Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G009303.493ON1761769021e-125
NCAS0E008003.493ON1741766721e-90
CAGL0I10494g3.493ON1721775965e-79
YPR149W (NCE102)3.493ON1731765871e-77
Smik_16.4023.493ON1731765818e-77
KAFR0C019703.493ON1791815758e-76
Skud_16.4443.493ON1731765635e-74
CAGL0L08448g3.493ON1731765601e-73
YGR131W (FHN1)3.493ON1741775557e-73
Suva_16.4783.493ON1661765287e-69
Suva_7.4193.493ON1741765252e-68
NDAI0B058803.493ON1821825263e-68
Smik_6.2273.493ON1741765132e-66
TDEL0D056103.493ON1751785036e-65
KNAG0B008003.493ON1821835012e-64
KNAG0A079503.493ON1821824864e-62
Skud_7.4423.493ON1741774776e-61
Kpol_1017.63.493ON1871764725e-60
SAKL0F02750g3.493ON1701764593e-58
NCAS0F035603.493ON1831834473e-56
TPHA0D032803.493ON1841844361e-54
ZYRO0D09966g3.493ON1781784352e-54
TBLA0D029603.493ON1891894326e-54
KAFR0G037003.493ON1861864301e-53
TBLA0C044903.493ON1861694143e-51
KLLA0D16280g3.493ON1691764045e-50
KLTH0F14850g3.493ON1711773951e-48
Kwal_55.212383.493ON1701763864e-47
Ecym_12363.493ON1691763073e-35
AFR312W3.493ON1681223064e-35
Suva_2.5705.485ON44642730.43
YDL222C (FMP45)2.55ON309115700.84
KAFR0B011407.297ON42642654.6
Kpol_530.476.102ON13564625.9
Suva_8.214.15ON186864646.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00930
         (176 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   352   e-125
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   263   1e-90
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   234   5e-79
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   230   1e-77
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   228   8e-77
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   226   8e-76
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   221   5e-74
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   220   1e-73
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   218   7e-73
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   207   7e-69
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   206   2e-68
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   207   3e-68
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   202   2e-66
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   198   6e-65
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   197   2e-64
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   191   4e-62
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   188   6e-61
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   186   5e-60
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   181   3e-58
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   176   3e-56
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   172   1e-54
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   172   2e-54
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   171   6e-54
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   170   1e-53
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   164   3e-51
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   160   5e-50
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   156   1e-48
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   153   4e-47
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   122   3e-35
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   122   4e-35
Suva_2.570 Chr2 (1011195..1012535) [1341 bp, 446 aa] {ON} YDR393...    33   0.43 
YDL222C Chr4 complement(60872..61801) [930 bp, 309 aa] {ON}  FMP...    32   0.84 
KAFR0B01140 Chr2 (215687..216967) [1281 bp, 426 aa] {ON} Anc_7.2...    30   4.6  
Kpol_530.47 s530 complement(108566..108973) [408 bp, 135 aa] {ON...    28   5.9  
Suva_8.21 Chr8 (41705..47311) [5607 bp, 1868 aa] {ON} YHL030W (R...    29   6.1  

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  352 bits (902), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 176/176 (100%), Positives = 176/176 (100%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  263 bits (672), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 133/176 (75%), Positives = 150/176 (85%), Gaps = 2/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML VADNLLR+LNA+FLVICIGLNSALLNT+  +NSRINYCMFTC YCL TDS +GI AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           FF+ L+ P + F LDFLNF+FTFVAGTVLATGIR+HSC ++ Y++ NKITQG  NRCRES
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           QALVAFFYFSM IFL KL MSTI+MIQNGAF+     RRRRRN AAE+GVPSISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHI-GRRRRRN-AAEIGVPSISQV 174

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  234 bits (596), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 113/177 (63%), Positives = 140/177 (79%), Gaps = 6/177 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLSVADNLLR++NA+FL+ICIGL S+L+NT++ H+SR+N+C+F   Y + TDS +GI AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRN-KITQGSGNRCRE 119
           FFE L++P +LF LDFLNF FTF AGTVLA GIR+HSCNN+ YL+R  KI QGSG RCR+
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           +QALVAFFYFSM IFL K+ MS +S++ NGAF       + RR    EVGVPSISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGA-----KLRRKHHTEVGVPSISQV 172

