Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G009103.495ON1631497091e-96
NCAS0E007803.495ON1711534434e-56
ZYRO0D09878g3.495ON1531494103e-51
TDEL0D056303.495ON1501493894e-48
TPHA0D042603.495ON1581493756e-46
KLTH0F14894g3.495ON1661473723e-45
YGR133W (PEX4)3.495ON1831493682e-44
Suva_7.4213.495ON1651493643e-44
Skud_7.4443.495ON1621493592e-43
CAGL0I10450g3.495ON1621553583e-43
Smik_6.2293.495ON1651493557e-43
Kpol_480.133.495ON1571473548e-43
Kwal_55.212463.495ON1601473496e-42
TBLA0C045003.495ON1651513358e-40
SAKL0F02706g3.495ON1611523322e-39
AFR314W3.495ON1551423227e-38
KAFR0C019903.495ON1511513182e-37
KNAG0B007803.495ON1531183174e-37
Ecym_12343.495ON1611402941e-33
KLLA0E04027g3.495ON1581432601e-28
TDEL0G036106.109ON1691132038e-20
Smik_7.2226.109ON1711132038e-20
YGL058W (RAD6)6.109ON1721132038e-20
Suva_7.2136.109ON1731132038e-20
ZYRO0C04950g6.109ON1681132029e-20
AAR156C6.109ON1701132029e-20
Kpol_461.86.109ON1671132029e-20
SAKL0A07260g6.109ON1691132029e-20
Ecym_30776.109ON1701132021e-19
NCAS0D032206.109ON1711132021e-19
KLTH0H06732g6.109ON1601132011e-19
KLLA0C05632g6.109ON1641132002e-19
TBLA0F024406.109ON1741132002e-19
Smik_15.5177.54ON1561111992e-19
TPHA0J017506.109ON1691132002e-19
CAGL0I00352g6.109ON1671131983e-19
KNAG0F025706.109ON1511131973e-19
KAFR0A047006.109ON1531131974e-19
Kwal_14.18286.109ON1521131965e-19
Skud_7.2226.109ON1701131968e-19
NDAI0E038707.54ON1641031922e-18
YOR339C (UBC11)7.54ON1561111913e-18
NDAI0I016506.109ON1761131933e-18
ADR169C8.375ON2111101918e-18
SAKL0A00396g8.375ON2151011919e-18
Kpol_1065.127.54ON1591051881e-17
Skud_15.5047.54ON1561071871e-17
Ecym_60388.375ON2111011892e-17
KLLA0C18656g8.375ON2281011902e-17
NCAS0B031508.375ON2141021892e-17
Suva_8.3897.54ON1561111852e-17
CAGL0E00671g8.375ON2131011874e-17
Suva_4.3263.308ON1481041834e-17
Skud_4.4418.375ON2151011874e-17
ZYRO0D04466g7.54ON1591031835e-17
Suva_2.3438.375ON2151011865e-17
Smik_4.4258.375ON2151011865e-17
Skud_2.2073.308ON1481041825e-17
Smik_2.2193.308ON1481041825e-17
YBR082C (UBC4)3.308ON1481041825e-17
YDR177W (UBC1)8.375ON2151011865e-17
NDAI0A011608.375ON2161011865e-17
TDEL0H039707.54ON1561031826e-17
CAGL0E04752g3.308ON1471041809e-17
KAFR0C002703.308ON1471041809e-17
NCAS0A108003.308ON1481041801e-16
NDAI0A054903.308ON1471041801e-16
Suva_2.2183.308ON1481041801e-16
Skud_4.3143.308ON1481041801e-16
YDR059C (UBC5)3.308ON1481041801e-16
KNAG0J023403.308ON1611031801e-16
TBLA0H031308.375ON2141011831e-16
ZYRO0C03784g8.375ON2181011832e-16
TDEL0F049908.375ON2171011822e-16
SAKL0B10582g7.54ON1611031792e-16
Smik_4.2973.308ON1481041782e-16
Ecym_74313.308ON1471041782e-16
KLTH0E14300g3.308ON1471041782e-16
SAKL0B06512g3.308ON1471041782e-16
AER173C3.308ON1471041782e-16
TPHA0A038503.308ON1481041773e-16
KLLA0E12563g3.308ON1481041773e-16
Kpol_1052.23.308ON1481041773e-16
Kwal_23.64858.375ON215891813e-16
KLTH0A07546g8.375ON215891805e-16
TBLA0I021303.308ON1481041756e-16
TDEL0F021003.308ON1471041747e-16
ZYRO0G12870g3.308ON1471041748e-16
Kpol_1030.108.375ON2151011771e-15
Kwal_27.124013.308ON2361031781e-15
TPHA0L008508.375ON2161011762e-15
KAFR0B060608.375ON2131011762e-15
KLTH0D01760g7.54ON1611031713e-15
KNAG0A048108.375ON2141011743e-15
Kwal_26.70097.54ON1611051689e-15
ZYRO0E06358g2.569ON1651471636e-14
KAFR0H012303.308ON110931534e-13
Smik_4.1714.249ON157981564e-13
YDL064W (UBC9)4.249ON157981564e-13
ABR059W2.569ON1651471564e-13
Suva_4.1864.249ON157981556e-13
TDEL0B065702.569ON1651231558e-13
CAGL0M07568g2.569ON1651171541e-12
KLLA0E07745g2.569ON1651471532e-12
TBLA0H026102.569ON1651171513e-12
KNAG0M021502.569ON1701471504e-12
TPHA0I024602.569ON1671471504e-12
SAKL0H17930g8.230ON1531011485e-12
Kpol_1075.1b8.230ON1521011477e-12
Ecym_45782.569ON1651471487e-12
Skud_4.1914.249ON157981487e-12
SAKL0D13552g2.569ON1651471488e-12
KNAG0H029808.230ON1521011461e-11
AGR121C8.230ON1541021451e-11
TPHA0B034108.230ON1521011451e-11
KAFR0A021602.569ON1651471462e-11
ZYRO0B11682g8.230ON1511041452e-11
Kwal_26.82242.569ON1651471452e-11
KLTH0D07986g2.569ON1651471452e-11
Kpol_1056.52.569ON1651471452e-11
Skud_4.3528.230ON1431011433e-11
KNAG0D043904.249ON157981434e-11
Kwal_56.234828.230ON1491011417e-11
Ecym_55638.230ON1641011417e-11
KLLA0E05039g4.249ON157991417e-11
KLTH0H13816g1.436ON2331061447e-11
NCAS0A127402.569ON1651171419e-11
NDAI0B015202.569ON1651171401e-10
Suva_2.2538.230ON1431011391e-10
KLTH0G14366g8.230ON1491011391e-10
YDR092W (UBC13)8.230ON1531011391e-10
Smik_4.3358.230ON1431011391e-10
KLLA0C17622g8.230ON1591011391e-10
YMR022W (UBC7)2.569ON1651111401e-10
Smik_13.1862.569ON1651111391e-10
CAGL0D00814g4.249ON157941391e-10
Suva_13.1892.569ON1651111391e-10
Skud_13.1762.569ON1651111391e-10
TBLA0I029604.249ON157991382e-10
TDEL0A013408.230ON1571011382e-10
NCAS0B040108.230ON1531041382e-10
TPHA0B007704.249ON1571021382e-10
ZYRO0B12386g4.249ON157981382e-10
Ecym_32704.249ON157981372e-10
KAFR0G032404.249ON157981372e-10
KLTH0D14344g4.249ON157981372e-10
KAFR0A024208.230ON1471011363e-10
SAKL0H03058g4.249ON157981373e-10
Kwal_23.42274.249ON122941353e-10
CAGL0M03399g1.436ON214941393e-10
CAGL0G08063g8.230ON1491051363e-10
AER056C4.249ON157981364e-10
Kpol_483.164.249ON122941344e-10
NCAS0A024904.249ON157981354e-10
NDAI0J015408.230ON1541011354e-10
AEL045W1.436ON2111061384e-10
Kwal_34.161741.436ON2131031376e-10
AGL203C3.301ON2701161386e-10
TDEL0E012204.249ON157981347e-10
NCAS0A107703.301ON2731161371e-09
Ecym_13481.436ON2111061351e-09
TPHA0O009201.436ON226941351e-09
NDAI0A055303.301ON2731161361e-09
Ecym_26693.301ON2681161352e-09
SAKL0D02530g3.301ON2721161352e-09
