Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G009403.492ON65665630250.0
NCAS0E008103.492ON69270614180.0
Skud_7.4413.492ON8074798152e-97
Smik_6.2263.492ON8394877972e-94
YGR130C3.492ON8164797934e-94
Suva_7.4183.492ON8314807725e-91
TDEL0D056003.492ON7003345975e-67
CAGL0I10516g3.492ON8134405931e-65
SAKL0F02772g3.492ON7734755873e-65
ZYRO0D09988g3.492ON9943724948e-52
KLTH0F14828g3.492ON8365034849e-51
Kwal_55.212293.492ON7874824652e-48
KLLA0D16236g3.492ON8714364263e-43
Kpol_480.143.492ON6993793898e-39
TPHA0D042503.492ON6293963833e-38
KNAG0B008103.492ON7574123526e-34
KAFR0C019603.492ON5633382198e-18
KAFR0G036903.492ON3632901783e-13
Ecym_12373.492ON7272631772e-12
TBLA0C044803.492ON802961655e-11
KNAG0A079403.492ON2752681462e-09
AFR310C3.492ON6232501271e-06
YPR049C (ATG11)3.330ON1178218910.026
NCAS0F035503.492ON441265840.14
Kwal_55.21822na 1ON28346790.47
Skud_16.3363.330ON1180109790.70
KAFR0G020908.604ON732249724.8
NCAS0E022607.44ON59366699.7
NOTE: 1 genes in the same pillar as NDAI0G00940 were not hit in these BLAST results
LIST: NDAI0B05860

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00940
         (656 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...  1169   0.0  
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   550   0.0  
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   318   2e-97
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   311   2e-94
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   310   4e-94
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   301   5e-91
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   234   5e-67
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   233   1e-65
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   230   3e-65
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   194   8e-52
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   191   9e-51
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   183   2e-48
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   168   3e-43
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   154   8e-39
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   152   3e-38
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   140   6e-34
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    89   8e-18
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    73   3e-13
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...    73   2e-12
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    68   5e-11
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    61   2e-09
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    54   1e-06
YPR049C Chr16 complement(661137..664673) [3537 bp, 1178 aa] {ON}...    40   0.026
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    37   0.14 
Kwal_55.21822 s55 (994578..995429) [852 bp, 283 aa] {ON} YNL202W...    35   0.47 
Skud_16.336 Chr16 complement(625927..629469) [3543 bp, 1180 aa] ...    35   0.70 
KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {O...    32   4.8  
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44      31   9.7  

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score = 1169 bits (3025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/656 (91%), Positives = 598/656 (91%)

Query: 1   MSLKLGSKKNDPFEHLLNPQPKTTGXXXXXXXXXXXLFLQRVIXXXXXXXXXXXXXXXXX 60
           MSLKLGSKKNDPFEHLLNPQPKTTG           LFLQRVI                 
Sbjct: 1   MSLKLGSKKNDPFEHLLNPQPKTTGSSDSSRPRSSSLFLQRVISSTSSIQKTPTTSSSSK 60

Query: 61  XXXXXEEYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNF 120
                EEYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNF
Sbjct: 61  KKVSTEEYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNF 120

Query: 121 AKDIFFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTKXXXXXXXXXXLDDSA 180
           AKDIFFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTK          LDDSA
Sbjct: 121 AKDIFFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTKQPSQSQSPSPLDDSA 180

Query: 181 NAEKPPLEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVK 240
           NAEKPPLEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVK
Sbjct: 181 NAEKPPLEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVK 240

Query: 241 TKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIVASNE 300
           TKKFGILSKSI               ASYKAEMQEKYDVKMQEYENELKSLDEKIVASNE
Sbjct: 241 TKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIVASNE 300

Query: 301 LIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELD 360
           LIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELD
Sbjct: 301 LIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELD 360

Query: 361 DQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLN 420
           DQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLN
Sbjct: 361 DQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLN 420

Query: 421 NEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANE 480
           NEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANE
Sbjct: 421 NEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANE 480

Query: 481 KIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMT 540
           KIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMT
Sbjct: 481 KIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMT 540

Query: 541 NLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEILSK 600
           NLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEILSK
Sbjct: 541 NLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEILSK 600

Query: 601 QHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPALSKAKDDSLFEYETEEEIMYV 656
           QHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPALSKAKDDSLFEYETEEEIMYV
Sbjct: 601 QHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPALSKAKDDSLFEYETEEEIMYV 656

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/706 (46%), Positives = 442/706 (62%), Gaps = 80/706 (11%)

Query: 8   KKNDPFEHLLNPQ-------------PKTTGXXXXXXXXXXXLFLQRVIXXXXXXXXXXX 54
           +++DPF+HL                 P+TT             FLQRV+           
Sbjct: 10  RRDDPFDHLFEEAEAAEAAKHNTSMAPRTTSS-----------FLQRVVSTTSSTTQKQP 58

Query: 55  XXX-XXXXXXXXEEYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKK 113
                        +Y SPFR+     N   +QNEKT+RFPTVSATSNYT +  K+ GF  
Sbjct: 59  KKKIAASEAKAMSDYASPFRAEYSNVN---VQNEKTRRFPTVSATSNYTLKNPKQKGFTT 115

Query: 114 IPKDKNFAKDIFFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTKXXXXXXXX 173
           I K +NFAKDI+FP+YLT+NEQRQQ EL  L K EKDL+Y +DSQNIIDLTK        
Sbjct: 116 IKKGQNFAKDIYFPNYLTENEQRQQAELLILEKKEKDLKYLQDSQNIIDLTKKQEPKKAP 175

Query: 174 XXLD------DSANAEKPPLEKPIDP---------------------------------- 193
             +       D A      + + I+P                                  
Sbjct: 176 TPVASTTEEIDEATFPHSNISEEINPDYEDEEQSSAQNNEQLVLVQSEEEIHTPNVVEPP 235

Query: 194 ---KLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKTKKFGILSKS 250
               L PMV F L+TP  N K+KK    P   EK  NP A+P ++EEIVKT +FG LSK+
Sbjct: 236 IDPALAPMVPFSLATP--NQKSKKETEAP---EKPSNPVASPTNQEEIVKTAQFGYLSKA 290

Query: 251 IXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIVASNELIEQCKKDTD 310
           +               A Y+ +  EKY+ KMQEY+  L+ +D ++   N+LIE+C+ DT 
Sbjct: 291 VYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTK 350

Query: 311 AKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELDDQVVGEIDQL 370
            K+D+M+ +LVK++FD++ VQ +DKMKIF+ETK IK EK+ EK NV   + +V   ID+L
Sbjct: 351 EKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDEL 410

Query: 371 NKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLNNEKLGLTKEI 430
             EK KV  E++ WT NMTNI  +LDAKLFKI QIN+TQMNLQNKID L ++K  L  EI
Sbjct: 411 TNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEI 470

Query: 431 EANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANEKIQLSELTQK 490
             NK  H +NV+ +E+VDNK+YLPKLN+ID++IN LLNQ+T++KQENANEK+QL+E+T+K
Sbjct: 471 AKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKK 530

Query: 491 LEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMTNLKTSYEQQL 550
           LE ER  HEE+L+L+AEERKRQEENLLGKQR+ELE KAN +Q+NH+ E+  LK  YE +L
Sbjct: 531 LEDERRAHEEQLQLEAEERKRQEENLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKL 590

Query: 551 ADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEILSKQHQQAEAYNA 610
            +FK++L ++QD++D +K QK+RLEG KA+++Q RQK +D+VLKNEI  KQH+QAEA++A
Sbjct: 591 EEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSA 650

Query: 611 VQLAQKKKNASPVAEDLMKESHIPALSKAKDDSLFEYETEEEIMYV 656
            QL  +K   + +A ++  E    A   +KD+SL++YETEE++MYV
Sbjct: 651 AQLKGRKHPLAALAREITGE----AKPSSKDNSLYDYETEEDVMYV 692