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  230 bits (587), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 137/176 (77%), Gaps = 3/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML++ADN+LR++N +FLVI IGL S+LLNTQ  H+SR+NYCMF C Y + TDS +G+ AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           F E L++P +LFTLDFLNF FTF AGTVLA GIR+HSCNN SY+D NKITQGSG RCR++
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           QA VAF YFS  IFL K  MS  +MI NGAF +   S+RRR     +VGVP+ISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---TGQVGVPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  228 bits (581), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 112/176 (63%), Positives = 136/176 (77%), Gaps = 3/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML++ADN+LR++N +FLVI I L S+LLNTQ  H+SR+NYCMF C Y + TDS +G+ AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           F E L++P +LFTLDFLNF FTF AGTVLA GIR+HSCNN SY+D NKITQGSG RCR++
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           QA VAF YFS  IFL K  MS  +MI NGAF +   S+RRR     +VGVP+ISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRR---TGQVGVPTISQV 173

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  226 bits (575), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 141/181 (77%), Gaps = 7/181 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGH-NSRINYCMFTCVYCLLTDSFFGILA 59
           ML VADN+LRL+NA+FL+I I L SAL+NTQ GH NSR+NYCMF C + L  DS +GI A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
           NFF+ L++P +LFTLDFLNF+FTF A T LA GIR+HSC NQSYLD NKI +GSG RCRE
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAF---SNTFTSRRRRRNGAAEV-GVPSISQ 175
           +QALVAF YFS  IF+ K+ MS I++ QNGAF   S+ F SRR++   A +V GVP+ISQ
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKH--ATDVGGVPNISQ 178

Query: 176 V 176
           V
Sbjct: 179 V 179

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  221 bits (563), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 110/176 (62%), Positives = 136/176 (77%), Gaps = 3/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML+ ADN+LR++N +FLVI IGL S+LLNTQ  ++SR+N+CMF   Y + TDS +G+ AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           FFE L++P +LFTLDFLNF FTF AGTVLA GIR+HSCNN+SY+D N ITQGSG RCR++
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           QA VAF YFS  IFL K  MS  +MI NGAF +   S+RRR     +VGVP+ISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---TGQVGVPTISQV 173

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  220 bits (560), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 110/176 (62%), Positives = 133/176 (75%), Gaps = 3/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML+V DNLLR++N +F+VICIGL S L+ T+  H+SR+NYCMF   Y + TDS +G+ AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           FFE L++P ILFTLDFLNF+F   AG VLA GIR+HSCNN  Y + NKI QGS  RCRES
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           QA VAFF+FSM IFL K+ MS +++  NGAF   F   RRRRN  AEVGVPS+SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFI--RRRRNN-AEVGVPSVSQV 173

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  218 bits (555), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 138/177 (77%), Gaps = 4/177 (2%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS ADNL+R++NA+FL+I IGL S L+ TQ  H+SR+N+CMF  VY L+TDS +G LAN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           F+  L++P IL  LDFLNF FTFVA T LA GIR HSC N++YL++NKI QGS +RC +S
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAF-SNTFTSRRRRRNGAAEVGVPSISQV 176
           QA VAFFYFS F+FLIK+ ++T+ M+QNG F SNT  SRRR R    ++G+P+ISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARR---QMGIPTISQV 174

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  207 bits (528), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 107/176 (60%), Positives = 130/176 (73%), Gaps = 10/176 (5%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML+  DN+LR++N +FLVI IGL S+LLNTQ G++SRINYCMF   Y ++TDS +G+ AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           FFE L++P ILF+LDFLNF FTF       T IR+HSC NQ+YL  N ITQGSGNRCRE+
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTF-------TAIRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           QA VAF YFS  IFL K  MS  +MI NGAF +   S+RRR     +VGVP+ISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---TGQVGVPTISQV 166

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  206 bits (525), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 136/176 (77%), Gaps = 2/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLSVADN++R++NA+FL+I IGL S L+++Q  H+SR+N+CMF   Y LLTDSF+G LAN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
            +  L++P I+F LDFLNF FTF+AGT LA GIR HSC+N++YLD NKITQGSG+RC ++
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           +A V FFYFS  +FLIK+ +S  +M+QNG F    +  RRR     ++G+P+ISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRR--ARRQMGIPTISQV 174

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  207 bits (526), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 135/182 (74%), Gaps = 6/182 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS  DN+LR++NA+FLV+ +   SALLNTQ+ ++SRIN+CMF   + LLTDSFFG+  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FFEFL-SFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
            F+ L S+P +LF  DFLNF FTF AGTVLA  IR+HSC N+ Y++ N ITQGS NRCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAF-SNTF----TSRRRRRNGAAEVGVPSIS 174
           SQA VAFFYFS FIFL K+ MS I+M  NG F S T+    + RR  R+GA EVGVP+IS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 175 QV 176
           QV
Sbjct: 181 QV 182

