Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G009303.493ON1761767491e-102
NCAS0E008003.493ON1741765862e-77
CAGL0I10494g3.493ON1721775183e-67
YPR149W (NCE102)3.493ON1731765044e-65
Smik_16.4023.493ON1731764993e-64
KAFR0C019703.493ON1791794881e-62
Skud_16.4443.493ON1731764768e-61
YGR131W (FHN1)3.493ON1741764751e-60
Suva_7.4193.493ON1741764653e-59
CAGL0L08448g3.493ON1731764621e-58
Smik_6.2273.493ON1741764524e-57
NDAI0B058803.493ON1821824525e-57
KNAG0B008003.493ON1821824422e-55
Suva_16.4783.493ON1661764392e-55
SAKL0F02750g3.493ON1701764212e-52
TDEL0D056103.493ON1751764169e-52
Kpol_1017.63.493ON1871764135e-51
KNAG0A079503.493ON1821504073e-50
Skud_7.4423.493ON1741763994e-49
ZYRO0D09966g3.493ON1781783952e-48
TPHA0D032803.493ON1841843934e-48
TBLA0D029603.493ON1891513919e-48
TBLA0C044903.493ON1861513788e-46
NCAS0F035603.493ON1831513622e-43
KAFR0G037003.493ON1861513552e-42
KLLA0D16280g3.493ON1691763482e-41
KLTH0F14850g3.493ON1711773472e-41
Kwal_55.212383.493ON1701763371e-39
AFR312W3.493ON1681222787e-31
Ecym_12363.493ON1691762464e-26
Kpol_530.476.102ON13564652.4
KNAG0H025905.190ON198050639.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00930
         (176 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   293   e-102
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   230   2e-77
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   204   3e-67
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   198   4e-65
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   196   3e-64
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   192   1e-62
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   187   8e-61
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   187   1e-60
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   183   3e-59
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   182   1e-58
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   178   4e-57
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   178   5e-57
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   174   2e-55
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   173   2e-55
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   166   2e-52
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   164   9e-52
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   163   5e-51
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   161   3e-50
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   158   4e-49
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   156   2e-48
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   155   4e-48
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   155   9e-48
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   150   8e-46
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   144   2e-43
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   141   2e-42
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   138   2e-41
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   138   2e-41
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   134   1e-39
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   111   7e-31
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...    99   4e-26
Kpol_530.47 s530 complement(108566..108973) [408 bp, 135 aa] {ON...    30   2.4  
KNAG0H02590 Chr8 (476608..482550) [5943 bp, 1980 aa] {ON} Anc_5....    29   9.9  

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  293 bits (749), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 151/176 (85%), Positives = 151/176 (85%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                       TLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QALVAFFYFSMFIFLIKLAMSTISMIQNGA             GAAEVGVPSISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  230 bits (586), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 121/176 (68%), Positives = 134/176 (76%), Gaps = 2/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML VADNLLR+LNA+FLVICIGLNSALLNT+  +NSRINYCMFTC YCL TDS +GI AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                        LDFLNF+FTFVAGTVLATGIR+HSC ++ Y++ NKITQG  NRCRES
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QALVAFFYFSM IFL KL MSTI+MIQNGA              AAE+GVPSISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGA--FTQHIGRRRRRNAAEIGVPSISQV 174

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  204 bits (518), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 126/177 (71%), Gaps = 6/177 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLSVADNLLR++NA+FL+ICIGL S+L+NT++ H+SR+N+C+F   Y + TDS +GI AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRN-KITQGSGNRCRE 119
                        LDFLNF FTF AGTVLA GIR+HSCNN+ YL+R  KI QGSG RCR+
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           +QALVAFFYFSM IFL K+ MS +S++ NGA                EVGVPSISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHH-----TEVGVPSISQV 172

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  198 bits (504), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 102/176 (57%), Positives = 121/176 (68%), Gaps = 3/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML++ADN+LR++N +FLVI IGL S+LLNTQ  H+SR+NYCMF C Y + TDS +G+ AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                       TLDFLNF FTF AGTVLA GIR+HSCNN SY+D NKITQGSG RCR++
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA VAF YFS  IFL K  MS  +MI NGA                +VGVP+ISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---TGQVGVPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  196 bits (499), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 120/176 (68%), Gaps = 3/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML++ADN+LR++N +FLVI I L S+LLNTQ  H+SR+NYCMF C Y + TDS +G+ AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                       TLDFLNF FTF AGTVLA GIR+HSCNN SY+D NKITQGSG RCR++
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA VAF YFS  IFL K  MS  +MI NGA                +VGVP+ISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRR---TGQVGVPTISQV 173

