Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G009203.494ON29629615560.0
NCAS0E007903.494ON32729213590.0
Smik_6.2283.494ON28728412861e-180
Suva_7.4203.494ON28728412841e-180
YGR132C (PHB1)3.494ON28728412641e-177
CAGL0I10472g3.494ON28828812641e-177
KAFR0C019803.494ON28328712451e-174
Skud_7.4433.494ON28728412411e-173
TPHA0D032903.494ON28528712061e-168
SAKL0F02728g3.494ON28228411921e-166
KLTH0F14872g3.494ON28028411921e-166
TDEL0D056203.494ON27927711901e-166
Kpol_1017.53.494ON28328411901e-166
TBLA0D029503.494ON28227911851e-165
KNAG0B007903.494ON28428411551e-160
Kwal_55.212403.494ON28325811491e-159
ZYRO0D09900g3.494ON28328611171e-154
Ecym_12353.494ON28328410771e-148
AFR313C3.494ON28327910421e-143
KLLA0D16302g3.494ON2262099321e-127
Suva_7.5235.98ON3102387398e-97
Skud_7.5655.98ON3102387398e-97
TPHA0A050905.98ON3102357398e-97
ADL141W5.98ON3072317371e-96
KAFR0B042505.98ON3102397362e-96
YGR231C (PHB2)5.98ON3102387353e-96
TBLA0H022205.98ON3072317344e-96
CAGL0L06490g5.98ON3132387336e-96
KLTH0C01672g5.98ON3072507328e-96
NDAI0D025305.98ON3162397321e-95
Kwal_27.127475.98ON3072357311e-95
NCAS0F006005.98ON3132397311e-95
Kpol_1050.615.98ON3102507302e-95
SAKL0G15510g5.98ON3082537275e-95
Smik_16.755.98ON3102387276e-95
TDEL0G012105.98ON3092417259e-95
KNAG0A015805.98ON2882397133e-93
ZYRO0B15136g5.98ON3102387154e-93
KLLA0E15731g5.98ON3082357136e-93
ZYRO0B06666g3.85ON659112731.1
CAGL0C05093g3.171ON704159721.6
KLTH0F18546g7.518ON277793694.1
TPHA0I013002.117ON37978668.0
Kpol_1045.493.171ON717165668.7
KNAG0A074703.410ON18517649.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00920
         (296 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     603   0.0  
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     528   0.0  
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   499   e-180
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   499   e-180
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   491   e-177
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   491   e-177
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   484   e-174
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   482   e-173
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   469   e-168
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   463   e-166
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   463   e-166
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   462   e-166
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   462   e-166
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   461   e-165
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   449   e-160
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   447   e-159
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   434   e-154
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   419   e-148
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   405   e-143
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   363   e-127
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   289   8e-97
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   289   8e-97
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   289   8e-97
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   288   1e-96
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   288   2e-96
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   287   3e-96
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   287   4e-96
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   286   6e-96
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   286   8e-96
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   286   1e-95
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   286   1e-95
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   286   1e-95
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   285   2e-95
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   284   5e-95
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   284   6e-95
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   283   9e-95
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   279   3e-93
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   280   4e-93
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   279   6e-93
ZYRO0B06666g Chr2 complement(533122..535101) [1980 bp, 659 aa] {...    33   1.1  
CAGL0C05093g Chr3 complement(482106..484220) [2115 bp, 704 aa] {...    32   1.6  
KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON} sim...    31   4.1  
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    30   8.0  
Kpol_1045.49 s1045 (115541..117694) [2154 bp, 717 aa] {ON} (1155...    30   8.7  
KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3....    29   9.2  

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/296 (100%), Positives = 296/296 (100%)

Query: 1   MSGPGFNPQQTQKFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVG 60
           MSGPGFNPQQTQKFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVG
Sbjct: 1   MSGPGFNPQQTQKFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVG 60

Query: 61  EGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLG 120
           EGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLG
Sbjct: 61  EGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLG 120

Query: 121 LDYDEKVLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSIT 180
           LDYDEKVLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSIT
Sbjct: 121 LDYDEKVLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSIT 180

Query: 181 HMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKV 240
           HMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKV
Sbjct: 181 HMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKV 240

Query: 241 GDGLLLIRRLEASKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           GDGLLLIRRLEASKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR
Sbjct: 241 GDGLLLIRRLEASKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/292 (88%), Positives = 273/292 (93%), Gaps = 4/292 (1%)

Query: 5   GFNPQQTQKFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTH 64
            FNPQQ  K  N++T+VALP+G+L TG++YSMYDVKGGSRGVIFDRLSGV+  V+GEGTH
Sbjct: 40  AFNPQQGTKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTH 99

Query: 65  FLVPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYD 124
           FLVPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPN+ ELPKIYQNLGLDYD
Sbjct: 100 FLVPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYD 159

Query: 125 EKVLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTF 184
           EKVLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELS RA+EFG+RLEDVSITHMTF
Sbjct: 160 EKVLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTF 219

Query: 185 GPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGL 244
           GPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAE+ISKALAKVGDGL
Sbjct: 220 GPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGL 279