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  318 bits (815), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 200/479 (41%), Positives = 295/479 (61%), Gaps = 27/479 (5%)

Query: 190 PIDPKLTPMVSFQ------------LSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEE 237
           PIDP   P V F+            L   P ++  +K  V         NP ATP + E 
Sbjct: 344 PIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAP-----SNPVATPENPEL 398

Query: 238 IVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIVA 297
           IVKTK+ G LSK++               A  KA+ + KYD     Y   L+ L  +I  
Sbjct: 399 IVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDE 458

Query: 298 SNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVE 357
               ++  +K+T  K+++    LVK++ D  +   + K+ IF +T+ +K +K+ EK  V 
Sbjct: 459 IENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVL 518

Query: 358 ELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKID 417
                V  EID+LN  K  V  EFN+WT N++N+++QLDA++FKI QIN+ Q  +QN+ID
Sbjct: 519 GKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEID 578

Query: 418 GLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQEN 477
            L  +K  L  + E NK  H  NV+T+E+V+NK+YLP++N+ID+Q++ LLN++T+I+QEN
Sbjct: 579 ALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQEN 638

Query: 478 ANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHET 537
           ANEK +LS +T++LE ER  HEE+LKL+AEERKR+EENLL KQR+ELE++A+  QL+HE 
Sbjct: 639 ANEKTELSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQ 698

Query: 538 EMTNLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEI 597
           ++T +K +Y  QL + + KL  ++ +++ +K +++RL+G KAIE+Q RQK SD  LK EI
Sbjct: 699 QITQVKQTYNDQLTELQDKLAAEEKELEAVKRERTRLQGEKAIEEQTRQKSSDEALKQEI 758

Query: 598 LSKQHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPALSKAKDDSLFEYETEEEIMYV 656
           L KQH+QAE  +A +      + SP  E L     +P     KDDSL+EY TEE++MY 
Sbjct: 759 LGKQHKQAEGLHAAEKHNIPNSHSPKNEIL-----VP-----KDDSLYEYHTEEDVMYA 807

 Score =  106 bits (265), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 85/157 (54%), Gaps = 18/157 (11%)

Query: 11  DPFEHLLNPQPKTTGXXXXXXXXXXXLFLQRVIXXXXXXXXXXXXXXXXXXXXXXEEYLS 70
           DPF  L+N                   FLQ+V+                      EE++S
Sbjct: 11  DPFTQLINQSSANAQNQREQQEEKPYQFLQKVVSNEPKGK---------------EEWVS 55

Query: 71  PFRSNLVT---NNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFFP 127
           PFR + ++   NN+ Y+ + K K+FPTVSATS Y+ +  K++G+K IPK+   AKDI FP
Sbjct: 56  PFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFP 115

Query: 128 SYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLT 164
           +YLT+NE+RQ   LT+L   EK L+Y K+ Q I DLT
Sbjct: 116 TYLTKNEERQYQLLTELELKEKHLKYLKECQKITDLT 152

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  311 bits (797), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 197/487 (40%), Positives = 295/487 (60%), Gaps = 43/487 (8%)

Query: 190 PIDPKLTPMVSFQ-------------LSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKE 236
           PIDP   P V FQ               +   ++  K     P       NP ATP   E
Sbjct: 376 PIDPSKAPKVPFQERPRKGKTGIFALWKSSTSSSAQKSNTAAP------SNPVATPEKPE 429

Query: 237 EIVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIV 296
            IVKTK+ G LSK++                  +A  + KYD K +EYE +L+ L  +I 
Sbjct: 430 LIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQID 489

Query: 297 ASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINV 356
              + ++  +K+T  K+++    LVK++ D  +   + K+ IF +T+ +K +K++EK  V
Sbjct: 490 EVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVV 549

Query: 357 EELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKI 416
                 V  +ID+LN EK  V  +FN+WT N++N+++QLDA++FKI QIN+ Q  +Q++I
Sbjct: 550 LNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEI 609

Query: 417 DGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQE 476
           D L  +K  L  + + N+  H  NV+ +E+V+N++YLP++N+ID+QI+ LLN++T+IKQE
Sbjct: 610 DSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQE 669

Query: 477 NANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHE 536
           NANEK QLS +T++LE ER  HEE+LKL+AEERKR+EENLL KQR+ELE++A   QL+HE
Sbjct: 670 NANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQARQAQLDHE 729

Query: 537 TEMTNLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNE 596
            ++T +K +Y  QL + + KL  ++ +++ +K +K+RL+G KAIE+Q RQ+ +D  LK E
Sbjct: 730 EQITQVKKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQRNADEALKQE 789

Query: 597 ILSKQHQQAEAYNAVQL-------AQKKKNASPVAEDLMKESHIPALSKAKDDSLFEYET 649
           ILSKQH+QAE  +A +         QK KN  P                 KDDSL+EY T
Sbjct: 790 ILSKQHKQAEGLHAAERYKIPNDHPQKNKNVVP-----------------KDDSLYEYHT 832

Query: 650 EEEIMYV 656
           EE++MY 
Sbjct: 833 EEDVMYA 839

 Score =  111 bits (277), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/169 (37%), Positives = 90/169 (53%), Gaps = 19/169 (11%)

Query: 1   MSLKLGSKKNDPFEHLLNPQPKTTGXXXXXXXXXXXLFLQRVIXXXXXXXXXXXXXXXXX 60
           M   +  + +DPF  L+N   +               FLQ+V+                 
Sbjct: 1   MLFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGK---------- 50

Query: 61  XXXXXEEYLSPFRSNLVT----NNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPK 116
                EE++SPFR + +     NN+ Y+++ K ++FPTVSATS Y+ +  K++G+K IPK
Sbjct: 51  -----EEWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPK 105

Query: 117 DKNFAKDIFFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTK 165
           +   AKDI FP+YLTQNE+RQ   LT+L   EK LQY K  Q I DLTK
Sbjct: 106 NAKRAKDIRFPTYLTQNEERQYQLLTELELKEKHLQYLKKCQKITDLTK 154

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  310 bits (793), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 197/479 (41%), Positives = 303/479 (63%), Gaps = 17/479 (3%)

Query: 178 DSANAEKPPLEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEE 237
           D + A K P ++P   + T +  F L   P ++  +K++          NP ATP + E 
Sbjct: 355 DPSKAPKVPFQEPSRKERTGI--FALWKSPTSSSTQKSKTAAP-----SNPVATPENPEL 407

Query: 238 IVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIVA 297
           IVKTK+ G LSK++               A  +A+ ++KYD K +EY+ +L+ L  +I  
Sbjct: 408 IVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDE 467

Query: 298 SNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVE 357
               ++  +++T  K+++    LVK++ D  +   + K+ I  +T+ +K +K+ EK  V 
Sbjct: 468 IENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVL 527

Query: 358 ELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKID 417
           +    V  EID LN EK  V  EFN+WT N++N+++QLDA++FKI QIN+ Q  +QN+ID
Sbjct: 528 DKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEID 587

Query: 418 GLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQEN 477
            L  +K  L  + E NK  H  NV+ +E+V+NK+YLP++N+ID+QI+ LLN++T+IKQEN
Sbjct: 588 NLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQEN 647

Query: 478 ANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHET 537
           ANEK QLS +T++LE ER  HEE+LKL+AEERKR+EENLL KQR+ELE++A+  QL+HE 
Sbjct: 648 ANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQ 707

Query: 538 EMTNLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEI 597
           ++T +K +Y  QL + + KL  ++ +++ +K +++RL+  KAIE+Q RQK +D  LK EI
Sbjct: 708 QITQVKQTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEALKQEI 767

Query: 598 LSKQHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPALSKAKDDSLFEYETEEEIMYV 656
           LS+QH+QAE  +A +      +  P        S +P     KDDSL+EY TEE++MY 
Sbjct: 768 LSRQHKQAEGIHAAE-----NHKIPNDRSQKNTSVLP-----KDDSLYEYHTEEDVMYA 816

