEEEKRKFKLMNYTIREYEEWXXXXXXXXXXXVDGSDLTELATFTYEKELS 120
           DYDGLGDFSNEEEKRKFKLMNYTIREYEEW           VDGSDLTELATFTYEKELS
Sbjct: 61  DYDGLGDFSNEEEKRKFKLMNYTIREYEEWDKQQKDKQRKRVDGSDLTELATFTYEKELS 120

Query: 121 KLNSKLENISHEQKHQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKKLQSK 180
           KLNSKLENISHEQKHQIGVNTRNGKLNVKDEER          ETAKKRYMVRKKKLQSK
Sbjct: 121 KLNSKLENISHEQKHQIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSK 180

Query: 181 ASSDIAGNYFKDKNKQFNEKLERELKERDNGGD 213
           ASSDIAGNYFKDKNKQFNEKLERELKERDNGGD
Sbjct: 181 ASSDIAGNYFKDKNKQFNEKLERELKERDNGGD 213

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score =  112 bits (279), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 74/201 (36%), Positives = 112/201 (55%), Gaps = 10/201 (4%)

Query: 5   ELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDG 64
           +L+ Y   LK LKR   D   ENR   D+E K+   S KP+VY+++  +D DN       
Sbjct: 3   DLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQ--DDQDNQ------ 54

Query: 65  LGDFSNEEEKRKFKLMNYTIREYEEWXXXXXXXXXXXVDGSDLTELATFTYEKELSKLNS 124
           L     + + +  KLMNYT+R+YEEW                + +LA F+Y+K +S LN 
Sbjct: 55  LETQEEDADDKVAKLMNYTLRQYEEWEKKQKDKKIKDDSSD-MKQLAMFSYDKGVSNLNR 113

Query: 125 -KLENISHEQKHQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKKLQSKASS 183
            + +  + E++ QI VN++ GK+N++DE++          +TA KRYMV KKKL +++  
Sbjct: 114 FRTDKTTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKD 173

Query: 184 DIAGNYFKDKNKQFNEKLERE 204
             A  Y  ++NK FNEKL+RE
Sbjct: 174 SSAEGYINERNKHFNEKLDRE 194

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score =  101 bits (252), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 110/203 (54%), Gaps = 14/203 (6%)

Query: 5   ELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDG 64
           +L+  E   K LK+  +D+  + RK A++E K++S   KPK+Y ++   +      D   
Sbjct: 2   DLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVD--- 58

Query: 65  LGDFSNEEEKRKFKLMNYTIREYEEWXXXXXXXXXXXVDGSDLTELATFTYEKELSKLNS 124
                   E+R+ KLMNY++REYEEW             G+++ ELA ++YEK+LS+  S
Sbjct: 59  ------SSERRRLKLMNYSMREYEEWDKKQKGKEVKR-GGANVQELAKYSYEKDLSR--S 109

Query: 125 KLENISHEQKHQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKKLQSKASSD 184
           K  N +   K  I  + +  +L VKD+E+          +T ++R++ RKK ++   +  
Sbjct: 110 KQNNGNRVVK--ISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARA 167

Query: 185 IAGNYFKDKNKQFNEKLERELKE 207
             G Y  +KNKQFN KL+R++KE
Sbjct: 168 TPGGYINEKNKQFNLKLDRQMKE 190

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score =  100 bits (250), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 115/213 (53%), Gaps = 23/213 (10%)

Query: 3   QEELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDY 62
           Q +LD + ++  ALK+   +I  ENRK  + E KE +   KP+VY ++A E         
Sbjct: 10  QMDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEP-------- 61

Query: 63  DGLGDFSNEEEKRKFKLMNYTIREYEEWXXXXXXXXXXXVDGSDLTELATFTYEKELSKL 122
                   +++K   +LMNYTI++YEEW            D  +L ++A +TY+KEL+KL
Sbjct: 62  ----SLPTQDDKHGNQLMNYTIQQYEEWNSRQRDQTNKR-DSGNLQDMAKYTYDKELNKL 116

Query: 123 --NSKLEN--ISHEQKHQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKKLQ 178
             ++ L+N   +     ++  N + GKL +KD+++          +TA +RY  R+++++
Sbjct: 117 HKDTMLQNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREME 176

Query: 179 ----SKASSDIAGNYFKDKNKQFNEKLERELKE 207
                 ASS   G Y  +KNKQFNEKL+R++ +
Sbjct: 177 RSNVQNASS--GGGYINEKNKQFNEKLDRQMPQ 207

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 93.6 bits (231), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 109/205 (53%), Gaps = 13/205 (6%)