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  202 bits (513), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 102/176 (57%), Positives = 130/176 (73%), Gaps = 2/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS ADNL+R++NA+FL+I IGL S L++TQ  H+SR+N+CMFT  Y L+TDS +G LAN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           F+  L++P IL  LD LNF FTFVA T LA GIR HSC N++YL++NKITQ S +RC +S
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           QA VAFFYFS F+FLIK+ ++    IQNG F       RRR     ++GVP+ISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRR--ARRQLGVPTISQV 174

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  198 bits (503), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 135/178 (75%), Gaps = 5/178 (2%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML++ DN LRL+N  FLVI +GL   L++++ GH+SR+N+CMF   + ++TDSF+GILAN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
            +E  ++P ILF LDFLNF+FTF A T LA GIR+HSC NQ YLD N ITQGS  RCR +
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSN--TFTSRRRRRNGAAEVGVPSISQV 176
           QA VAFFYFS FIFL K+ MS I +I NG FS+  T TSRRR+   +A+VGVP+ISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRK---SAQVGVPTISQV 175

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  197 bits (501), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 126/183 (68%), Gaps = 8/183 (4%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML VADNLLRLLN  FLVIC+   S L+NTQ+ H SR+NYCMF   Y + TD  +G+LAN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           F+E L++P ILFTLDFLNF+FT  AG VLA GIR+HSC N  Y +RN I QGS NRCR S
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSR-------RRRRNGAAEVGVPSI 173
           QA  AFF+FSM IF+ K+ MS I++  NGAF+ T +S+                 GVPSI
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFT-TASSKFGRRRRHGGGVGVPETSGVPSI 179

Query: 174 SQV 176
           SQV
Sbjct: 180 SQV 182

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  191 bits (486), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 105/182 (57%), Positives = 133/182 (73%), Gaps = 6/182 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML++AD  LRL+N +FLVIC+GL SALLNTQ GH+SRINYCMFT  Y + TDSF+G++AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           F+E LS+P +L  LDFLNF FT  AG VLA GIR+HSC N +Y ++NKI QGS NRCR++
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSR------RRRRNGAAEVGVPSIS 174
           QA VAFF+FSM IFL K  MS +++  NG F +  +S       +R+R      GVP+IS
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180

Query: 175 QV 176
            V
Sbjct: 181 TV 182

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  188 bits (477), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 131/177 (74%), Gaps = 4/177 (2%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS ADNL+R+++A+FL+I IGL   L+ TQ   +SR+N+CMF   Y L+TDSF+G LAN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           F+  L++P IL  LDFLNF FTF A T LA GIR HSC N++YL++N ITQGS +RC +S
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFS-NTFTSRRRRRNGAAEVGVPSISQV 176
           QA VAFFYFS F+FLIK+ +S   M+QNG F  NT   RRR R    ++GVP+ISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARR---QMGVPTISQV 174

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  186 bits (472), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 132/176 (75%), Gaps = 1/176 (0%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS+ADN++R +N  F VIC+GL  +LL T++GH+SR+NYCMF   + ++TDSF+GILAN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  FF-EFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
            +    ++P ILF  DFLNF+FTF AGTVL+ GIR+HSC N++Y+D NKI QGS +RCR+
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQ 175
           +QA +AFFYFS FIF +K+ MS I+++ NGA   +  S  RRR+  A +GVP  S 
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASS 176

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  181 bits (459), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 96/176 (54%), Positives = 123/176 (69%), Gaps = 6/176 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS+ DN LRL+N  FLVI +GL  +L+ TQ  H+ R+N+ +FT  + L+TDSF+ + AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
            F   ++P +L T DFLNF FTF A T LA GIR+HSC N+SYL  N ITQGS +RCR++
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           QA VAF YFS FIFL KL +S I++  +GAF +   SRR      A VGVP+ISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSGSRR------ANVGVPTISQV 170

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  176 bits (447), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 111/183 (60%), Positives = 130/183 (71%), Gaps = 7/183 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS  DN LR  N +FLV+ I   S LL+TQ   +SR+NYCMF   + LLTDSFFG+ AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FFEFLS-FPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
             +FLS +P ILF  DFLNF FTF AGTVLA GIR HSCNN+ YL+ NKI QGSG RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAF-SNTFTSRRRRRN-----GAAEVGVPSI 173
           SQA VAFFYF+ F+FL K+ MS ISM  NGAF S +F SRR+RR+     G    GVP+I
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVPTI 180