 Score =  112 bits (281), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 91/168 (54%), Gaps = 18/168 (10%)

Query: 1   MSLKLGSKKNDPFEHLLNPQPKTTGXXXXXXXXXXXLFLQRVIXXXXXXXXXXXXXXXXX 60
           M   +  +++DPF  L+N     T             FLQ+V+                 
Sbjct: 1   MLFNINRQEDDPFTQLINQSSANTQNQQAHQQESPYQFLQKVVSNEPKGK---------- 50

Query: 61  XXXXXEEYLSPFRSNLVTN---NKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKD 117
                EE++SPFR + + N   N+AY ++ K ++FPTVSATS Y+ +  K++G+K IPK+
Sbjct: 51  -----EEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKN 105

Query: 118 KNFAKDIFFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTK 165
              AKDI FP+YLTQNE+RQ   LT+L   EK L+Y K  Q I DLTK
Sbjct: 106 AKRAKDIRFPTYLTQNEERQYQLLTELELKEKHLKYLKKCQKITDLTK 153

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  301 bits (772), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 195/480 (40%), Positives = 298/480 (62%), Gaps = 28/480 (5%)

Query: 190 PIDPKLTPMVSFQ-------------LSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKE 236
           PIDP   P V FQ               +P  ++  K     P       NP ATP + E
Sbjct: 367 PIDPSKAPKVPFQERPQKERTGFFALWKSPTSSSAKKGAATAP------LNPVATPENPE 420

Query: 237 EIVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIV 296
            IVKTK+ G LSK++                  +A  + KYD K  EY+ +L+ L  +I 
Sbjct: 421 LIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQID 480

Query: 297 ASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINV 356
                ++Q +++T  K+++    LVK++ D  +   + K+ IF +T+ +K++K++EK  V
Sbjct: 481 EIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEV 540

Query: 357 EELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKI 416
                 V  EID+LN EK  V  EFN+WT N++++++QLDA++FKI QIN+ Q   QN+I
Sbjct: 541 LNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEI 600

Query: 417 DGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQE 476
           D L  +K  L  + E NK  H  NVE +E+V+NK+YLP++N+ID+QI+ LLNQ+T+I+QE
Sbjct: 601 DNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQE 660

Query: 477 NANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHE 536
           NANE+  LS +T+KLE ER  HEE+LKL+AEERKR+EENLL KQR+ELE++A+  +L HE
Sbjct: 661 NANERTHLSAITKKLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAELEHE 720

Query: 537 TEMTNLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNE 596
            ++T +K +Y  QL + + KL  ++++++ +K ++++L+G KAIE+Q RQK +D +LK  
Sbjct: 721 EQITQVKKTYNDQLTELQDKLAAEEEELEAVKRERTKLQGEKAIEEQTRQKNADEILKQT 780

Query: 597 ILSKQHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPALSKAKDDSLFEYETEEEIMYV 656
           IL KQH+QA   +A   A+ + N +P +     +  +P     K+DSL+EY TEE++MY 
Sbjct: 781 ILDKQHKQATGLHA---AENRVN-TPSSNLQESKRAVP-----KNDSLYEYHTEEDVMYA 831

 Score =  100 bits (249), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 72/102 (70%), Gaps = 3/102 (2%)

Query: 66  EEYLSPFRSNLVT---NNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAK 122
           E+++SPFR + ++   NN+ Y+ + K ++FPTVSATS Y+ +  +++G+K IPKD   AK
Sbjct: 49  EDWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAK 108

Query: 123 DIFFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLT 164
           DI FP+YLT+NE+RQ   LT+L   EK L+Y K  Q I DLT
Sbjct: 109 DIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKITDLT 150

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  234 bits (597), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 142/334 (42%), Positives = 208/334 (62%), Gaps = 4/334 (1%)

Query: 236 EEIVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKI 295
           E +VKTK  G L+K I               A YK + Q+K+D K  E   ++ SL  +I
Sbjct: 349 EHVVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQI 407

Query: 296 VASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKIN 355
                 + Q + DTDAK+++   EL ++ F+   V    K ++F +T++IK +K+ EK +
Sbjct: 408 KEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDS 467

Query: 356 VEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNK 415
           V +   +V  EID+LN EKEKV +E  +WT ++  ++ ++DAK+  ++++N+ Q N Q +
Sbjct: 468 VLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEE 527

Query: 416 IDGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQ 475
           I+ L  +K+ +  +IE N  THA N + IE   NK YLPKLN +D+QI+ LL QLT I+Q
Sbjct: 528 INKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQ 587

Query: 476 ENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNH 535
             ANE+ +LS +T+KL+KER++HEEKLKL+AE R+R+EE+LLGKQR+ELE KA + +  H
Sbjct: 588 HCANERTELSAITKKLDKERLEHEEKLKLEAENRRRKEEDLLGKQRKELEAKAQEAREKH 647

Query: 536 ETEMTNLKTSYEQQLADFKSKLMEQQDKVDDLKL 569
           E EM  LKT Y Q    FK    EQQ K D L  
Sbjct: 648 EQEMQKLKTDYTQLEGKFKR---EQQQKKDALAF 678

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 52/92 (56%), Gaps = 3/92 (3%)

Query: 67  EYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFF 126
           +Y+SPFR           Q  +T+RFPT SA S Y N   +E+G+KKI   +  AKDI F
Sbjct: 39  DYVSPFRDE---QEVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISF 95

Query: 127 PSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQ 158
           P YL + E++Q   L +L   E  L+Y KD Q
Sbjct: 96  PVYLEEIEKKQLELLRELEVKEAHLRYLKDCQ 127

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  233 bits (593), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 177/440 (40%), Positives = 270/440 (61%), Gaps = 34/440 (7%)

Query: 217 VVPEEEEKERNPKATPNSKEEIVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEK 276
           V+P++ + +    ATP + E I KT+++G +SK I                 +K   + K
Sbjct: 408 VIPDQSQLDFPI-ATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAK 466

Query: 277 YDVKMQEYENELKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKM 336
           YD KM+EY NEL+ L ++I   NE +E  KK+T  K+++    LVK++F+  ++  + K 
Sbjct: 467 YDDKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKN 526

Query: 337 KIFSETKLIKREKIDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLD 396
           KIF ET+ IK +KI +K  + +    V  EI QLN  K++V +EF++WT NMT + +QLD
Sbjct: 527 KIFKETENIKNQKIQQKKEILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLD 586

Query: 397 AKLFKIKQINITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKL 456
           AK+ K+ QI + Q   Q +I+ L  +K     +I+A K  H    + +E+ +NK+YLPK+
Sbjct: 587 AKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKI 646

Query: 457 NNIDSQINDLLNQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENL 516
           + ID+QI++LLN+L +IKQENANE+ +LS++T++LE+ER  HEEKLKL+AEER+RQE+NL
Sbjct: 647 HTIDNQISELLNELAIIKQENANEQTELSKITKELEEERRAHEEKLKLEAEERERQEKNL 706

Query: 517 LGKQREELEQKANDLQLNHETEMTNLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEG 576
           L KQR ELE+KA   +  HE ++  +K  YE +L              +++K QK  LE 
Sbjct: 707 LEKQRLELEEKAEQQKREHEEQVRKMKEQYENEL--------------NNVKKQKESLET 752

Query: 577 SKAIEDQDRQKQSDNVLKNEILSKQHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPAL 636
            K +E+ +R +     +K E+L KQ +QAEA +A   AQ K  A+  A D+         
Sbjct: 753 EKLVEEHNRNEN----IKKEVLDKQRKQAEAQHA---AQTKSIATNAANDM--------- 796

Query: 637 SKAKDDSLFEYETEEEIMYV 656
              +D+SL+E++TEEEIMYV
Sbjct: 797 ---QDNSLYEFKTEEEIMYV 813

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 58/90 (64%)