Query: 5   ELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDG 64
           +L+ Y + LK LKR  + +  +N+++  QE K+ S  +KP VY +K  E   +  T    
Sbjct: 2   DLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETT---- 57

Query: 65  LGDFSNEEEKRKFKLMNYTIREYEEWXXXXXXXXXXXVDGSDLTELATFTYEKELSKLNS 124
                  EE ++ KL+ Y+++++E+W            D +   +LA FTY+KE+ +L  
Sbjct: 58  -------EESKEAKLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRK 110

Query: 125 KLENISHEQKHQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKKLQSKASSD 184
              N   E+  ++ +N + GK+ VKD+            +TA +RY   +KK+  +  SD
Sbjct: 111 NYTN-KVEKPKKVSIN-KKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSD 168

Query: 185 IAGNYFKDKNKQFNEKLERELKERD 209
             G +  +KNKQFN+K+ER+ K+R+
Sbjct: 169 TPGGFINEKNKQFNDKIERQTKKRE 193

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score = 91.3 bits (225), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 111/198 (56%), Gaps = 16/198 (8%)

Query: 13  LKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEE 72
           LK LKR  +D+  +NRK A++E K+  QS KPKVY +    ++D    D         +E
Sbjct: 10  LKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSM----NEDETFKD--------QKE 57

Query: 73  EKRKFKLMNYTIREYEEWXXXXXXXXXXXVDGSDLTELATFTYEKELSKLNSKLENISHE 132
           E  + KL+NY+I++YE+W            DGS   +LA +TY+KE+ ++  K  +++  
Sbjct: 58  EDTRGKLLNYSIKDYEKWQLKRTAKLKNS-DGSSQQDLAKYTYDKEIREM-EKDGSLNRG 115

Query: 133 QKHQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKKLQSKASSDIAGNYFKD 192
           +  +  +N + G++ + D+++          ++ K+RY+ RKK+ + K  S   G +  D
Sbjct: 116 KVTKARLNGK-GRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAE-KLDSSTTGGFIND 173

Query: 193 KNKQFNEKLERELKERDN 210
           KNKQFNEKL R+ K+ D+
Sbjct: 174 KNKQFNEKLSRQFKQFDD 191

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score = 91.7 bits (226), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 115/221 (52%), Gaps = 29/221 (13%)

Query: 6   LDVY--EENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYD 63
           +D Y  +E LK LKR  +D+  ++RK AD+E++E S + KP+VY ++ V D D      +
Sbjct: 1   MDFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDAD------E 54

Query: 64  GLGDFSNEEEKRKFKLMNYTIREYEEWXXXXXXXXXXXVD--GSDLTELATFTYEKELSK 121
            +GD  + E+++ F   +YT++EY+ W               G    +LA  +YEK L  
Sbjct: 55  SVGDTESPEKEKAF---HYTVQEYDAWERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRN 111

Query: 122 LNSKLENISHE-------------QKHQIGV---NTRNGKLNVKDEERXXXXXXXXXXET 165
           L ++ +N S +             +K +IG    +T+ GK+ + D+++            
Sbjct: 112 LATQTQNSSKQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSE 171

Query: 166 AKKRYMVRKKKLQSKASSDIAGNYFKDKNKQFNEKLERELK 206
           +KKRY  RK+++Q+  +     ++  DKNKQFNEKL RE K
Sbjct: 172 SKKRYEARKRQMQNAKTLYGVESFINDKNKQFNEKLSRESK 212

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 87.8 bits (216), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 106/219 (48%), Gaps = 25/219 (11%)

Query: 5   ELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDG 64
           ELD  ++ LK LKR  +++  +NRK AD+E++E   + KPKVY ++ V D         G
Sbjct: 2   ELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVND---------G 52

Query: 65  LGDFSNEEEKRKFKLMNYTIREYEEWXXXXXXXX--XXXVDGSDLTELATFTYEKELSKL 122
                + E   K K  +YT++EY  W               G+   ++A  +YEK L  L
Sbjct: 53  AEPVEDAETSDKDKAFHYTVQEYNAWKQKQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNL 112

Query: 123 ---------NSKLENISHEQK-----HQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKK 168
                    NS  +N S+        H+I  N + GK+ + D+++            +KK
Sbjct: 113 VTQNSNKNENSVNKNDSNSSPKNGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKK 172

Query: 169 RYMVRKKKLQSKASSDIAGNYFKDKNKQFNEKLERELKE 207
           RY  R+K++++  +     ++  DKNKQFNEKL RE K+
Sbjct: 173 RYEARRKQMENAKTPSSVESFINDKNKQFNEKLSREPKD 211