Query: 245 LLIRRLEASKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           LLIRRLEASKDIAQTLANSPN+TYLPGQ    G G D G  SPNSLLLNIGR
Sbjct: 280 LLIRRLEASKDIAQTLANSPNITYLPGQ--QGGRGNDSG--SPNSLLLNIGR 327

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  499 bits (1286), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 242/284 (85%), Positives = 263/284 (92%), Gaps = 2/284 (0%)

Query: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72
           +  +++TKVALPIG++ +G+ YSMYDVKGGSRGVIFDR++GVK  VVGEGTHFLVPWLQK
Sbjct: 6   RLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQK 65

Query: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132
           A+IYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 66  AIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSIG 125

Query: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192
           NEVLKSIVAQFDAAELITQREI+SQ+I+ ELS RANEFG++LEDVSITHMTFGPEFTKAV
Sbjct: 126 NEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAV 185

Query: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252
           EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA
Sbjct: 186 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 245

Query: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           SKDIAQTLANS NV YLP Q  HSG+G    + SPNSLLLNIGR
Sbjct: 246 SKDIAQTLANSSNVVYLPSQ--HSGNGNSESSGSPNSLLLNIGR 287

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  499 bits (1284), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 242/284 (85%), Positives = 264/284 (92%), Gaps = 2/284 (0%)

Query: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72
           +F +++TKVALPIGL+ +G+ YSMYDVKGGSRGVIFDR++GVK  VVGEGTHFLVPWLQK
Sbjct: 6   RFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQK 65

Query: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132
           A+IYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 66  AIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIG 125

Query: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192
           NEVLKSIVAQFDAAELITQREI+SQ+I+ ELS RANEFG++LEDVSITHMTFGPEFTKAV
Sbjct: 126 NEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAV 185

Query: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252
           EQKQIAQQDAERAKF+VEKAEQERQASVIRAEGEAESAE+ISKALAKVGDGLLLIRRLEA
Sbjct: 186 EQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEA 245

Query: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           SKDIAQTLANS NV YLP Q  H+GSG    + SPNSLLLNIGR
Sbjct: 246 SKDIAQTLANSSNVIYLPSQ--HAGSGNSEYSGSPNSLLLNIGR 287

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  491 bits (1264), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 244/284 (85%), Positives = 262/284 (92%), Gaps = 2/284 (0%)

Query: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72
           K  +++TKVALPIG++ +G+ YSMYDVKGGSRGVIFDR++GVK  VVGEGTHFLVPWLQK
Sbjct: 6   KLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQK 65

Query: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132
           A+IYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRP V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 66  AIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSIG 125

Query: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192
           NEVLKSIVAQFDAAELITQREI+SQ+I+ ELS RANEFG++LEDVSITHMTFGPEFTKAV
Sbjct: 126 NEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAV 185

Query: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252
           EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA
Sbjct: 186 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 245

Query: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           SKDIAQTLANS NV YLP Q  HSG G    + SPNSLLLNIGR
Sbjct: 246 SKDIAQTLANSSNVVYLPSQ--HSGGGNSESSGSPNSLLLNIGR 287

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  491 bits (1264), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 242/288 (84%), Positives = 263/288 (91%), Gaps = 3/288 (1%)

Query: 9   QQTQKFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVP 68
           QQ   F  L+TKVA+P+G+ V+G+ YSMYDV+GGSRGVIFDRL GVKS VVGEGTHFLVP
Sbjct: 3   QQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVP 62

Query: 69  WLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVL 128
           WLQKA+IYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRP+V +LP IYQNLGLDYDE+VL
Sbjct: 63  WLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVL 122

Query: 129 PSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEF 188
           PSIGNEVLKSIVAQFDAAELITQREIVSQ+I+ ELS RANEFG+RLEDVSITHMTFGPEF
Sbjct: 123 PSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEF 182

Query: 189 TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIR 248
           TKAVEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE+ISKAL+KVGDGLLLIR
Sbjct: 183 TKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIR 242

Query: 249 RLEASKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           RLEASK+IAQTLANS N+TYLP  N   G   D G  SPN+LLLN+GR
Sbjct: 243 RLEASKEIAQTLANSNNITYLPS-NHAGGDKDDKG--SPNTLLLNLGR 287

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  484 bits (1245), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 236/287 (82%), Positives = 262/287 (91%), Gaps = 6/287 (2%)

Query: 11  TQKFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWL 70
           + +  N++TK+A+P GLL+T VDYSMYDVKGGSRGVIFDR+SGVK  V+GEGTHFLVPWL
Sbjct: 2   STRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWL 61

Query: 71  QKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPS 130
           QKA+IYDVRTKPKSI+TNTGTKDLQMVSLTLR+LHRPNV ELP+IYQNLGLDYDE+VLPS
Sbjct: 62  QKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPS 121

Query: 131 IGNEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTK 190
           IGNEVLKSIVAQFDAAELITQREIVSQRI+ E+S RANEFG++LEDVSITHMTFG EFTK
Sbjct: 122 IGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTK 181