TBLA0F037908.230ON1511011302e-09
NDAI0D043804.249ON157991312e-09
KNAG0H010403.301ON296941342e-09
TDEL0D032603.301ON289941333e-09
Skud_4.3063.301ON297941333e-09
KLLA0D09196g3.301ON292941334e-09
Smik_4.2903.301ON297941334e-09
Suva_2.2113.301ON297941334e-09
KAFR0H012703.301ON2871161324e-09
YDR054C (CDC34)3.301ON295941324e-09
TBLA0G032703.301ON330941325e-09
ZYRO0G12650g3.301ON285941325e-09
Skud_5.871.436ON210941305e-09
Kwal_27.104443.301ON2781161316e-09
CAGL0E04598g3.301ON295981317e-09
TDEL0B056701.436ON2031061298e-09
KLTH0C04818g3.301ON2751161308e-09
Kpol_1065.453.301ON323941309e-09
TPHA0M012803.301ON435941319e-09
Smik_5.981.436ON215941272e-08
KAFR0H029601.436ON1871061252e-08
KNAG0H018701.436ON210941262e-08
Suva_5.531.436ON215941262e-08
NCAS0I014303.301ON258941272e-08
Kpol_1030.181.436ON223941262e-08
NDAI0D011401.436ON245941263e-08
KLLA0A11198g1.436ON202941253e-08
SAKL0D10560g1.436ON2071031253e-08
YEL012W (UBC8)1.436ON218941253e-08
KAFR0F030404.49ON1691141233e-08
NCAS0G031301.436ON231941235e-08
TBLA0E015704.49ON194721225e-08
ZYRO0E03806g1.436ON2091061235e-08
KNAG0I029404.49ON1971181219e-08
TBLA0A012901.436ON219941201e-07
YLR306W (UBC12)4.49ON1881041182e-07
NDAI0A075703.301ON239981183e-07
NCAS0A059404.49ON1931111164e-07
Smik_12.3894.49ON1871001155e-07
Suva_10.4014.49ON1871001138e-07
Ecym_83714.49ON267861159e-07
KLLA0C17248g4.49ON184861121e-06
TDEL0E055604.49ON1871121121e-06
Skud_12.3894.49ON1871001051e-05
ZYRO0G19910g4.49ON179831051e-05
KNAG0J022803.301ON217941052e-05
CAGL0D06468g4.49ON1871011042e-05
TPHA0F003904.49ON1931021042e-05
NDAI0D029104.49ON1891191042e-05
ADL035C4.49ON200911033e-05
TBLA0D006007.392ON256851025e-05
Ecym_46837.392ON243851025e-05
CAGL0I05478g7.392ON246891009e-05
Smik_5.2467.392ON25087972e-04
KNAG0B023607.392ON25187972e-04
Skud_5.2257.392ON25087972e-04
YER100W (UBC6)7.392ON25091972e-04
NDAI0A016507.392ON25191962e-04
KLTH0H09504g4.49ON18486952e-04
NCAS0A143907.392ON24085954e-04
Kpol_414.2singletonOFF19293936e-04
Kpol_YGOB_414.24.49ON19393936e-04
KAFR0L017507.392ON25187937e-04
TDEL0C015507.392ON24885920.001
Kpol_1045.397.392ON25389910.001
Suva_5.2197.392ON24991910.001
KLLA0E20395g7.392ON25189900.002
SAKL0H24112g4.49ON18579890.002
Kwal_27.108377.392ON24687890.002
TPHA0K008207.392ON25789890.003
KLTH0C06688g7.392ON24687880.003
ZYRO0B03344g7.392ON25089880.004
NCAS0E026007.392ON25587870.004
NDAI0E041707.392ON25787820.017
AGR372W7.392ON24283810.024
SAKL0F12474g7.392ON25187800.039
Suva_7.1826.187ON137100770.056
KLLA0E19119g6.187ON13988740.12
Suva_3.111.412ON379124750.18
Smik_7.1966.187ON10097710.24
YGL087C (MMS2)6.187ON137100720.25
KNAG0F021306.187ON138101710.35
SAKL0A05192g6.187ON14088690.57
Ecym_22306.187ON13894690.62
KLTH0H04796g6.187ON13890680.73
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00910
         (163 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   277   1e-96
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   175   4e-56
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   162   3e-51
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   154   4e-48
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   149   6e-46
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   147   3e-45
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   146   2e-44
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   144   3e-44
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   142   2e-43
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   142   3e-43
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   141   7e-43
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   140   8e-43
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   139   6e-42
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   133   8e-40
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   132   2e-39
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   128   7e-38
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   127   2e-37
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   126   4e-37
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   117   1e-33
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   104   1e-28
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    83   8e-20
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    83   8e-20
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    83   8e-20
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    83   8e-20
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    82   9e-20
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    82   9e-20
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    82   9e-20
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    82   9e-20
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    82   1e-19
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      82   1e-19
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    82   1e-19
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    82   2e-19
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    82   2e-19
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    81   2e-19
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    82   2e-19
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    81   3e-19
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    80   3e-19
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    80   4e-19
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    80   5e-19
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    80   8e-19