Query: 174 SQV 176
           S+V
Sbjct: 181 SEV 183

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  172 bits (436), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 99/184 (53%), Positives = 127/184 (69%), Gaps = 8/184 (4%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML +ADN+LR +N  F VIC+GL  +LL TQ  H+SR+NYC+F   + L+TD+F+G LAN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FFEF-LSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
            +   L++P ILF  DFLNF+FTF AGTVLA G R+HSC NQSYLD N ITQGS +RCR+
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSN-------TFTSRRRRRNGAAEVGVPS 172
           +QA  AFFYFS FIFL KL MS+I++  NGA  +                  + ++GVP+
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 173 ISQV 176
           ISQV
Sbjct: 181 ISQV 184

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  172 bits (435), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 133/178 (74%), Gaps = 2/178 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQ-GHNSRINYCMFTCVYCLLTDSFFGILA 59
           ML++ DN+LR +N  F VI +GL   L+ +++ GHNSR+N+CMF   + ++ DSF+GILA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
           N F   +FP ILF LDFLNF FTF A T LA GIR+HSC N+ YLD NKITQGS +RCRE
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGA-FSNTFTSRRRRRNGAAEVGVPSISQV 176
           +QA+VAFFYF+ FIFL K+ MS +S++ NGA  S++  S RRRR   A VGVP+ISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  171 bits (432), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 118/189 (62%), Gaps = 13/189 (6%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNS-RINYCMFTCVYCLLTDSFFGILA 59
           ML + DN+ R+ N  F VI  G+   LLNT+ GH+S R+NYCMF   + L++DSF+GILA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NFF-EFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCR 118
           N   E  +FP ILF  DFLNF FTF AGTVLA GIR+HSC N+ Y   N I QGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 ESQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFT---------SRRRRRNGAAEV- 168
           E+QA +AFFYFSMF+FL+K+ ++ ++    G    T            RR R     ++ 
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQTGYGGGYGGRSFGRRPRTRAPPQMN 180

Query: 169 -GVPSISQV 176
            G  SISQV
Sbjct: 181 KGGISISQV 189

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  170 bits (430), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 129/186 (69%), Gaps = 10/186 (5%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNS-RINYCMFTCVYCLLTDSFFGILA 59
           ML++ADN LRL+N  F+VI +   + LLNT+QGHNS R+NYCMF   + +LTDS +G+ A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
           NFFE L++P ILF  DFLNF F F AGTVLA GIR+H+CNN++Y + NKI +GS  RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGA----FSNTFTSRRRRRNGAAEV-----GV 170
           +QA VAFFYFSM IFL+K   S +  I  G      S  F SRR+RR+    V     GV
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTGV 180

Query: 171 PSISQV 176
           P++S+V
Sbjct: 181 PTVSEV 186

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  164 bits (414), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 117/169 (69%), Gaps = 8/169 (4%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQ-GHNSRINYCMFTCVYCLLTDSFFGILA 59
           MLS   N+LR++N  FLVI  G+   L+ +++  H+ R+NYCMF   + L+TDSF+ I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFFE-FLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCR 118
           NF+    ++P +L++ DFLNF+FTF AGTVL+ GIR+HSC N+ YL  NKITQGS  RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 ESQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSN------TFTSRRRR 161
            +QA +AF+YFS FI+L++L  S++ M +NG F        +F + RRR
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPEERGGASFRNSRRR 169

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  160 bits (404), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 116/176 (65%), Gaps = 7/176 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS+ DN LR +N +FL+I +GL   L+ TQ   +SR+N+ +F  V+ ++ DS + ++AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           F   L++P IL +LDFLN+ FTF A T LA GIR  SC N S+   NKI +GS +RCR++
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           QA   F YFS  IFL+K  +S ++ I +GAF    TS  R+     +VGVP+ISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFG---TSSNRK----TQVGVPTISQV 169

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  156 bits (395), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 92/177 (51%), Positives = 117/177 (66%), Gaps = 7/177 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHN-SRINYCMFTCVYCLLTDSFFGILA 59
           MLS+ DN LR LN  FLVI +GL  +L  T + HN  ++N+ +FT  + LL DS + I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
           NF   L++P ++   DFLNF FTF A T LA  IR+HSC NQ YLD N +TQGS +RCR+
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           +QA VAF YFS FIFL KL +S +++I  GAF     +   RR G   VGVP+ISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFG----AGSSRRTG--NVGVPTISQV 171

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  153 bits (386), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 119/176 (67%), Gaps = 6/176 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS+ DN LR  N +FL+I +GL  +L  T+  +N ++N+ +F   + LL D+ + I AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           F   L++P ++   DFLNF FTF A T LA  IR HSC N  Y+D NK+TQGS +RCR++
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           QA VAF YF+ F+FL+KLA+S +++   GAFS   TS  R+   +A VGVP+ISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFS---TSSGRK---SANVGVPTISQV 170