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 83.2 bits (204), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 109/215 (50%), Gaps = 25/215 (11%)

Query: 6   LDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGL 65
           LD  E+ LK LK+  +++  +NRK AD+E++E + + KP+VY+++ + D D      + +
Sbjct: 3   LDQLEQRLKELKKKRVNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVD------ESV 56

Query: 66  GDFSNEEEKRKFKLMNYTIREYEEWXXXXXXXXXXXVDGSDLT--ELATFTYEKELSKLN 123
           G   + ++ R F   +YT +EY  W              S ++  +LA  +YEK L  L 
Sbjct: 57  GYTESSDKDRAF---HYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLA 113

Query: 124 ----SKLENISHEQKH----------QIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKR 169
               S+ +N  +E+ H          +I  +T+ GK+ + D+ +            +KKR
Sbjct: 114 TQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKR 173

Query: 170 YMVRKKKLQSKASSDIAGNYFKDKNKQFNEKLERE 204
           Y  RK++++S        ++  DKNKQFNEKL RE
Sbjct: 174 YEARKRQMESAVIPSGVESFINDKNKQFNEKLSRE 208

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 79.0 bits (193), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 106/205 (51%), Gaps = 13/205 (6%)

Query: 5   ELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDG 64
           +L  Y + LK LKR  +D+  +N+    +E K  S S KP VY + A           +G
Sbjct: 2   DLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNA-----------EG 50

Query: 65  LGDFSNEEEKRKFKLMNYTIREYEEWXXXXXXXXXXXVDGSDLTELATFTYEKELSKLNS 124
             +   ++     KL+ Y++ EYE+W             G+   +LA  TY+KE+ +L S
Sbjct: 51  AEEEIAKDVTEANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQL-S 109

Query: 125 KLENISHEQKHQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKKLQSKASSD 184
           K++     +  +  VN + GK+ V+D+++          +TA +RY   +KK+  + ++ 
Sbjct: 110 KIDGNRVNKNTKYRVNNK-GKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNT 168

Query: 185 IAGNYFKDKNKQFNEKLERELKERD 209
            +G Y  +KNKQFN+KLER+ K+R+
Sbjct: 169 TSGGYINEKNKQFNDKLERQTKKRE 193

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 73.2 bits (178), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 92/196 (46%), Gaps = 15/196 (7%)

Query: 13  LKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEE 72
           L+ LK+  +D    NRK A  E + +    KP+VY +     D+            +++ 
Sbjct: 10  LRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEA----------EADDT 59

Query: 73  EKRKFKLMNYTIREYEEWXXXXXXXXXXXVDGSDLTELATFTYEKELSKLNSKLENISHE 132
           +  + KL+NY I +YE+W            DG+DL ELA  TY  EL +L+ +       
Sbjct: 60  QSEQLKLLNYRIADYEKWDEKQKRHKQPS-DGADLGELANSTYRSELHQLHRRGVVKGRA 118

Query: 133 QKHQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKKLQSKASSDIAGNYFKD 192
              +I  +   GK+ + DE            +TAK+R+  R+KK         AG+   D
Sbjct: 119 TNGRISAS---GKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGS-LND 174

Query: 193 KNKQFNEKLERELKER 208
           KN+ FNEKL+RE ++R
Sbjct: 175 KNRHFNEKLDREFRKR 190

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 73.6 bits (179), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 104/199 (52%), Gaps = 15/199 (7%)

Query: 11  ENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSN 70
           E  K LKR  +DI+ ENRK  D   +E  ++SKPK Y ++ + +DD  +T   G  D ++
Sbjct: 10  EEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNT---GTVDEAD 66

Query: 71  EEEKRKFKLMNYTIREYEEWXXXX-XXXXXXXVDGSDL---TELATFTYEKELSKLNSKL 126
                  +L+NY+IREYEEW            V  S +    ++A FTY+K++ KL  + 
Sbjct: 67  -------RLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQK 119

Query: 127 E-NISHEQKHQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKKLQSKASSDI 185
             N +  +  +I  + + GK+ V D ++          +T K+RY    +K Q  +  + 
Sbjct: 120 STNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNE 179

Query: 186 AGNYFKDKNKQFNEKLERE 204
             +Y  +KNK+FN+KLER+
Sbjct: 180 NYSYINEKNKEFNDKLERQ 198

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 73.2 bits (178), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 93/200 (46%), Gaps = 12/200 (6%)

Query: 6   LDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGL 65
           L+ Y E LK LK+SV DI   NR    QE +EK +  KP+VY +   EDD +     D  
Sbjct: 3   LEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSDEQ 62