Query: 191 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 250
           AVEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE ISKAL++VGDGLLLIRRL
Sbjct: 182 AVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRL 241

Query: 251 EASKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSS-PNSLLLNIGR 296
           EASKDIA+TL+ S N+TYLPG     G G +G   + PNSLLLNIGR
Sbjct: 242 EASKDIARTLSKSSNITYLPG-----GKGREGDEKTPPNSLLLNIGR 283

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  482 bits (1241), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 242/284 (85%), Positives = 264/284 (92%), Gaps = 2/284 (0%)

Query: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72
           +  +++TKVALPIG++ TG+ Y+MYDVKGGSRGVIFDR++GVK  VVGEGTHFLVPWLQK
Sbjct: 6   RLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQK 65

Query: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132
           A+IYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 66  AIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIG 125

Query: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192
           NEVLKSIVAQFDAAELITQREI+SQ+I+ ELS RANEFG++LEDVSITHMTFGPEFTKAV
Sbjct: 126 NEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAV 185

Query: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252
           EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA
Sbjct: 186 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 245

Query: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           SKDIAQTLANS NV YLP Q  HSG+G+   + SPNSLLLNIGR
Sbjct: 246 SKDIAQTLANSSNVVYLPSQ--HSGNGSGDSSGSPNSLLLNIGR 287

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  469 bits (1206), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 227/287 (79%), Positives = 258/287 (89%), Gaps = 8/287 (2%)

Query: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72
           K  + L K+A+P+G+ V+G+ Y+MYDVKGGSR VIFDRLSGVK  V+GEGTHFL PWLQK
Sbjct: 4   KVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQK 63

Query: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132
           A+++DVRTKPKSIATNTGTKDLQMVSLTLRVLHRP+V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 64  AIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIG 123

Query: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192
           NEVLK+IVAQFDAAELITQREIVS +I+ ELS+R+NEFG++LEDVSITHMTFG EFTKAV
Sbjct: 124 NEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAV 183

Query: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252
           EQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESAE+ISKALAK GDGLLLIRRLEA
Sbjct: 184 EQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLEA 243

Query: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSS---PNSLLLNIGR 296
           SK+IA+TL+ S NVTYLP     SGS ++G N S   PNSLLLN+GR
Sbjct: 244 SKEIAKTLSQSSNVTYLP-----SGSSSNGNNESAGTPNSLLLNLGR 285

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  463 bits (1192), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 225/284 (79%), Positives = 253/284 (89%), Gaps = 4/284 (1%)

Query: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72
           K  + L ++ALPIG+  + + YSMYDVKGG+R VIFDRLSGV+  V+GEGTHFLVPWLQ+
Sbjct: 3   KLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQR 62

Query: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132
           A++YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 63  AIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIG 122

Query: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192
           NEVLK+IVAQFDAAELITQREIVSQRI+ ELS+RA EF +RLEDVSITHMTFG EFTKAV
Sbjct: 123 NEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAV 182

Query: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252
           EQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA++ISKAL+K GDGLLLIRRLEA
Sbjct: 183 EQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEA 242

Query: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           SK+IAQTLANS NVTYLP     +G+G      SPNSLLLN+GR
Sbjct: 243 SKEIAQTLANSSNVTYLPS----NGAGGAEQQGSPNSLLLNLGR 282

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  463 bits (1192), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 226/284 (79%), Positives = 252/284 (88%), Gaps = 6/284 (2%)

Query: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72
           +  + L K+ALP+GL  + + YSMYDVKGGSR VIFDRLSGV+  VVGEGTHFLVPWLQK
Sbjct: 3   RLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQK 62

Query: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132
           AV+YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 63  AVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIG 122

Query: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192
           NEVLK+IVAQFDAAELITQRE VSQRI+ ELS+RA+EF +RLEDVSITHMTFG EFTKAV
Sbjct: 123 NEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAV 182

Query: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252
           EQKQIAQQDAERA+++VE AEQERQASVIRAEGEAESAE+ISKALAK GDGLLLIRR+EA
Sbjct: 183 EQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIEA 242

Query: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           SK+IA+TLANS NVTYLP  +  S  G      SPNSLLLN+GR
Sbjct: 243 SKEIAKTLANSSNVTYLPSSHSASEQG------SPNSLLLNLGR 280

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  462 bits (1190), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 224/277 (80%), Positives = 252/277 (90%), Gaps = 6/277 (2%)

Query: 18  LTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYD 77
           L +VA+P+G++V+GV YSMYDV+GGSR VIFDRLSGV+  VVGEGTHFLVPWLQKA++YD
Sbjct: 8   LARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYD 67

Query: 78  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLK 137
           +RTKPK IATNTGTKD+QMVSLTLRVLHRP+V +LP+IYQNLGLDYDE+VLPSIGNEVLK
Sbjct: 68  IRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLK 127

Query: 138 SIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQI 197
           +IVAQFDAAELITQRE+VSQRI+ ELS RA+EFG+RLEDVSITHMTFGPEFTKAVEQKQI
Sbjct: 128 AIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQI 187