Query: 75  NLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFFPSYLTQNE 134
           N  TN  AY +N K  +FPTVSATS   N+  KE+GFK + K    AKDI FP YLT+NE
Sbjct: 106 NPFTNKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENE 165

Query: 135 QRQQIELTKLVKLEKDLQYKKDSQNIIDLT 164
            RQQ  L +L   E  LQY KDSQ IIDLT
Sbjct: 166 FRQQTILKELELKEGKLQYLKDSQKIIDLT 195

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  230 bits (587), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 178/475 (37%), Positives = 274/475 (57%), Gaps = 25/475 (5%)

Query: 187 LEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKTKKFGI 246
           L +PIDP   P V F+  T            +    +K+  P ATP   E IV+T K G 
Sbjct: 317 LAQPIDPNKAPRVPFKAKT--------GVFALWTRSDKQDQPLATPQDPEYIVRTDK-GY 367

Query: 247 LSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIVASNELIEQCK 306
           +SK+I               A++  E  +KYD   +EY ++L  L  +I      +EQ +
Sbjct: 368 MSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLR 427

Query: 307 KDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELDDQVVGE 366
            DT  K+ +  +EL K+M D  +     K  IF ET+ IK +KI E+  +    ++V  E
Sbjct: 428 LDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAE 487

Query: 367 IDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLNNEKLGL 426
           I++LN  K++V  EFNE+   + ++  QLD+K+ KI+++N  QM +   I  LN +KL +
Sbjct: 488 IEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEI 547

Query: 427 TKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANEKIQLSE 486
             E    +  H  +   +E++ NK+YLPK+N IDSQ+  LL  LTLIKQENAN+K + + 
Sbjct: 548 ETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAA 607

Query: 487 LTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMTNLKTSY 546
           +T++LE+ER  HEEKL+ + EERKR EE  L KQREELE KA D +L HE E+  +K  +
Sbjct: 608 ITKRLEEERKAHEEKLRREEEERKRLEEERLQKQREELEAKAEDARLKHEEELRQIKEEH 667

Query: 547 EQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEILSKQHQQAE 606
           E+ L D   +L +++++ + ++ +K+RL G KAI++Q+R +++D  LK E++ K+ +QAE
Sbjct: 668 EKALNDANVQLAKEKEEREVVEREKTRLAGEKAIQEQERAQEADLALKQELMEKRRKQAE 727

Query: 607 AYNAVQLA-----QKKKNASPVAEDLMKESHIPALSKAKDDSLFEYETEEEIMYV 656
           A +A + A     QKK   S  +++L +ES           SL++YET EEI+ V
Sbjct: 728 AVDAAEQARKISTQKKSVLSNPSQNLTRES-----------SLYDYETVEEIITV 771

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/168 (34%), Positives = 81/168 (48%), Gaps = 34/168 (20%)

Query: 1   MSLKLGSKKNDPFEHLLNP-QPKTTGXXXXXXXXXXXLFLQRVIXXXXXXXXXXXXXXXX 59
           MS+    ++ DPF HLL P QP+               FL++V+                
Sbjct: 1   MSIFKKKQQVDPFAHLLQPEQPQEQPN-----------FLRKVVTNKKKEEEEK------ 43

Query: 60  XXXXXXEEYLSPFRSN--LVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKD 117
                  +Y SPFRS   L+       +N K K+FPTVSATS     ++ ++G+K I   
Sbjct: 44  -------DYSSPFRSQQELIA-----AKNVKAKKFPTVSATSGTA--SAADLGYKVIDSA 89

Query: 118 KNFAKDIFFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTK 165
           K  AKDI  P YL   +++Q+ +L KL   E  LQY KDSQ I+D+ K
Sbjct: 90  KRRAKDISVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVDVRK 137

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  194 bits (494), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 131/372 (35%), Positives = 217/372 (58%), Gaps = 8/372 (2%)

Query: 185 PPLEKPIDPKLT--PMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKTK 242
           PP++    P++   P V  + S   +  + KK+Q       +  NP ATP + E +VKT 
Sbjct: 449 PPVDYAAVPRVVTFPEVEKKRSIFSIFGRKKKSQ------NRAPNPLATPENPEILVKTD 502

Query: 243 KFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIVASNELI 302
           + G LSK++                 + +  +++Y+ K  +Y+N L+ L +++    E +
Sbjct: 503 REGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEKLEESM 562

Query: 303 EQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELDDQ 362
           ++ K D +  ++I +  L K+  +      + K  IF ETK I+ +K  E   ++   ++
Sbjct: 563 QEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEE 622

Query: 363 VVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLNNE 422
           V  EI  LN EK+ ++ EF  WT  + + +  LDAK++ +  +       Q +ID L+++
Sbjct: 623 VQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHK 682

Query: 423 KLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANEKI 482
           K  L KE+ A+K THA N + +E   NK+YLPK++ ID +I++LL +L++IKQE+ANEK+
Sbjct: 683 KAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEKL 742

Query: 483 QLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMTNL 542
           +L  +T+KLE ER  HEE+LKL+AEER+R+E++LLGKQREE E  A  L+  HE E+  +
Sbjct: 743 KLGSITKKLESERQAHEEQLKLEAEERERKEKDLLGKQREEHEAVAAGLKKQHEEELRKM 802

Query: 543 KTSYEQQLADFK 554
           K  YE++L + K
Sbjct: 803 KQDYEKRLQELK 814

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 58/98 (59%), Gaps = 3/98 (3%)

Query: 67  EYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFF 126
           E+ SPFR   + +N+   +  + +RFPTVS  S ++    KE+G++ + +    AKDI F
Sbjct: 68  EFASPFR---LESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQF 124

Query: 127 PSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLT 164
           P YL +NE RQ   LT++   E+ L Y K+SQ + D T
Sbjct: 125 PIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  191 bits (484), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 165/503 (32%), Positives = 262/503 (52%), Gaps = 43/503 (8%)

Query: 181 NAEKPPLEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVK 240
           NA+  P EKP D K TP V F      +  ++          +K   P A+PN  E IVK
Sbjct: 340 NADGVP-EKPKDIKETPRVPFATGIFALWTRS----------DKRGQPVASPNDPEFIVK 388

Query: 241 TKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIVASNE 300
             K G +SK++                 Y  E   KY+ K  EYE+ L SL  +I     
Sbjct: 389 FDK-GYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEA 447

Query: 301 LIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELD 360
            +E  +KDT  K++I  A+L  +M D  +  +  K  IF ET+ +K  K++EK  VE   
Sbjct: 448 TMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAAKVEEKEGVEAKQ 507

Query: 361 DQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLN 420
           + V  E+++L K + ++  E  E    +  +  +LDAKL  I+++N  Q  LQ  ID L 
Sbjct: 508 EDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQ 567

Query: 421 NEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANE 480
            +K  L  E  A    H +NV  +E+++NK+YLPKLN ID++I++LL  LT++KQE AN 
Sbjct: 568 QQKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANH 627

Query: 481 KIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMT 540
           K + + ++++LE+E  + +EKL+ + E RKR E   L KQREE +Q+   LQ  HE ++ 
Sbjct: 628 KTEFAAVSKRLEEEDEERKEKLRQEEENRKRLEAERLQKQREEHDQQILLLQQEHERQLA 687

Query: 541 NLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEILSK 600
                  Q+ A+ +  L++++++ + ++ ++ +L+G KAI +Q+  K +D  L+ EI  +
Sbjct: 688 EAS----QKAAEHEQALLKEREQRELVERERVKLQGEKAIREQEEAKAADKALEEEIKQR 743

Query: 601 QHQQAEAYNAVQLA----------QKKKNASPVAED---------LMKESH-IPALSKAK 640
            H +A A +  + A          QKK    P +E          + KE+  +PA   A+
Sbjct: 744 NHSRALALDGAEAAVQKSQKEITEQKKTPLLPASEQKETPLLPAPVQKETPLLPAPESAQ 803