Query: 66  GDFSNEEEKRKFKLMNYTIREYEEWX---XXXXXXXXXXVDGSDLTELATFTYEKELSKL 122
            D        +  L  YT++++ +W                G  L  LA  TY+KEL  L
Sbjct: 63  SDM-------RTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNL 115

Query: 123 NSKLENISHEQKHQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKKLQSKAS 182
             + E     ++ Q  +N  +GK+N+KD +           ETAK+RY   +K    K  
Sbjct: 116 -PRPEFKMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIANDKEH 174

Query: 183 SDIAGNYFKDKNKQFNEKLE 202
           + ++G+    KN QFN+ L+
Sbjct: 175 TSLSGS-INAKNLQFNKSLD 193

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 71.6 bits (174), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 101/205 (49%), Gaps = 18/205 (8%)

Query: 2   KQEELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTD 61
           K  +L   E+ LK+L++  +++   N+K     + E+ ++S+ +VY + A + +D   ++
Sbjct: 35  KMNDLMEIEKKLKSLRKQKVEVSIRNKKAI---IAEEKKNSERRVYSM-ADDGEDKARSN 90

Query: 62  YDGLGDFSNEEEKRKFKLMNYTIREYEEWXXXXXXXXXXXVDGSDLTELATFTYEKELSK 121
                     E +   KL NY+IREYE+W               D   +A  +Y+KE+  
Sbjct: 91  --------KSEPEDPIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDA 142

Query: 122 LNSKLENISHEQKHQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKKLQSKA 181
           L    ++ISH  K  I   T +GK+ V+D             E +KKRYMVRK+KL  + 
Sbjct: 143 L---PKDISHPLKGGI---TEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQN 196

Query: 182 SSDIAGNYFKDKNKQFNEKLERELK 206
             ++   +  DKNK+FN KL  E K
Sbjct: 197 KINLDDGFINDKNKRFNAKLNSEFK 221

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score = 68.6 bits (166), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 102/208 (49%), Gaps = 26/208 (12%)

Query: 13  LKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEE 72
           LK LKR  +D   + RK AD+E++E S + KP+VY ++   DD+        + +  +++
Sbjct: 10  LKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSMEDASDDE-------LVRETKSDD 62

Query: 73  EKRKFKLMNYTIREYEEWXXXXXXXXXXXVDGSDLT--ELATFTYEKELSKLNS----KL 126
           + R F   +YT++EY  W             G+  +  +LA  +Y+K L  L +    K 
Sbjct: 63  KDRAF---HYTVQEYNAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKH 119

Query: 127 ENISHEQKHQ----------IGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKK 176
           E+  +E+  +          I  N+  GK+ + D++             +KKR+  RK++
Sbjct: 120 ESSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQ 179

Query: 177 LQSKASSDIAGNYFKDKNKQFNEKLERE 204
           +++  +     ++  DKNKQFNEKL RE
Sbjct: 180 MENVKTPSGVESFINDKNKQFNEKLGRE 207

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 65.1 bits (157), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 101/204 (49%), Gaps = 16/204 (7%)

Query: 5   ELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDG 64
           ++D     L+ LK   +DI  +NRK    E   +   SKP+VY I      ++     + 
Sbjct: 2   DIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRSKPEVYSI------NDEGAAVNE 55

Query: 65  LGDFSNEEEKRKFKLMNYTIREYEEWXXXXXXXXXXXVDGSDLTELATFTYEKELSKLNS 124
           +   SN E +   KL+NY++ +YE+W            DG+   ++A  TY+ E+ +L  
Sbjct: 56  VQSTSNTERR---KLLNYSLIDYEKWDEKEKQAN---FDGTYSGDIAYSTYKNEIKQLRK 109

Query: 125 KLENISHEQKHQIGVNTRNGKLNVKDEERXXXXXXXXXXETAKKRYMVRKKKLQS-KASS 183
                    K +I   + +GK+ ++DE+           +T+++R++  KK+L   KA++
Sbjct: 110 GGLTKGKITKGRI---SESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANT 166

Query: 184 DIAGNYFKDKNKQFNEKLERELKE 207
              GN+  +KN+ FNEKL R+ KE
Sbjct: 167 SELGNFVNEKNRHFNEKLSRQFKE 190

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 92/206 (44%), Gaps = 23/206 (11%)

Query: 13  LKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEE 72
            K LK+  LD + E+RK  + + KE+    KPKVY I   +D D    D       +N  
Sbjct: 10  FKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGD----DLLTNNS 65