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    79   2e-18
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    78   3e-18
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      79   3e-18
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    78   8e-18
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    78   9e-18
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    77   1e-17
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    77   1e-17
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    77   2e-17
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    78   2e-17
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      77   2e-17
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    76   2e-17
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    77   4e-17
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    75   4e-17
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    77   4e-17
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    75   5e-17
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    76   5e-17
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    76   5e-17
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    75   5e-17
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    75   5e-17
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    75   5e-17
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    76   5e-17
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      76   5e-17
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    75   6e-17
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    74   9e-17
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    74   9e-17
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    74   1e-16
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    74   1e-16
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    74   1e-16
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    74   1e-16
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    74   1e-16
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    74   1e-16
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    75   1e-16
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    75   2e-16
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    75   2e-16
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    74   2e-16
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    73   2e-16
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    73   2e-16
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    73   2e-16
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    73   2e-16
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    73   2e-16
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    73   3e-16
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    73   3e-16
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    73   3e-16
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    74   3e-16
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    74   5e-16
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    72   6e-16
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    72   7e-16
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    72   8e-16
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    73   1e-15
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    73   1e-15
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    72   2e-15
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    72   2e-15
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    70   3e-15
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    72   3e-15
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    69   9e-15
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    67   6e-14
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    64   4e-13
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    65   4e-13
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    65   4e-13
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    65   4e-13
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    64   6e-13
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    64   8e-13
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    64   1e-12
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    64   2e-12
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    63   3e-12
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    62   4e-12
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    62   4e-12
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    62   5e-12
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    61   7e-12
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    62   7e-12
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    62   7e-12
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    62   8e-12
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    61   1e-11
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    60   1e-11
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    60   1e-11
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    61   2e-11
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    60   2e-11
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    60   2e-11
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    60   2e-11
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    60   2e-11