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  192 bits (488), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 122/179 (68%), Gaps = 3/179 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGH-NSRINYCMFTCVYCLLTDSFFGILA 59
           ML VADN+LRL+NA+FL+I I L SAL+NTQ GH NSR+NYCMF C + L  DS +GI A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NXXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
           N            TLDFLNF+FTF A T LA GIR+HSC NQSYLD NKI +GSG RCRE
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGA-XXXXXXXXXXXXXGAAEV-GVPSISQV 176
           +QALVAF YFS  IF+ K+ MS I++ QNGA               A +V GVP+ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  187 bits (476), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 98/176 (55%), Positives = 119/176 (67%), Gaps = 3/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML+ ADN+LR++N +FLVI IGL S+LLNTQ  ++SR+N+CMF   Y + TDS +G+ AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                       TLDFLNF FTF AGTVLA GIR+HSCNN+SY+D N ITQGSG RCR++
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA VAF YFS  IFL K  MS  +MI NGA                +VGVP+ISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---TGQVGVPTISQV 173

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  187 bits (475), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 121/176 (68%), Gaps = 2/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS ADNL+R++NA+FL+I IGL S L+ TQ  H+SR+N+CMF  VY L+TDS +G LAN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                        LDFLNF FTFVA T LA GIR HSC N++YL++NKI QGS +RC +S
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA VAFFYFS F+FLIK+ ++T+ M+QNG                 ++G+P+ISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGG--FGSNTGFSRRRARRQMGIPTISQV 174

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  183 bits (465), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 91/176 (51%), Positives = 121/176 (68%), Gaps = 2/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLSVADN++R++NA+FL+I IGL S L+++Q  H+SR+N+CMF   Y LLTDSF+G LAN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                        LDFLNF FTF+AGT LA GIR HSC+N++YLD NKITQGSG+RC ++
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           +A V FFYFS  +FLIK+ +S  +M+Q                   ++G+P+ISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQ--NGGFGFGNSFGRRRARRQMGIPTISQV 174

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  182 bits (462), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 95/176 (53%), Positives = 116/176 (65%), Gaps = 3/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML+V DNLLR++N +F+VICIGL S L+ T+  H+SR+NYCMF   Y + TDS +G+ AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                       TLDFLNF+F   AG VLA GIR+HSCNN  Y + NKI QGS  RCRES
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA VAFF+FSM IFL K+ MS +++  NGA               AEVGVPS+SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGA---FGTKFIRRRRNNAEVGVPSVSQV 173

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  178 bits (452), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 91/176 (51%), Positives = 116/176 (65%), Gaps = 2/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS ADNL+R++NA+FL+I IGL S L++TQ  H+SR+N+CMFT  Y L+TDS +G LAN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                        LD LNF FTFVA T LA GIR HSC N++YL++NKITQ S +RC +S
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA VAFFYFS F+FLIK+ ++    IQ                   ++GVP+ISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQ--NGGFGFNSGFGRRRARRQLGVPTISQV 174

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  178 bits (452), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 98/182 (53%), Positives = 117/182 (64%), Gaps = 6/182 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS  DN+LR++NA+FLV+ +   SALLNTQ+ ++SRIN+CMF   + LLTDSFFG+  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  XXXXXXXXXXXX-TLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
                          DFLNF FTF AGTVLA  IR+HSC N+ Y++ N ITQGS NRCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQN-----GAXXXXXXXXXXXXXGAAEVGVPSIS 174
           SQA VAFFYFS FIFL K+ MS I+M  N     G              GA EVGVP+IS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 175 QV 176
           QV
Sbjct: 181 QV 182

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  174 bits (442), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 110/182 (60%), Gaps = 6/182 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML VADNLLRLLN  FLVIC+   S L+NTQ+ H SR+NYCMF   Y + TD  +G+LAN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                       TLDFLNF+FT  AG VLA GIR+HSC N  Y +RN I QGS NRCR S
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXX------XXXXXXGAAEVGVPSIS 174
           QA  AFF+FSM IF+ K+ MS I++  NGA                        GVPSIS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 175 QV 176
           QV
Sbjct: 181 QV 182

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  173 bits (439), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 113/176 (64%), Gaps = 10/176 (5%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML+  DN+LR++N +FLVI IGL S+LLNTQ G++SRINYCMF   Y ++TDS +G+ AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                       +LDFLNF FTF       T IR+HSC NQ+YL  N ITQGSGNRCRE+
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTF-------TAIRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA VAF YFS  IFL K  MS  +MI NGA                +VGVP+ISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---TGQVGVPTISQV 166