Query: 73  EKRKFKLMNYTIREYEEWXXXXXXXXXXXVD----GSDLTELATFTYEKELSKLNSKLEN 128
           E+    L+ YTIR+YEEW            +     S   + A FTY+KE+ ++  +   
Sbjct: 66  ER---ALLTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMKKRQGK 122

Query: 129 ISHEQKHQIGVNTR----NGKLNVKDEERXXXXXXXXXXETAKKRYMVRKK-------KL 177
            + +++   G   +    +GKL +KD++           + +  RY+ R K         
Sbjct: 123 FATDEEITRGSAMKEVLDDGKLLIKDDKHLVNGFISDINKVSNDRYIKRMKLNAVNNDAT 182

Query: 178 QSKASSDIA-GNYFKDKNKQFNEKLE 202
            SK S D    +Y   KNK FN+KLE
Sbjct: 183 GSKVSHDKGKTSYNNAKNKDFNDKLE 208

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 77/171 (45%), Gaps = 31/171 (18%)

Query: 36  KEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEEEKRKFKLMNYTIREYEEWXXXXX 95
           K++++  KPKVY ++A E         DG+ D +   +    KL+N  +R+ E       
Sbjct: 60  KQQAEVEKPKVYSLQAAE------PSVDGI-DGAEVVDNVTVKLLNTPLRQLEAREARRG 112

Query: 96  XXXXXXVDGSDLTELATFTYEKELSKLNSKLENISHEQKHQIGVNTRNGKLNVKDEERXX 155
                 V   +   +A  TY+KEL+ L  K    ++    +  V   N            
Sbjct: 113 ENGDDAVARVEGDRVAKDTYKKELALLGRKSTRGTYRDNVERLVTHLN------------ 160

Query: 156 XXXXXXXXETAKKRYMVRKKKLQ---SKASSDIAGNYFKDKNKQFNEKLER 203
                   + +KKRY+VRK K++   ++  S + G Y  +KNKQFN+KL+R
Sbjct: 161 --------DVSKKRYLVRKNKMKRQGARGGSSLDG-YINEKNKQFNKKLQR 202

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 86/187 (45%), Gaps = 15/187 (8%)

Query: 39  SQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEEEKRKFKLMNYTIREYEEWXXXXXXXX 98
           + ++KPKVY +    D D    + D     ++ EE+R  KLMNYT+REY++W        
Sbjct: 37  ATNNKPKVYSMTDEFDKDELPIN-DENARKNHSEEERISKLMNYTLREYKDWELKQNEYT 95

Query: 99  XXXVDGS------DLTELATFTYEKELSKLNSKLENISHEQKH----QIGVNTRN--GKL 146
                 S       L  LA  TY+K++ KLN  L   +   K     +I  N RN   K+
Sbjct: 96  TESQTNSKDDQIESLDSLAKRTYDKDIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKI 155

Query: 147 NVKDEERXXXXXXXXXXETAKKRYMVRKKKLQSKASSDIAGNYFKDKNKQFNEKLERELK 206
            +KD ++          +T   R      + +   S+ ++G +   KN++FNEKL RE K
Sbjct: 156 VIKD-DKFLVEELVNNLKTKSDRLYKHLGERRKNYSTTLSG-HVNTKNQEFNEKLTREWK 213

Query: 207 ERDNGGD 213
           +  N  D
Sbjct: 214 KLSNSID 220

>Smik_14.353 Chr14 (628425..630125) [1701 bp, 566 aa] {ON} YNR023W
           (REAL)
          Length = 566

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 22  DIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGL 65
           +I+  N   A+Q VK+   S+ PK+  +K  + D N+  D+DGL
Sbjct: 240 NIVQNNVMMAEQTVKKDMVSTTPKLEPVKW-QYDPNNPVDFDGL 282

>SAKL0G07832g Chr7 (656128..658200) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q05497 Saccharomyces cerevisiae YDR338C
           Hypothetical ORF
          Length = 690

 Score = 29.3 bits (64), Expect = 9.6,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 28/57 (49%)

Query: 4   EELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHT 60
           EE   YE+ ++ ++R ++  ++  R +    +   S+ S P +Y     E+D  H T
Sbjct: 160 EEALEYEDFMQRVRRQLVSDMSRKRAKRPSFISVSSRGSVPTIYQEIGTEEDFAHET 216

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.127    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,802,708
Number of extensions: 968195
Number of successful extensions: 4750
Number of sequences better than 10.0: 127
Number of HSP's gapped: 4684
Number of HSP's successfully gapped: 131
Length of query: 213
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 108
Effective length of database: 41,441,469
Effective search space: 4475678652
Effective search space used: 4475678652
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 63 (28.9 bits)