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    60   3e-11
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    60   4e-11
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    59   7e-11
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    59   7e-11
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    59   7e-11
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    60   7e-11
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    59   9e-11
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    59   1e-10
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    58   1e-10
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    58   1e-10
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    58   1e-10
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    58   1e-10
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    58   1e-10
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    59   1e-10
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    58   1e-10
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    58   1e-10
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    58   1e-10
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    58   1e-10
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    58   2e-10
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    58   2e-10
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    58   2e-10
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    58   2e-10
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    58   2e-10
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    57   2e-10
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    57   2e-10
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    57   2e-10
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    57   3e-10
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    57   3e-10
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    57   3e-10
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    58   3e-10
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    57   3e-10
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    57   4e-10
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    56   4e-10
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    57   4e-10
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    57   4e-10
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    58   4e-10
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    57   6e-10
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    58   6e-10
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    56   7e-10
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    57   1e-09
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    57   1e-09
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    57   1e-09
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    57   1e-09
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    57   2e-09
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    57   2e-09
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    55   2e-09
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    55   2e-09
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                56   2e-09
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    56   3e-09
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    56   3e-09
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    56   4e-09
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    56   4e-09
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    56   4e-09
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                55   4e-09
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    55   4e-09
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    55   5e-09
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    55   5e-09
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    55   5e-09
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    55   6e-09
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    55   7e-09
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    54   8e-09
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    55   8e-09
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    55   9e-09
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    55   9e-09
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    54   2e-08
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    53   2e-08
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    53   2e-08
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    53   2e-08
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                54   2e-08
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    53   2e-08
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    53   3e-08
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    53   3e-08
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    53   3e-08
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    53   3e-08
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    52   3e-08
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                52   5e-08
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    52   5e-08
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    52   5e-08
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    51   9e-08
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    51   1e-07