Query: 198 AQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIA 257
           AQQDAERAKFLVEKAEQ R+ASVIRAEGEAESAE+ISKALA+ GDGLLLIRRLEASK+IA
Sbjct: 188 AQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIA 247

Query: 258 QTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNI 294
           QTLA S N+TYLPG+   +  G      S NSLLLNI
Sbjct: 248 QTLAASSNITYLPGKAHGNTEG------SQNSLLLNI 278

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  462 bits (1190), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/284 (78%), Positives = 255/284 (89%), Gaps = 3/284 (1%)

Query: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72
           K  + + KVALPIG++V+G+ +SMYDVKGGSR VIFDR+SGVK  ++GEGTHFL+PWLQK
Sbjct: 3   KIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQK 62

Query: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132
           A+IYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRP+V +LP IYQNLGLDYDE+VLPSI 
Sbjct: 63  AIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSIS 122

Query: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192
           NEVLK+IVAQFDAAELITQRE+VS RI++EL  R+NEFG+RLEDVSITHMTFG EFTKAV
Sbjct: 123 NEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAV 182

Query: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252
           E KQIAQQDAERAKFLVEKAEQERQA+VIRAEGEAESAE+ISKAL K GDGLLLIRRLEA
Sbjct: 183 ELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEA 242

Query: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           SK+IA TL+ S NVTYLP  + ++  G+DG   +PN+LLLN+GR
Sbjct: 243 SKEIAATLSQSSNVTYLPNGHGNARGGSDG---TPNTLLLNLGR 283

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  461 bits (1185), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/279 (79%), Positives = 250/279 (89%), Gaps = 6/279 (2%)

Query: 18  LTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYD 77
           L K+A+P+G+ V+ +DYSMYDVKGGSR VIFDR+ GVK  VVGEGTHFLVPWLQK+VI+D
Sbjct: 10  LAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFD 69

Query: 78  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLK 137
           +RTKPK+I TNTGT+DLQMVSLTLR+LHRP++ +LP IYQNLGLDYDE+VLPSIGNEVLK
Sbjct: 70  IRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLK 129

Query: 138 SIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQI 197
           SIVAQFDAAELITQREIVSQRI+ EL+ RANEFG+RLEDVSITHMTFGPEFTKAVEQKQI
Sbjct: 130 SIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 189

Query: 198 AQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIA 257
           AQQDAERAKFLVEKAEQERQASVIRAEGEAESAE IS+AL K GDGLLLIRRLE SK+IA
Sbjct: 190 AQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIA 249

Query: 258 QTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           +TLA SP+VTYLP      G G    ++S NSLLLN+GR
Sbjct: 250 ETLAGSPHVTYLP------GGGNQAEDASKNSLLLNLGR 282

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  449 bits (1155), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 232/284 (81%), Positives = 253/284 (89%), Gaps = 2/284 (0%)

Query: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72
           K  N+L+K+A+P GLL+   DY+MYDVKGGSRGVIFDR+SGV+  VVGEGTHFLVPWLQK
Sbjct: 3   KAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQK 62

Query: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132
           A+IYDVR+KPKSIATNTGTKDLQMVSLTLRVLHRP V ELP+IYQ+LGLDYDE+VLPSIG
Sbjct: 63  AIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIG 122

Query: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192
           NEVLKSIVAQFDAAELITQRE+VSQRI+ ELS RA EFG+RLEDVSITHMTFG EFTKAV
Sbjct: 123 NEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAV 182

Query: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252
           EQKQIAQQDAERAKFLVEKAEQ RQASVIRAEGEAESAE ISKALAKVGDGLLLIRRLEA
Sbjct: 183 EQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRLEA 242

Query: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           SK+IA+TL+ S NVTYLP        G + G  S N+LLLNIGR
Sbjct: 243 SKEIARTLSRSSNVTYLPSAGAGGKHGREDG--SGNTLLLNIGR 284

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  447 bits (1149), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 214/258 (82%), Positives = 239/258 (92%)

Query: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72
           +F + L K+ALP+GL  + + YSMYDVKGGSR VIFDRLSGV+  VVGEGTHFL+PWLQK
Sbjct: 3   RFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQK 62

Query: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132
           AV++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 63  AVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIG 122

Query: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192
           NEVLKSIVAQFDAAELITQRE VSQRI+ ELS+RA+EF +RLEDVSITHMTFG +FTKAV
Sbjct: 123 NEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAV 182

Query: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252
           EQKQIAQQDAERA+F+VE AEQERQASVIRAEGEAESAE+ISKALAK GDGLLLIRR+EA
Sbjct: 183 EQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIEA 242

Query: 253 SKDIAQTLANSPNVTYLP 270
           SK+IA+TLANS NVTYLP
Sbjct: 243 SKEIAKTLANSSNVTYLP 260

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  434 bits (1117), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 224/286 (78%), Positives = 250/286 (87%), Gaps = 5/286 (1%)