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  166 bits (421), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 89/176 (50%), Positives = 112/176 (63%), Gaps = 6/176 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS+ DN LRL+N  FLVI +GL  +L+ TQ  H+ R+N+ +FT  + L+TDSF+ + AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                       T DFLNF FTF A T LA GIR+HSC N+SYL  N ITQGS +RCR++
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA VAF YFS FIFL KL +S I++  +GA               A VGVP+ISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSGSRR------ANVGVPTISQV 170

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  164 bits (416), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 117/176 (66%), Gaps = 1/176 (0%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML++ DN LRL+N  FLVI +GL   L++++ GH+SR+N+CMF   + ++TDSF+GILAN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                        LDFLNF+FTF A T LA GIR+HSC NQ YLD N ITQGS  RCR +
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA VAFFYFS FIFL K+ MS I +I NG               +A+VGVP+ISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRK-SAQVGVPTISQV 175

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  163 bits (413), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 89/176 (50%), Positives = 119/176 (67%), Gaps = 1/176 (0%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS+ADN++R +N  F VIC+GL  +LL T++GH+SR+NYCMF   + ++TDSF+GILAN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  XXXXX-XXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
                          DFLNF+FTF AGTVL+ GIR+HSC N++Y+D NKI QGS +RCR+
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQ 175
           +QA +AFFYFS FIF +K+ MS I+++ NGA               A +GVP  S 
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASS 176

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  161 bits (407), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 109/150 (72%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML++AD  LRL+N +FLVIC+GL SALLNTQ GH+SRINYCMFT  Y + TDSF+G++AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                        LDFLNF FT  AG VLA GIR+HSC N +Y ++NKI QGS NRCR++
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGA 150
           QA VAFF+FSM IFL K  MS +++  NG 
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGP 150

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  158 bits (399), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 91/176 (51%), Positives = 116/176 (65%), Gaps = 2/176 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS ADNL+R+++A+FL+I IGL   L+ TQ   +SR+N+CMF   Y L+TDSF+G LAN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                        LDFLNF FTF A T LA GIR HSC N++YL++N ITQGS +RC +S
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA VAFFYFS F+FLIK+ +S   M+QNG                 ++GVP+ISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRAR--RQMGVPTISQV 174

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  156 bits (395), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 92/178 (51%), Positives = 118/178 (66%), Gaps = 2/178 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQ-GHNSRINYCMFTCVYCLLTDSFFGILA 59
           ML++ DN+LR +N  F VI +GL   L+ +++ GHNSR+N+CMF   + ++ DSF+GILA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NXXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
           N             LDFLNF FTF A T LA GIR+HSC N+ YLD NKITQGS +RCRE
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGA-XXXXXXXXXXXXXGAAEVGVPSISQV 176
           +QA+VAFFYF+ FIFL K+ MS +S++ NGA                A VGVP+ISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  155 bits (393), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 118/184 (64%), Gaps = 8/184 (4%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           ML +ADN+LR +N  F VIC+GL  +LL TQ  H+SR+NYC+F   + L+TD+F+G LAN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  XXXXXXXXXXXX-TLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
                          DFLNF+FTF AGTVLA G R+HSC NQSYLD N ITQGS +RCR+
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXX-------XXXXXXXXGAAEVGVPS 172
           +QA  AFFYFS FIFL KL MS+I++  NGA                     + ++GVP+
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 173 ISQV 176
           ISQV
Sbjct: 181 ISQV 184

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  155 bits (391), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 77/151 (50%), Positives = 99/151 (65%), Gaps = 2/151 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNS-RINYCMFTCVYCLLTDSFFGILA 59
           ML + DN+ R+ N  F VI  G+   LLNT+ GH+S R+NYCMF   + L++DSF+GILA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NXXXXXXXXXXXX-TLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCR 118
           N               DFLNF FTF AGTVLA GIR+HSC N+ Y   N I QGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 ESQALVAFFYFSMFIFLIKLAMSTISMIQNG 149
           E+QA +AFFYFSMF+FL+K+ ++ ++    G
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGG 151

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  150 bits (378), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 75/151 (49%), Positives = 102/151 (67%), Gaps = 2/151 (1%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQ-GHNSRINYCMFTCVYCLLTDSFFGILA 59
           MLS   N+LR++N  FLVI  G+   L+ +++  H+ R+NYCMF   + L+TDSF+ I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NXXXXX-XXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCR 118
           N             + DFLNF+FTF AGTVL+ GIR+HSC N+ YL  NKITQGS  RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 ESQALVAFFYFSMFIFLIKLAMSTISMIQNG 149
            +QA +AF+YFS FI+L++L  S++ M +NG
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENG 151