Query: 641 -------DDSLFEYETEEEIMYV 656
                  + SL+EY TE+EI  V
Sbjct: 804 PKALTNDNSSLYEYFTEKEIRTV 826

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 74/156 (47%), Gaps = 28/156 (17%)

Query: 8   KKNDPFEHLLNPQPKTTGXXXXXXXXXXXLFLQRVIXXXXXXXXXXXXXXXXXXXXXXEE 67
           K+ DP EHL       TG            FL +V+                        
Sbjct: 4   KRQDPLEHLFQQSEPQTGDADKG-------FLHKVVSKEQEQSA---------------- 40

Query: 68  YLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFFP 127
           Y SPFR+   + + A  Q  K ++FPTVS  ++ +  +S +MG+K I   +  AKDI  P
Sbjct: 41  YNSPFRT---SQSLAAAQKRKMQKFPTVS--ASVSAHSSSDMGYKVIDAARRRAKDIAVP 95

Query: 128 SYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDL 163
            YL  N++RQ+  L KL + E  L+YKKDSQ I+D+
Sbjct: 96  RYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDV 131

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  183 bits (465), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 157/482 (32%), Positives = 254/482 (52%), Gaps = 33/482 (6%)

Query: 187 LEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKTKKFGI 246
           L+KP + K TP V F      +  ++          +K   P A+P+  E IVK  K G 
Sbjct: 317 LQKPKNIKDTPRVPFATGIFALWTRS----------DKRGQPVASPDDPEFIVKFDK-GY 365

Query: 247 LSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIVASNELIEQCK 306
           +SK++                 Y  E  +KYD K QEYE+ L SL  +I      +EQ +
Sbjct: 366 MSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQ 425

Query: 307 KDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELDDQVVGE 366
            DT  K++I  AEL  RM +  +  ++ K  IF ET+  K  KIDEK  V    D+V  E
Sbjct: 426 LDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAE 485

Query: 367 IDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLNNEKLGL 426
            ++L  ++ +      E    +  +  QLD+K   I+++N  Q  +Q  ID L  +K  L
Sbjct: 486 NEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTL 545

Query: 427 TKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANEKIQLSE 486
             +  A    H +N+  +E + NK YLPK+N +DSQI+ LL+ L L+KQE AN+  + + 
Sbjct: 546 VADATAADELHNSNIAILEGISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAA 605

Query: 487 LTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMTNLKTSY 546
           ++++LE+E  + +EKL+L+ E RKR E     KQR+E +Q    LQ  HE ++       
Sbjct: 606 VSKRLEEENEERKEKLRLEEENRKRLEAERFQKQRDEHDQHVLTLQQEHERQLAEAS--- 662

Query: 547 EQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEILSKQHQQAE 606
            Q+ AD +  L ++++K + ++ ++ RL+G KAI++Q++ K +D  L++E+  + H +A+
Sbjct: 663 -QKAADTELLLQQEREKRELVERERVRLQGEKAIQEQEQAKLADKALEDEVKERNHNRAQ 721

Query: 607 AYNAVQLAQKKKNASPVAEDLMKESHIPALSKAKDD------------SLFEYETEEEIM 654
           A +A + A+ +   S      +  ++ PALS  K+D            SL+EY TE+E+ 
Sbjct: 722 AIDAAEAARARNAKS------ISNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVR 775

Query: 655 YV 656
           YV
Sbjct: 776 YV 777

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 76/155 (49%), Gaps = 31/155 (20%)

Query: 8   KKNDPFEHLLNP-QPKTTGXXXXXXXXXXXLFLQRVIXXXXXXXXXXXXXXXXXXXXXXE 66
           KK+DPFEHL    QPK               FL++V+                       
Sbjct: 4   KKHDPFEHLFQQDQPK---------KETSKGFLRKVVTKEQEDAT--------------- 39

Query: 67  EYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFF 126
            Y SPFR+   + ++   Q  K +RFPTVSA+S     +S EMGFK I   +  AKDI  
Sbjct: 40  -YSSPFRT---SQSQVEAQKRKVQRFPTVSASSG--GNSSAEMGFKVIDAARKRAKDIAV 93

Query: 127 PSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNII 161
           P YL  N++RQ+  L KL + E  LQYKKDSQ I+
Sbjct: 94  PRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIV 128

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  168 bits (426), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 146/436 (33%), Positives = 239/436 (54%), Gaps = 16/436 (3%)

Query: 228 PKATPNSKEEIVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENE 287
           P ATP   E IV+T++ G +SKS+               A Y  E  E+Y+ K QEYE +
Sbjct: 444 PVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEEK 502

Query: 288 LKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKR 347
           ++S+  +I   +  +EQ + + + KL +   E  + + +      + K  ++ +T+ IK 
Sbjct: 503 IQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTEEIKN 562

Query: 348 EKIDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINI 407
           + I +K + E     V  EID+L   K++V  E  E    +  +  +LD K   + +   
Sbjct: 563 QTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALNESLA 622

Query: 408 TQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLL 467
            +     +I  L  EK  L +EI+  +  H  NV  IE++DNK+YLPK+N I+++I+ LL
Sbjct: 623 KKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTEISSLL 682

Query: 468 NQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQK 527
             L LI+QE AN+K++ S +T++LE+ER  HEE+L  + EER+R E+  L KQR E E++
Sbjct: 683 ASLGLIQQEIANQKVEFSSVTRRLEEERKQHEEQLLKEKEERERLEKERLEKQRTEYEKQ 742

Query: 528 ANDLQLNHETEMTNLKTSYEQQLADFK-------SKLMEQQDKVDDLKLQKSRLEGSKAI 580
           A + +L HE E+ NLK ++++ L + +        +L E+Q + + ++ +++RL+G KAI
Sbjct: 743 AEEARLKHEEELANLKQTHDEALKEAQLQREAAAKQLEEEQQRREQVERERTRLQGEKAI 802

Query: 581 EDQDRQKQSDNVLKNEILSKQHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPALSKAK 640
           E Q R    D  L+ E   K  +QAEA +AV+ A K  N         K +  PA     
Sbjct: 803 EAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALKSSNKK------TKAAVPPA--NTT 854

Query: 641 DDSLFEYETEEEIMYV 656
           + SL++YET EE++ V
Sbjct: 855 NSSLYDYETVEEVITV 870

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 71/154 (46%), Gaps = 29/154 (18%)

Query: 67  EYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNF--AKDI 124
           EY SPFR+   T     ++ EK   FPT+S          ++MG+  +  DK+   AKDI
Sbjct: 60  EYHSPFRTAEETQRARQVRQEK---FPTLS--QGAVQLDPEQMGYSVV-TDKSVKKAKDI 113

Query: 125 FFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTKXXXXXXXXXXLD--DSANA 182
             PS L   E  Q++ LT L K EK L+Y + SQ I+DLTK          LD  D  + 
Sbjct: 114 IIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLTKPQEAIEASDNLDELDEVDP 173

Query: 183 EK-PPL------------------EKPIDPKLTP 197
            K PP+                  E+P+DPK  P
Sbjct: 174 SKEPPIEDVAEALEEAEAMAEDDEEEPVDPKREP 207

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  154 bits (389), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 120/379 (31%), Positives = 205/379 (54%), Gaps = 20/379 (5%)

Query: 182 AEKPPLEKPIDPKLTPMVSFQLSTP--------PVNNKNKKTQVVPEEEEKERNPKATPN 233
            E+  L +PI+P   PM+      P         +   N  + + P      +NP ++P 
Sbjct: 306 TEEKSLVEPINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQP----VSKNPMSSPE 361

Query: 234 SKEEIVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDE 293
           + E ++KTK+ G LSK++                + +   +EKY  K  EYE+ L  +  
Sbjct: 362 NPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQS 421

Query: 294 KIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEK 353
           KI   ++L+++ K  T  K+++M  +LVK + D      D K KIF ET+L+K EK++ K
Sbjct: 422 KIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAK 481