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  122 bits (307), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 108/176 (61%), Gaps = 7/176 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS+ DN LR  N +FL+I + L  +L+N Q   +SR+N+ +FT ++ LL DS + +LAN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           F   L++P +L T D LN  FTF A T L   I  HSC+N  +L  N I++G   RCR+ 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176
           QA   F +FS FIFL K  +S ++++  GAFS    S   R+ G    GVP+ISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFS----SGSGRKTGG---GVPTISQV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  122 bits (306), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 84/122 (68%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS+ DN LR +N +FL+I +GL  +L++ Q+  +SR+N+ +FT V+ L+TDSF+ I+AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
           F    ++P I   LD LN  FTF A T L   I +HSC+N+ +LD N I++ S +RCR+ 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QA 122
           QA
Sbjct: 121 QA 122

>Suva_2.570 Chr2 (1011195..1012535) [1341 bp, 446 aa] {ON} YDR393W
           (REAL)
          Length = 446

 Score = 32.7 bits (73), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 53  SFFGILANF-FEFLSFPFILFTLDFLNFSFTFVAGTVLATGI 93
           SFF  L N  F+ L  P ++ TL+F  +S + V+ T+L +G+
Sbjct: 404 SFFSTLRNIKFKRLDAPLVVNTLEFYLYSISLVSMTILISGV 445

>YDL222C Chr4 complement(60872..61801) [930 bp, 309 aa] {ON}
           FMP45Integral membrane protein localized to mitochondria
           (untagged protein); required for sporulation and
           maintaining sphingolipid content; has sequence
           similarity to SUR7 and YNL194C
          Length = 309

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 46/115 (40%), Gaps = 23/115 (20%)

Query: 36  SRINYCMFTCVYCLLTDSFF-------GILANFFEFLSFPFILFTLDFLNFSFTFVAGTV 88
           SR+ + M      LL   FF       G LA F  F + P +   L +L F F  +A   
Sbjct: 110 SRVGWAM------LLISLFFIVLALVPGFLATFLPFKAVPVLYCVLSWLAFFFIILA-AC 162

Query: 89  LATGIRSHSCNNQSYLDRNKITQGSGNRCRESQALVAFFYFSMFIFLIKLAMSTI 143
           L TG          Y+   K  + SG   R      AF + S+F+ L+    STI
Sbjct: 163 LYTGC---------YVKARKTFRNSGRSARLGPKNFAFIWTSVFLMLVNAIWSTI 208

>KAFR0B01140 Chr2 (215687..216967) [1281 bp, 426 aa] {ON} Anc_7.297
           YDL133W
          Length = 426

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 26/42 (61%)

Query: 117 CRESQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSR 158
           CR+ +AL AF +  +F++++   +S I +++  + +NT   R
Sbjct: 384 CRKQKALSAFLFVLLFMWILIFTVSIIRVVEKVSSANTRNER 425

>Kpol_530.47 s530 complement(108566..108973) [408 bp, 135 aa] {ON}
           complement(108566..108973) [408 nt, 136 aa]
          Length = 135

 Score = 28.5 bits (62), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 81  FTFVAGTVL-ATGIRSHSCNNQSYLDRNKITQGSGNRCRESQALVAFFYFSMFIFLIKLA 139
           FTF+    L A  I+     NQ  LD  +I +      RES   +AF+    F++L K+ 
Sbjct: 70  FTFLLNLPLFAYNIKKFYEKNQ-LLDATEIFRTLSKHKRESFLKLAFYLLMFFVYLYKMI 128

Query: 140 MSTI 143
           MS I
Sbjct: 129 MSLI 132

>Suva_8.21 Chr8 (41705..47311) [5607 bp, 1868 aa] {ON} YHL030W
           (REAL)
          Length = 1868

 Score = 29.3 bits (64), Expect = 6.1,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 6   DNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILANFFEFL 65
           D LL+  NA+F  +C G+ +A  + Q   N+ +    F CV    + +     A F +  
Sbjct: 229 DQLLKFKNAIFRFVCHGMAAANCDKQPSKNTEL--MKFLCVVSTDSSTLSDSAAQFMKRF 286

Query: 66  SFPF 69
           + P+
Sbjct: 287 AVPY 290

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.332    0.140    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,237,608
Number of extensions: 614870
Number of successful extensions: 1991
Number of sequences better than 10.0: 46
Number of HSP's gapped: 1983
Number of HSP's successfully gapped: 46
Length of query: 176
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 74
Effective length of database: 41,785,467
Effective search space: 3092124558
Effective search space used: 3092124558
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 62 (28.5 bits)