Query: 11  TQKFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWL 70
           + +    + KVA+P+G++ +G+ YSMYDV+GGSR VIFDRLSGV+  VVGEGTHFLVPWL
Sbjct: 2   SSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWL 61

Query: 71  QKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPS 130
           QKAVIYDVRTKPKSIATNTGTKD+QMVSLTLRVLHRP V +LP IYQNLGLDYDE+VLPS
Sbjct: 62  QKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPS 121

Query: 131 IGNEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTK 190
           IGNEVLK+IVA++DAAELITQRE+VS  I+ ELS RA+EF +RLEDVSITHMTFGPEFTK
Sbjct: 122 IGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTK 181

Query: 191 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 250
           AVE KQIAQQDAERAKFLVEKAEQ R+ SVIRAEGEAE+AE ISKALAK GDGLLLIRRL
Sbjct: 182 AVELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRL 241

Query: 251 EASKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           EASKDIAQTLANS NVTYLP Q   SG G +G   +  SLLLN+GR
Sbjct: 242 EASKDIAQTLANSSNVTYLPSQ--QSGGGQEG---TSQSLLLNLGR 282

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  419 bits (1077), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 199/284 (70%), Positives = 242/284 (85%), Gaps = 3/284 (1%)

Query: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72
           +F   +  +A+PIG+ +      +YDV+GG+R VIFDRLSGV+  VVGEGTHFL+PWLQK
Sbjct: 3   RFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQK 62

Query: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132
           AVIYDVRTKPK+IATNTGTKDLQ+V+LTLRVLHRP+V  LPKIYQ LGLDYDE+VLPSIG
Sbjct: 63  AVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIG 122

Query: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192
           NEVLK+IVAQFDAAELITQRE+VSQ+I+ EL+ RA+ F ++LEDV+ITHM FG EFTK+V
Sbjct: 123 NEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSV 182

Query: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252
           E+KQIAQQ++ERAK+LV+ AEQER A+VIRAEG+AE+AE+ISKAL K GDGLL+IRRLEA
Sbjct: 183 EKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEA 242

Query: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           SK IAQTLA S N+TYLP  ++    G+     +P+SLLLN+GR
Sbjct: 243 SKKIAQTLAGSSNITYLPSSSK---GGSHDACGTPSSLLLNLGR 283

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  405 bits (1042), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 205/279 (73%), Positives = 245/279 (87%), Gaps = 6/279 (2%)

Query: 18  LTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYD 77
           LT    PI L  + V +SMYDV+GG+R +IFDR+SGVK  VVGEGTHFL+PWLQKA+I+D
Sbjct: 11  LTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFD 70

Query: 78  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLK 137
           VRTKP++IATNTGTKDLQMVSLTLRVLHRP+V  L +IY+ LG DYDE+VLPSIGNEVLK
Sbjct: 71  VRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLK 130

Query: 138 SIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQI 197
           +IVAQF+A+ELITQRE+VSQ+I++EL+ RA+EF +RLEDVSITHMTFG EFTKAVEQKQI
Sbjct: 131 AIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQI 190

Query: 198 AQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIA 257
           AQQ+++RAKF+VE+AEQER+A+VIRAEGEAE+AE ISKAL K GDGLL+IRRLEASK IA
Sbjct: 191 AQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIA 250

Query: 258 QTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296
           +TLANSPNVTYLP + + + SG      +PNSLLLN+GR
Sbjct: 251 ETLANSPNVTYLPSKGQAADSG------APNSLLLNLGR 283

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  363 bits (932), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 196/209 (93%)

Query: 16  NLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVI 75
           +++ ++A+P+GL V+ + YSMYDV+GG R VIFDRL GV+  V+GEGTHFLVPWLQK+++
Sbjct: 6   DVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSIL 65

Query: 76  YDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEV 135
           +DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V +LPKIYQNLG+DYDE+VLPSIGNEV
Sbjct: 66  FDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEV 125

Query: 136 LKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQK 195
           LK+IVAQFDAAELITQREIVSQRI++ELS RA+EF ++LEDVSITHMTFG EFTKAVEQK
Sbjct: 126 LKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQK 185

Query: 196 QIAQQDAERAKFLVEKAEQERQASVIRAE 224
           QIAQQDAERA+FLVEKAEQER+A+VIRAE
Sbjct: 186 QIAQQDAERARFLVEKAEQERKAAVIRAE 214

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  289 bits (739), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 187/238 (78%), Gaps = 1/238 (0%)

Query: 32  VDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 91
           V+ ++++V GG R +++ RL+GV + +  EGTHF+ PW+   +IYDVR KP+++A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGT 113

Query: 92  KDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQ 151
           KDLQMV++T RVL RP+V +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 152 REIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 211
           RE VS+ I+  L  RA+ F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 212 AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYL 269
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LANSPN   L
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTARDIAKILANSPNRVVL 290

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  289 bits (739), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 138/238 (57%), Positives = 185/238 (77%), Gaps = 1/238 (0%)

Query: 32  VDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 91
           V+ ++++V GG R +++ R+ GV S +  EGTHF+ PWL   +IYDVR KP+++A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 92  KDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQ 151
           KDLQMV++T RVL RP+V +LP IY+ LG DYDE+VLPSI NEVLKS+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQ 173