Query: 354 INVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQ 413
            +      ++  EI+ L++E+  V D+FNEW   +  I  QLDAK+  I+  N  +++++
Sbjct: 482 QDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIE 541

Query: 414 NKIDGLNNEKLGLTKEIEANKFTHANNVETIENVD-NKQYLPKLNNIDSQINDLLNQLTL 472
            ++  LN  K+ L +EI+ N+  H NN E + +++  K YLP++N ID++I   L +L+ 
Sbjct: 542 QEMAKLNISKMELEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNEIAGRLEKLST 601

Query: 473 IKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQ 532
           IK+E   E  +L+ LT+KLE ER+  E +++L  E+ KR++E  L KQ  EL+ K     
Sbjct: 602 IKKETIEENNRLTILTKKLEDERIARENEIRLKNEKLKREQEQKLQKQLAELKAK----- 656

Query: 533 LNHETEMTNLKTSYEQQLA 551
             H  E+  ++  YE+++A
Sbjct: 657 --HNEELLEIQKKYEKKMA 673

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 65/98 (66%), Gaps = 4/98 (4%)

Query: 67  EYLSPFR--SNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDI 124
           EY+SPFR  SN+   N  Y + +K +RFPTVSA+S+++  +  E+G+K I K    AKDI
Sbjct: 37  EYVSPFRDPSNVQAAN--YAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDI 94

Query: 125 FFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIID 162
            FPS+L  NE+RQ   +T L   E +L+Y ++SQ +++
Sbjct: 95  SFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLN 132

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  152 bits (383), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 131/396 (33%), Positives = 210/396 (53%), Gaps = 54/396 (13%)

Query: 190 PIDPKLTPMVSFQ------LSTPPVN---------------NKNKKTQV--------VPE 220
           PIDP + PMV         LS P  N               NK  K           VPE
Sbjct: 252 PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 311

Query: 221 EEEKERNPKATPNSKEEIVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVK 280
                 +  A+P + E +V+T ++ I+SK++                ++ A   EKY+ K
Sbjct: 312 -----THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTK 366

Query: 281 MQEYENELKSLDEKIVASNELIEQCKKDTDA----KLDIMNAELVKRMFDERSVQTDDKM 336
            QEYE++L  L +++    + IE+ KK ++     K++IM  +LVK + D +S    DK 
Sbjct: 367 KQEYEDKLVELQKQL----DDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKG 422

Query: 337 KIFSETKLIKREKIDEK--INVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQ 394
           K+  ET+L+K +KI+ K  +  ++LD  V  EI++LN EKE + +E+N W  N+ N+   
Sbjct: 423 KVIKETELMKLQKINAKEDLLAKQLD--VKNEIEKLNNEKEAITNEYNIWNGNLENLTTL 480

Query: 395 LDAKLFKIKQINITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVD-NKQYL 453
           LD K+ KI+ IN   M +Q  I+ L  +KL L  EI+ ++     N + ++ ++  K YL
Sbjct: 481 LDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYL 540

Query: 454 PKLNNIDSQINDLLNQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQE 513
           P+LN ID QI    ++L +IK E  +E  QLS LT+KLE+ER+ HE ++K+  E+ KR++
Sbjct: 541 PRLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQ 600

Query: 514 ENLLGKQREELEQKANDLQLNHETEMTNLKTSYEQQ 549
           + LL K+  EL++K       H  EM  ++  Y+++
Sbjct: 601 DELLQKKLTELQEK-------HNEEMAEIQKKYQEK 629

 Score = 70.5 bits (171), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 44/71 (61%)

Query: 67  EYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFF 126
           EY+SPFR+   T    Y ++ K K+FPT SATSN+      EMG+  + K+   AKDI F
Sbjct: 36  EYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQF 95

Query: 127 PSYLTQNEQRQ 137
           P YL  NE+RQ
Sbjct: 96  PKYLLDNEKRQ 106

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score =  140 bits (352), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 110/412 (26%), Positives = 209/412 (50%), Gaps = 24/412 (5%)

Query: 189 KPIDPKLTPMV-----SFQLSTPPVNNKNKKTQVVPEEEEKER-------NPKATPNSKE 236
           KP+DP   P +     S QL  P        T        K+R       NP+AT ++ E
Sbjct: 255 KPVDPATQPKLYVDLDSLQLIDPGSTAVGVST--------KQRLMDTPVTNPQATEDTPE 306

Query: 237 EIVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIV 296
            ++K  K+G +S ++               A Y+ E + K+  K+QEYE +L  +D++ +
Sbjct: 307 LLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVDDRKL 366

Query: 297 ASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINV 356
           +    +   K D  AK +++  + +K++FD  +   D K+K+  E +L+K +K+ +   +
Sbjct: 367 SVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVKLQKLQDLKFI 426

Query: 357 EELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKI 416
            +    +  E++QL  EK     +++ WT N+TNI E+LDA+LFK+ Q N  Q  +  +I
Sbjct: 427 SQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKITRQI 486

Query: 417 DGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYL--PKLNNIDSQINDLLNQLTLIK 474
             L   K  L  EI+AN+F+  N    + +++  Q+L   +L  +   I   L+ L ++K
Sbjct: 487 RDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLDSLAVVK 546

Query: 475 QENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLN 534
           QE + E+++L  +T ++E+ R + E       +   +  E+ LG++  +L+++   L + 
Sbjct: 547 QEISGERLKLIGITNEMERARAERERIWNEKLDSNTKFYEDKLGEKDADLDERLKQLDVE 606

Query: 535 HETEMTNLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQ 586
           H   +  ++  YE +L D   K  E + ++     +K+++E  K++ DQ++Q
Sbjct: 607 HTANLVQVREIYEAKLQDSAEKAEEAEQQLKLAAEEKAQIE--KSLLDQEQQ 656

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 66  EEYLSPFRSNLVTN-NKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDI 124
           EEY+SPFR   +T  +K  +Q ++TK+FPTVSATS Y +  ++E+GF K+  D+  A+DI
Sbjct: 46  EEYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDI 105

Query: 125 FFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLT 164
            FP YL +NE RQ++ L  L K E+ L + +  Q+++D T
Sbjct: 106 VFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRT 145

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 89.0 bits (219), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 98/338 (28%), Positives = 173/338 (51%), Gaps = 29/338 (8%)

Query: 228 PKATPNSKEEIVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENE 287
           P A+P +KE +VK      +SK +                 Y+ +   K +    EY  +
Sbjct: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306

Query: 288 LKSLD-EKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIK 346
           +KS+  EK    NE IE    ++    +++  +LVK + D  +  +D+K+KI  +T  +K
Sbjct: 307 IKSIQLEKFKTLNE-IENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLK 365

Query: 347 REKIDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQIN 406
            +K++E   + +  + +  E + +N EK+     FN    ++  I ++LDAKLFK+ Q N
Sbjct: 366 LQKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDN 425

Query: 407 ITQMNLQNKIDGLNNEKLGLTKEIEANKF--THANNVETIENVDNKQYLPKLNNIDSQIN 464
           I   NL+++I+ L ++K  L  EI++ ++   H ++       D+KQ   +LN +D QIN
Sbjct: 426 IRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDD-------DSKQL--ELNEMDEQIN 476

Query: 465 DLLNQLTLIKQENANEKIQLSELTQKLEKERMDHE-EKLKLDAEERKRQEENLLGKQREE 523
             L+ L LIKQE  NEK+++S+LT  L  + ++++ E L++  E  K             
Sbjct: 477 SKLSNLNLIKQEIINEKLKISKLTNDLNLQLIENKNENLRIMDENTK------------- 523

Query: 524 LEQKANDLQLNHETEMTNLKTSYEQQLADFKSKLMEQQ 561
           L  K +++Q  H+ E+ NL   +E   +D  S + E+Q
Sbjct: 524 LNDKIHNMQELHKNELKNLTERHEN--SDTYSYVTEEQ 559