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  144 bits (362), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/151 (58%), Positives = 101/151 (66%), Gaps = 1/151 (0%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS  DN LR  N +FLV+ I   S LL+TQ   +SR+NYCMF   + LLTDSFFG+ AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  XXXXXXXXXXXX-TLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
                          DFLNF FTF AGTVLA GIR HSCNN+ YL+ NKI QGSG RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGA 150
           SQA VAFFYF+ F+FL K+ MS ISM  NGA
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGA 151

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  141 bits (355), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/151 (52%), Positives = 101/151 (66%), Gaps = 1/151 (0%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNS-RINYCMFTCVYCLLTDSFFGILA 59
           ML++ADN LRL+N  F+VI +   + LLNT+QGHNS R+NYCMF   + +LTDS +G+ A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NXXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
           N              DFLNF F F AGTVLA GIR+H+CNN++Y + NKI +GS  RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGA 150
           +QA VAFFYFSM IFL+K   S +  I  G 
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGP 151

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  138 bits (348), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 104/176 (59%), Gaps = 7/176 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS+ DN LR +N +FL+I +GL   L+ TQ   +SR+N+ +F  V+ ++ DS + ++AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                       +LDFLN+ FTF A T LA GIR  SC N S+   NKI +GS +RCR++
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA   F YFS  IFL+K  +S ++ I +GA                +VGVP+ISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNR-------KTQVGVPTISQV 169

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  138 bits (347), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 105/177 (59%), Gaps = 7/177 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHN-SRINYCMFTCVYCLLTDSFFGILA 59
           MLS+ DN LR LN  FLVI +GL  +L  T + HN  ++N+ +FT  + LL DS + I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NXXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119
           N              DFLNF FTF A T LA  IR+HSC NQ YLD N +TQGS +RCR+
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           +QA VAF YFS FIFL KL +S +++I  GA                 VGVP+ISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRR------TGNVGVPTISQV 171

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  134 bits (337), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 106/176 (60%), Gaps = 6/176 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS+ DN LR  N +FL+I +GL  +L  T+  +N ++N+ +F   + LL D+ + I AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                         DFLNF FTF A T LA  IR HSC N  Y+D NK+TQGS +RCR++
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA VAF YF+ F+FL+KLA+S +++   GA              +A VGVP+ISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGA------FSTSSGRKSANVGVPTISQV 170

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  111 bits (278), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 79/122 (64%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS+ DN LR +N +FL+I +GL  +L++ Q+  +SR+N+ +FT V+ L+TDSF+ I+AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                        LD LN  FTF A T L   I +HSC+N+ +LD N I++ S +RCR+ 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QA 122
           QA
Sbjct: 121 QA 122

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score = 99.4 bits (246), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 95/176 (53%), Gaps = 7/176 (3%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60
           MLS+ DN LR  N +FL+I + L  +L+N Q   +SR+N+ +FT ++ LL DS + +LAN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  XXXXXXXXXXXXTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120
                       T D LN  FTF A T L   I  HSC+N  +L  N I++G   RCR+ 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAXXXXXXXXXXXXXGAAEVGVPSISQV 176
           QA   F +FS FIFL K  +S ++++  GA                  GVP+ISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRKTGG-------GVPTISQV 169

>Kpol_530.47 s530 complement(108566..108973) [408 bp, 135 aa] {ON}
           complement(108566..108973) [408 nt, 136 aa]
          Length = 135

 Score = 29.6 bits (65), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 81  FTFVAGTVL-ATGIRSHSCNNQSYLDRNKITQGSGNRCRESQALVAFFYFSMFIFLIKLA 139
           FTF+    L A  I+     NQ  LD  +I +      RES   +AF+    F++L K+ 
Sbjct: 70  FTFLLNLPLFAYNIKKFYEKNQ-LLDATEIFRTLSKHKRESFLKLAFYLLMFFVYLYKMI 128

Query: 140 MSTI 143
           MS I
Sbjct: 129 MSLI 132

>KNAG0H02590 Chr8 (476608..482550) [5943 bp, 1980 aa] {ON} Anc_5.190
           YGR184C
          Length = 1980

 Score = 28.9 bits (63), Expect = 9.9,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 1   MLSVADNLLRLLNAMFLVICIGLNSALLN-TQQGHNSRINYCMFTCVYCL 49
           ML  A+++  L++  F V   GL++ + + T+  H     Y +F C +CL
Sbjct: 305 MLKCAEDISSLMDGYFAVQTNGLSATMTSWTEYVHQETAKYLIFWCNHCL 354

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.138    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,977,027
Number of extensions: 402596
Number of successful extensions: 1051
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1031
Number of HSP's successfully gapped: 34
Length of query: 176
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 74
Effective length of database: 41,785,467
Effective search space: 3092124558
Effective search space used: 3092124558
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)