Query: 152 REIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 211
           RE VS+ I+  L  RA  F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 212 AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYL 269
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LANSPN   L
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILANSPNRVIL 290

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  289 bits (739), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 185/235 (78%), Gaps = 1/235 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           ++++V GG R +++ R+ GV + +  EGTHF++PW++  VIYDVR KP+++A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RPNV +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L +RA +F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYL 269
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +KDIA  LA SPN   L
Sbjct: 238 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAKDIADILAKSPNRVVL 291

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  288 bits (737), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 186/231 (80%), Gaps = 1/231 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           S+++V GG R +++ RLSGV+ +V GEGTHF++PWL+  V+YDVR+KP+++++ TGT DL
Sbjct: 57  SLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGTNDL 116

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RP+V  LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQRES 176

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L  RA+ F + L+DVSIT+MTF PEFT AVE KQ+AQQDA+RA F VEKA+Q
Sbjct: 177 VSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEKAKQ 236

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 265
           E+Q+ +++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  LA SPN
Sbjct: 237 EKQSMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAGILAASPN 286

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  288 bits (736), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 189/239 (79%), Gaps = 1/239 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           S+++V GG R +++ R++GV S +  EGTHF++PWL+  ++YDVR KP+++A+ TGTKDL
Sbjct: 56  SLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGTKDL 115

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RP+V  LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 116 QMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 175

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L  RA++F + L+DVSIT MTF PEFT+AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 176 VSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDKARQ 235

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYLPGQN 273
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA+ LANSPN   L  ++
Sbjct: 236 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTAREIARILANSPNRVVLDNES 293

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  287 bits (735), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 187/238 (78%), Gaps = 1/238 (0%)

Query: 32  VDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 91
           ++ ++++V GG R +++ R+ GV S +  EGTHF+ PWL   +IYDVR KP+++A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 92  KDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQ 151
           KDLQMV++T RVL RP+V +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 152 REIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 211
           RE VS+ I+  L  RA++F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 212 AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYL 269
           A QE+Q  V+RA+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LA+SPN   L
Sbjct: 234 ARQEKQGMVVRAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPNRVIL 290

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  287 bits (734), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 182/231 (78%), Gaps = 1/231 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           S+++V GG R +++ RLSGV S +  EGTHF++PWLQ  +IYDVR KP+++A+ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RP++  LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L  RA +F + L+DVSIT MTF PEFT AVE KQIAQQDA+RA FLV++A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 265
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ SKDIA+ LA S N
Sbjct: 235 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDISKDIAKILATSSN 284

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  286 bits (733), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 185/238 (77%), Gaps = 1/238 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           ++++V GG R +++ R+ GV   +  EGTH ++PW++  ++YDVR KP+++A+ TGTKDL
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKPRNVASLTGTKDL 118

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RPNV +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L  RA+ F + L+DVSIT+MTF PEFT+AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDAQRAAFIVDKARQ 238

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYLPGQ 272
           E+Q  V++A+GEA+SAE I  A+ K  D + L +RL+ +KDIA+ LANSPN   L  +
Sbjct: 239 EKQGMVVKAQGEAKSAELIGDAIKKSRDYVEL-KRLDTAKDIAKILANSPNRVVLDNE 295

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  286 bits (732), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 190/250 (76%), Gaps = 1/250 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           S+++V GG R +I+ RL+GV+S +  EGTHF +PW +  ++YDVR KP+++A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RPNV++LP +++ LG DYDE+VLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L  RA++F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYLPGQNR 274
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  L+ SPN   L  +  
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSQSPNRVILDNEAL 295

Query: 275 HSGSGTDGGN 284
              +  D  N
Sbjct: 296 LLNTAADTRN 305

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  286 bits (732), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 136/239 (56%), Positives = 184/239 (76%), Gaps = 1/239 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           ++++V GG R +++ R+SGV   +  EGTHF +PW++  +IYDVR KP+++A+ TGTKDL
Sbjct: 62  ALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTGTKDL 121

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RPNV +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 122 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 181

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L  RAN F + L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 182 VSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 241

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYLPGQN 273
           E+Q  V+RA+GEA+SAE I  A+ K  D + L +RL+ +++IA+ LA SPN   L  ++
Sbjct: 242 EKQGMVVRAQGEAKSAELIGDAIKKSKDYVEL-KRLDTAREIARILAKSPNRVVLDNES 299

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  286 bits (731), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 133/235 (56%), Positives = 187/235 (79%), Gaps = 1/235 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           S+++V GG R +++ RL+GV+S +  EGTHF +PWL+  ++YDVR KP+++A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RP+V +LP +++ LG DYDE+VLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L  RA++F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYL 269
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  L++SPN   L
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSSSPNKVIL 290