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 61/98 (62%), Gaps = 5/98 (5%)

Query: 68  YLSPFRSNLVTN-NKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFF 126
           Y SPFR+N  +   K  +Q+ KT +FP VSATS Y N  +K++ +K +   KNFA+DI F
Sbjct: 51  YNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTY-NTDTKDV-YKDLDPKKNFARDIKF 108

Query: 127 PSYLTQNEQRQQIELTKLVKLEKD-LQYKKDSQNIIDL 163
           PS L  NE RQ   L  L K+++D L   KDS  +ID+
Sbjct: 109 PSRLIDNENRQNQILLDL-KIKQDALDRLKDSLQVIDV 145

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 132/290 (45%), Gaps = 27/290 (9%)

Query: 68  YLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKN---FAKDI 124
           Y SPFR N+  N   YI+  K  ++   +  S++       +G+K IP D+     AKDI
Sbjct: 39  YQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDI 98

Query: 125 FFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTKXXXXXXXXXXLDDSANAEK 184
            FP  L +NE+ Q   L +L   E +L++ KDSQN++ + +          +    +++ 
Sbjct: 99  DFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYIDE--------DDISYEGDSKY 150

Query: 185 PPLEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKE-RNPKATPNSKEE-IVKTK 242
             +EKPI+    P +   + T            VP  ++KE +N  ATP +KE+ IV  K
Sbjct: 151 KIIEKPINIYSVPKIPSYVFTK-----------VPGNKKKELKNSLATPQNKEQVIVLRK 199

Query: 243 KFGIL---SKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIVASN 299
           K G+L   SK +                   A+  E++  K+ EY+ ++ +L+ KI   N
Sbjct: 200 KDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKIDIEN 259

Query: 300 ELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREK 349
           E I +         D  + +  K    + +   + K +++ E + IK ++
Sbjct: 260 EKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEIEAIKNQR 309

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 133/263 (50%), Gaps = 4/263 (1%)

Query: 230 ATPNSKEEIVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELK 289
           ATP   E IV T+K G +SK+I               AS       KY+   + YE +L 
Sbjct: 323 ATPEDPEFIVLTEK-GYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLA 381

Query: 290 SLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREK 349
           SL+ +I   +  ++Q K  T+ ++  + A L + + D ++   + K  +  E +  K  K
Sbjct: 382 SLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAK 441

Query: 350 IDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQ 409
           I EK  + E   QV  E++ L + + +   E  ++   +  +  +LDA+L +++ ++  Q
Sbjct: 442 ITEKNTINEKLTQVEPELEALKRLELERKVELQQYQSEVQALTAELDARLGELQNVSDEQ 501

Query: 410 MNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQ 469
             +   +  L   ++ + K+I  +    ANN E ++N++N    P +  +D+Q++++   
Sbjct: 502 TEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNLENH---PSIAALDNQVSEVTRT 558

Query: 470 LTLIKQENANEKIQLSELTQKLE 492
           ++ ++QE+A +K +L+EL+ K E
Sbjct: 559 VSAVEQEHAAQKDELTELSTKKE 581

 Score = 39.3 bits (90), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 50/101 (49%), Gaps = 17/101 (16%)

Query: 67  EYLSPFRSNLVTNNKAYIQNEKTK--RFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDI 124
           EY+SPFR     ++KA  + E+ +  +FPT    S  T R    +        K  A+DI
Sbjct: 56  EYVSPFR-----DDKAVAEAERIRDLKFPTTGHHS--TVRVKDNV--------KRKAQDI 100

Query: 125 FFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTK 165
             P      + +QQ +L +L   E  L+Y ++SQ I+D+ K
Sbjct: 101 AEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDVRK 141

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 54/96 (56%)

Query: 66  EEYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIF 125
           ++Y SPFR     +N      +K  R+PT+SATS Y+N T +++G+K I      AKDI 
Sbjct: 54  KQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIP 113

Query: 126 FPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNII 161
           FP  L +NE RQ     +L + E  L Y + SQ +I
Sbjct: 114 FPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLI 149

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 90/205 (43%), Gaps = 26/205 (12%)

Query: 227 NPKATPNSKEEIVKTKKFG---ILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQE 283
           NPKATP + E +VKT+      ILSKS+                 Y  +   KY  K +E
Sbjct: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEE 435

Query: 284 YENELKSLDEKIVASNELIEQCKKDTDAKLD-IMNAELVKRMFDERSVQTDDKMKIFSET 342
           + N +  LD KI +    IE+   D  AK+D +MN  + K   D         ++ + E 
Sbjct: 436 FNNSINELDLKIKS----IEKDIIDYKAKIDSLMNDNVEKNDID---------IENYHEK 482

Query: 343 KLIKREKI---DEKINVEELDDQVVGEI-----DQLNKEKEKVYDEFNEWTFNMTNIAEQ 394
            LIK+ +I   +++I            I     D + K+ +       +W    + + EQ
Sbjct: 483 MLIKKNQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSD-CTPLIKDWKSEQSKLNEQ 541

Query: 395 LDAKLFKIKQINITQMNLQNKIDGL 419
           +D+K+  IKQ+N    +++ KI  L
Sbjct: 542 IDSKVNVIKQLNKNLADVKQKITEL 566

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 112/268 (41%), Gaps = 46/268 (17%)

Query: 86  NEKTKRFPTVSATSNYTNRTSKEMGFK-KIPKDKNFAKDIFFPSYLTQNEQRQQIELTKL 144
            +K K  P  +  S+Y     +E+G+K K PK   +A++I FP+ LT+NE RQ+  L  L
Sbjct: 7   GKKRKSSPISNPHSSYNTLKPEELGYKQKFPK--KYAREIHFPAELTENEMRQRAILQDL 64

Query: 145 VKLEKDLQYKKDSQNIIDLTKXXXXXXXXXXLDDSANAEKPPLEK------PIDPKLTPM 198
            + E+ L + K SQ ++ + K                    P+EK      P+D +  P 
Sbjct: 65  DEKEQHLDHLKKSQRVVYIDK--------------------PVEKEDVVREPVDIQKVPK 104

Query: 199 VSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKTKKFG----ILSKSIXXX 254
           + +             ++     E + RNP ATP + EE+V  K         SK I   
Sbjct: 105 IPY-------------SEYGQCNEAEFRNPVATPETPEEVVIYKHLNGTNKAYSKEIFDN 151

Query: 255 XXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIVASNELIEQCKKDTDAKLD 314
                        S + +  ++   KM+EY  +L  LD++I +    +   ++     +D
Sbjct: 152 IQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRKQQRAID 211

Query: 315 IMNAELVKRMFDERSVQTDDKMKIFSET 342
           +    L K    +    T +K KI+ ET
Sbjct: 212 LNENRLTKTFLLQTQQFTAEKNKIYKET 239

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 119/250 (47%), Gaps = 3/250 (1%)

Query: 228 PKATPNSKEEIVKTKKFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENE 287
           P  TP   E ++ T + G +SK++                +   +  + Y +  Q YE E
Sbjct: 279 PNGTPEEPEVVLLTNR-GYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337

Query: 288 LKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKR 347
           +  LD +I      I   + +T+ ++D + A L K + D ++   D +  +  + +  + 
Sbjct: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHEQAEAQRA 397

Query: 348 EKIDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINI 407
           E++ +K  +   + ++  EID+L K KE    E  E    +  + +QLDA+  +++ +  
Sbjct: 398 EQLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTD 457

Query: 408 TQMNLQNKIDGLNNEKLGLTKEI-EANKFTHANNVETIENVDNKQYLPKLNNIDSQINDL 466
            Q  +   +  L  +K  L +E+ ++N+FT  N  E +E ++   Y   +  ID++ +++
Sbjct: 458 QQAEVSVVLATLQEQKAQLEREVADSNEFTKRNR-EALERLNQTDYTATVREIDAKNSEI 516