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  286 bits (731), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 136/239 (56%), Positives = 184/239 (76%), Gaps = 1/239 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           S+++V GG R +++ R+SGV   +  EGTHF++PW++  +IYDVR KP+++A+ TGTKDL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RPNV  LP IY+ LG DYDE+VLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L  R++ F + L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYLPGQN 273
           E+Q  V+RA+GEA+SAE I +A+ K  D + L +RL+ +++IA  LA SPN   L  ++
Sbjct: 239 EKQGMVVRAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILAKSPNRVVLDNES 296

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  285 bits (730), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 137/250 (54%), Positives = 191/250 (76%), Gaps = 1/250 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           ++++V GG R +++ R+ GV S +  EGTHF++PWL+  V+YDVR KP+++A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RP+V++LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L  RA  F L L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYLPGQNR 274
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  LA SPN   L  ++ 
Sbjct: 240 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIADILAKSPNRVVLDNESL 298

Query: 275 HSGSGTDGGN 284
              + +D  N
Sbjct: 299 LLNTLSDTRN 308

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  284 bits (727), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 192/253 (75%), Gaps = 1/253 (0%)

Query: 32  VDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 91
           V+ ++++V GG R +++ R+ G++  +  EGTHF VPWL+  ++YDVR KP+++A+ TGT
Sbjct: 55  VNSALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGT 114

Query: 92  KDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQ 151
           KDLQMV++T RVL RP V++LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQ
Sbjct: 115 KDLQMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 174

Query: 152 REIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 211
           RE VS+ I+  L  RA++F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 175 RERVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 234

Query: 212 AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYLPG 271
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA+ L+ SPN   L  
Sbjct: 235 ARQEKQGMVVKAQGEAQSAELIGEAIKKSKDYVEL-KRLDTAREIAEILSKSPNRVILDN 293

Query: 272 QNRHSGSGTDGGN 284
           +     + TD  N
Sbjct: 294 EALLLNTVTDNRN 306

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  284 bits (727), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 133/238 (55%), Positives = 187/238 (78%), Gaps = 1/238 (0%)

Query: 32  VDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 91
           ++ ++++V GG R +++ R+ GV + +  EGTHF+ PWL   ++YDVR KP+++A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGT 113

Query: 92  KDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQ 151
           KDLQMV++T RVL RP+V +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 152 REIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 211
           RE VS+ I+  L  RA++F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 212 AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYL 269
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LA+SPN   L
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPNRVIL 290

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  283 bits (725), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 134/241 (55%), Positives = 186/241 (77%), Gaps = 1/241 (0%)

Query: 32  VDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 91
           ++ ++++V GG R +++ R+ GV S +  EGTH ++PWL+  V+YDVR KP+++A+ TGT
Sbjct: 56  LNSALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGT 115

Query: 92  KDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQ 151
           KDLQMV++T RVL RPNV +LP IY+ LG DY E+VLPSI NEVLK++VAQF+A++LITQ
Sbjct: 116 KDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQ 175

Query: 152 REIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 211
           RE VS+ I+  L  RA+ F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 176 REKVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 235

Query: 212 AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYLPG 271
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IAQ LA SPN   L  
Sbjct: 236 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAQILARSPNRVILDN 294

Query: 272 Q 272
           +
Sbjct: 295 E 295

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  279 bits (713), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 184/239 (76%), Gaps = 1/239 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           ++++V GG R +++ R+ GV   +  EGTHF++PWL+  ++YDVR KP+++A+ TGTKDL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RP+V +LP +Y+ LG DYD++VLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L  RA+ F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYLPGQN 273
           E+Q  V++A GEA+SAE I +A+ K  D + L +RL+ +K+IA  LA SPN   L  ++
Sbjct: 215 EKQGMVVKAVGEAKSAELIGEAIKKSKDYVEL-KRLDTAKEIATILAASPNRVVLDNES 272

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  280 bits (715), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 185/238 (77%), Gaps = 1/238 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           ++++V GG R +++ R+ GV S +  EGTH L+PW +  V+YDVR KP+++A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RP+V +LP IY+ LGLDYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L  RA+ F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYLPGQ 272
           E+Q  V++A+G+A+SAE I +A+ K  D + L +RL+ +++IAQ L+ SPN   L  +
Sbjct: 240 EKQGLVVKAQGDAKSAELIGEAIRKSKDYVEL-KRLDTAREIAQILSRSPNRVVLDNE 296

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  279 bits (713), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 184/235 (78%), Gaps = 1/235 (0%)

Query: 35  SMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 94
           ++++V GG R +++ R++GV+  +  EGTHF++PW++  V+YDVR KP+++++ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 95  QMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 154
           QMV++T RVL RPNV  LP IY+ LG+DYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 155 VSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 214
           VS+ I+  L  RA  F + L+DVSIT+MTF PEFT +VE KQIAQQDA++A F+V+KA Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 215 ERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANSPNVTYL 269
           E+Q  +++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  L+ SPN   L
Sbjct: 238 EKQGMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIASILSRSPNKVIL 291

>ZYRO0B06666g Chr2 complement(533122..535101) [1980 bp, 659 aa] {ON}
           similar to Q04373 YDR496C uniprot|Q04373 Saccharomyces
           cerevisiae PUF6 Pumilio-homology domain protein that
           binds ASH1 mRNA at PUF consensus sequences
          Length = 659