Query: 467 LNQLTLIKQE 476
           L ++  I+QE
Sbjct: 517 LTEIAKIRQE 526

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 17/98 (17%)

Query: 66  EEYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIF 125
           +EY SPFR  +            T +FPT       T     E   +++P       DI 
Sbjct: 54  DEYYSPFRDAIAVEE---AHGSGTLKFPT-------TGTHVTEEARRRVP-------DID 96

Query: 126 FPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDL 163
            P  L+  ++RQ+ +L +L   E  L+  K+SQ I+D+
Sbjct: 97  EPKRLSTVDERQRQQLQELELKEGQLRLYKESQKIVDV 134

>YPR049C Chr16 complement(661137..664673) [3537 bp, 1178 aa] {ON}
           ATG11Adapter protein for pexophagy and the
           cytoplasm-to-vacuole targeting (Cvt) pathway; directs
           receptor-bound cargo to the phagophore assembly site
           (PAS) for packaging into vesicles; required for
           recruiting other proteins to the (PAS)
          Length = 1178

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 110/218 (50%), Gaps = 29/218 (13%)

Query: 440 NVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANEKIQLSELTQKLEKERMDHE 499
           N++++   +N Q    +  ++S ++DLL+QL L+K+EN  + +Q+SE+ +K+        
Sbjct: 691 NIDSVSQANNHQ----IQELESNVDDLLHQLQLLKEENNRKSMQISEMGKKIS------- 739

Query: 500 EKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMTNLKTSYEQQLADFKSKLME 559
                D E  K      L    +EL +  N+ Q +H TE+  L  S+++QL D  S+  E
Sbjct: 740 -----DLEVEKTAYRETLTNLNQELARLTNEEQ-SHRTEIFTLNASFKKQLNDIISQDNE 793

Query: 560 QQDKV----DDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEI--LSKQHQQAE-AYNAVQ 612
           + +K+    DD+   + RL+     E   + +Q  N+LK +I  L KQ   +E +Y    
Sbjct: 794 KIEKLTGDYDDVSKSRERLQMDLD-ESNKKHEQEVNLLKADIERLGKQIVTSEKSYAETN 852

Query: 613 LAQKKKN----ASPVAEDLMKESHIPALSKAKDDSLFE 646
            +  +K       P+AED  +E+ I A ++   D +F+
Sbjct: 853 SSSMEKGEKFETIPLAEDPGRENQISAYTQTLQDRIFD 890

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 106/265 (40%), Gaps = 50/265 (18%)

Query: 68  YLSPFRSNLVTNNKA--YIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIF 125
           ++S FR  L+ N     Y+ + K +R P++     Y +R                  +I 
Sbjct: 57  FVSTFREPLMNNRYYANYLYHMKQQRHPSLRK---YESRNP----------------NIV 97

Query: 126 FPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTKXXXXXXXXXXLDDSANAEKP 185
            P +L   E++Q+ +L  L   E++LQ  K+SQ II                 S+ A   
Sbjct: 98  TPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRIIT----------------SSTARTY 141

Query: 186 PLEKPIDPKLTPMVSFQLS---TPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKTK 242
           P ++ I PK    V ++ S   TPP   +     + P      + P ATP + E +V+  
Sbjct: 142 PQQQNIYPK----VYYEHSKKRTPPTEQEQFHRGMNPP---SPKYPIATPQNPEILVQLT 194

Query: 243 --KFGILSKSIXXXXXXXXXXXXXXXASYKAEMQEKYDVKMQEYENELKSLDEKIVASNE 300
             +  I+SK                  SY AE    Y+ + Q Y+ ++  LDEKI    E
Sbjct: 195 ENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQKQIDVLDEKIRYYQE 254

Query: 301 LIEQCKKDTDAKLDI-MNAELVKRM 324
           +    + D     +I  N  LVKR 
Sbjct: 255 MSNVLEADYLRVSEINKNKALVKRF 279

>Kwal_55.21822 s55 (994578..995429) [852 bp, 283 aa] {ON} YNL202W
           (SPS19) - peroxisomal 2,4-dienoyl-CoA reductase [contig
           126] FULL
          Length = 283

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 4/46 (8%)

Query: 271 AEMQEKYDVKMQEYENELKSLDEKIVASNELIEQCKKDTDAKLDIM 316
            E+ EKY VK++ Y+  + S   K VAS   I+Q KKD   K+DIM
Sbjct: 72  GEISEKYGVKVKAYKCSVTS--SKDVAST--IDQIKKDFGGKIDIM 113

>Skud_16.336 Chr16 complement(625927..629469) [3543 bp, 1180 aa]
           {ON} YPR049C (REAL)
          Length = 1180

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 56/109 (51%), Gaps = 13/109 (11%)

Query: 459 IDSQINDLLNQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLG 518
           ++S + DLL Q+  +++EN  +   +SE+ + +             D+E  K+     L 
Sbjct: 706 LESNVEDLLQQIRFLREENIQKSKDISEMKKNIS------------DSEVEKKAYRETLN 753

Query: 519 KQREELEQKANDLQLNHETEMTNLKTSYEQQLADFKSKLMEQQDKVDDL 567
              +EL +  N+ Q +HETE+  L  ++++QL D  ++  E+  K+D L
Sbjct: 754 NLNQELARLTNEEQ-SHETEVFALNATFKKQLNDIIAQDNEKLAKIDKL 801

>KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {ON}
           Anc_8.604 YOR195W
          Length = 732

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 125/249 (50%), Gaps = 28/249 (11%)

Query: 346 KREKIDE-KINVEELDDQVVG---EIDQLNKEKEKVYDEFNEWTF---NMTNIAEQLDAK 398
           K  KI+E  +N + L+++ V    EID L  EK ++  + NE       + +  E+L  K
Sbjct: 239 KNSKINEISLNFDRLNNEYVNQKKEIDNLMTEKNEIVTKLNEMQVVNNELVSKNEKLKVK 298

Query: 399 L--FK--IKQINITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLP 454
           +  FK  I  +N  Q  L++K D L +E   L K  E       NN+    +++N++ + 
Sbjct: 299 VTEFKNEINTLNANQSLLKSKYDNLISENDALKKNKEL-----LNNL----SIENEKLIN 349

Query: 455 KLNNIDSQINDLLNQLTLIKQENANEKIQLSELTQK---LEKERMDHEEKLKLDAEERKR 511
           +  N +++ ++L N+     ++ A  K Q SELT +   LE +  +  E L +  EE K 
Sbjct: 350 QGKNWETRFSELENEKDSADEKFAQIKEQFSELTSRNESLENQITELNELLSVAKEENKN 409

Query: 512 Q----EENLLGKQREELEQKANDLQLNHETEMTNLKTSYEQQLADFKSKLMEQQDKVDDL 567
                E N L ++R+EL++K   ++L+ E E++ L++     L +  S L   Q ++++L
Sbjct: 410 SDLLNEVNSLQEERKELQKKLEKIELDKENEVSILESKI-SALNETISSLQSCQKEIENL 468

Query: 568 KLQKSRLEG 576
              K+ LE 
Sbjct: 469 NSTKTNLEN 477

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 486 ELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMTNLKTS 545
           +LT+   KE +D+ E   LD E++++ EEN  GK ++ L+ +   L     T  T L   
Sbjct: 38  QLTKDKHKETIDYSETSSLDEEKQQQPEEN--GKLKQGLKSRHVQLIALGGTIGTGLLVG 95

Query: 546 YEQQLA 551
             Q LA
Sbjct: 96  SSQTLA 101

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.126    0.329 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,611,555
Number of extensions: 3292884
Number of successful extensions: 37794
Number of sequences better than 10.0: 2981
Number of HSP's gapped: 31316
Number of HSP's successfully gapped: 4695
Length of query: 656
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 540
Effective length of database: 40,180,143
Effective search space: 21697277220
Effective search space used: 21697277220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 69 (31.2 bits)