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 53/112 (47%), Gaps = 12/112 (10%)

Query: 84  SIATNTGTKDLQMVSLTLR-VLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQ 142
           S +   G+   Q++   +R  +H  N  E+ ++ + L   + E V    G+EV  +++A+
Sbjct: 305 SASVEKGSTGFQILHAAMRQFVHIANDKEIEELIEILHESFAELVHTPEGSEVACTLIAR 364

Query: 143 FDAAELITQREIVSQRIKSELSMRANEFG--------LRLEDVSITHMTFGP 186
            +A E   +++I+        ++  NE+G          ++D  + H TFGP
Sbjct: 365 TNAKE---RKQIIRSLRDHTEALIKNEYGTAAFITLLFCVDDTVLVHKTFGP 413

>CAGL0C05093g Chr3 complement(482106..484220) [2115 bp, 704 aa] {ON}
           highly similar to uniprot|Q08225 Saccharomyces
           cerevisiae YOL057w
          Length = 704

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 63/159 (39%), Gaps = 7/159 (4%)

Query: 143 FDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDA 202
           F   +   + +++S+ +       ANE+ +++ D  I H   G        QK   +  +
Sbjct: 248 FKFGDHTREMQLISKYLAEAKKYAANEYQIKMLDEYIRHFETGSSHAHKEAQKYWVKDIS 307

Query: 203 ERAKFLVEKAEQERQASVIRAEGEA----ESAEFISKALAKVGDGLLLIRRLEASKDIAQ 258
              +  +   E  R+ S I  E E+    ++ E   K  A V      I  L  S D  +
Sbjct: 308 PVVETNIGFIETYREPSGIIGEYESLVAIQNKERTKKFGAMVSRAEEFISELPWSADFEK 367

Query: 259 TLANSPNVTYLPGQNRHSGSGTDGGNSSPN--SLLLNIG 295
              N P+ T L      +GSG   G + PN   + LNIG
Sbjct: 368 PKFNPPDFTSLEVLT-FTGSGIPAGINIPNYDDVRLNIG 405

>KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON}
           similar to uniprot|Q06179 Saccharomyces cerevisiae
           YLR454W FMP27 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 2777

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 46/93 (49%), Gaps = 6/93 (6%)

Query: 172 LRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAE 231
           ++L DVSI++     + TK++E     Q+ AER++    ++ ++   + ++     ES E
Sbjct: 197 IKLRDVSISY----DQLTKSIESA-YQQKAAERSEAPANESHKDHFQTNMQPVTTGESIE 251

Query: 232 FISKALAKVGDGLLLIRRLEASKDIAQTLANSP 264
           +I   L K  D + +  R   + D    LA+ P
Sbjct: 252 YIKSLLLKASDFVTMFDRFYVALDTV-CLADIP 283

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 65  FLVPWLQKAVIYDVRTKPKSIATN---TGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGL 121
           F +P  +   I +VR +   +  N    G +   +  +  + L R +++  P +Y++L L
Sbjct: 246 FKLPDGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVL 305

Query: 122 DYDEKVLPSIGNEVLKSI 139
           +    VLP  GN +LK +
Sbjct: 306 NGGTTVLPGFGNRILKEL 323

>Kpol_1045.49 s1045 (115541..117694) [2154 bp, 717 aa] {ON}
           (115543..117696) [2154 nt, 718 aa]
          Length = 717

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 69/165 (41%), Gaps = 7/165 (4%)

Query: 137 KSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQ 196
           K+   QF   +   + E +++ +K   +  ANE   ++ D  I + T G        QK 
Sbjct: 253 KTYGVQFKFGDHSREMEKIAEHLKLAKNYSANETQSKMLDQYIYYFTTGSSNAHKESQKL 312

Query: 197 IAQQDAERAKFLVEKAEQERQASVIRAEGEA----ESAEFISKALAKVGDGLLLIRRLEA 252
             +  +   +  +   E  R+ S I  E EA    ++ +  +K    V +    I+ L  
Sbjct: 313 WVKDLSPIVETNIGFIETYREPSGIIGEWEALVAVQNKDRTAKFSKMVDNAKNFIKLLPW 372

Query: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPN--SLLLNIG 295
            +D  + + N P+ T +      +GSG   G + PN   + +N+G
Sbjct: 373 GQDFEKNVFNPPDFTSIEVLT-FTGSGIPAGINIPNYDDVRINVG 416

>KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3.410
           YGR082W
          Length = 185

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 16/17 (94%)

Query: 190 KAVEQKQIAQQDAERAK 206
           KAV+QK++AQQDA RAK
Sbjct: 43  KAVKQKKLAQQDAARAK 59

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,263,698
Number of extensions: 1112261
Number of successful extensions: 3336
Number of sequences better than 10.0: 69
Number of HSP's gapped: 3408
Number of HSP's successfully gapped: 69
Length of query: 296
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 187
Effective length of database: 40,982,805
Effective search space: 7663784535
Effective search space used: 7663784535
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)