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    50   2e-07
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    50   3e-07
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     49   4e-07
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    49   5e-07
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    48   8e-07
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    49   9e-07
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    48   1e-06
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    48   1e-06
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    45   1e-05
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    45   1e-05
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    45   2e-05
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    45   2e-05
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    45   2e-05
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       45   2e-05
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    44   3e-05
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    44   5e-05
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    44   5e-05
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    43   9e-05
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    42   2e-04
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    42   2e-04
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    42   2e-04
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    42   2e-04
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    42   2e-04
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    41   2e-04
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    41   4e-04
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    40   6e-04
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    40   6e-04
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    40   7e-04
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    40   0.001
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    40   0.001
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    40   0.001
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    39   0.002
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    39   0.002
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    39   0.002
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    39   0.003
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    39   0.003
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    39   0.004
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    38   0.004
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    36   0.017
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    36   0.024
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    35   0.039
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    34   0.056
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    33   0.12 
Suva_3.11 Chr3 complement(15902..17041) [1140 bp, 379 aa] {ON} Y...    33   0.18 
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    32   0.24 
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    32   0.25 
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    32   0.35 
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    31   0.57 
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    31   0.62 
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    31   0.73 
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    30   1.1  
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    30   1.1  
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    30   1.2  
TPHA0P00990 Chr16 (201279..202499) [1221 bp, 406 aa] {ON} Anc_2....    31   1.3  
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    30   1.5  
Ecym_5011 Chr5 (20656..21087) [432 bp, 143 aa] {ON} similar to A...    30   1.8  
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    30   2.0  
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    30   2.4  
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    29   2.5  
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    29   2.5  
TDEL0B01320 Chr2 complement(235606..237090) [1485 bp, 494 aa] {O...    30   2.8  
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    29   3.4  
Suva_2.657 Chr2 (1173079..1174413) [1335 bp, 444 aa] {ON} YDR483...    30   3.6  
KLTH0E11726g Chr5 (1041704..1043077) [1374 bp, 457 aa] {ON} simi...    29   5.1  
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    28   5.3  
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    28   5.7  
TBLA0A00480 Chr1 complement(89887..91359) [1473 bp, 490 aa] {ON}       29   5.9  

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  277 bits (709), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 136/149 (91%), Positives = 136/149 (91%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60
           MSRIIKEYKTIQKQL             IIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60

Query: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120
           NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA
Sbjct: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120

Query: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           IWLLLKDPVPESPLNVDLANLLRFGDLSA
Sbjct: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSA 149

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  175 bits (443), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 101/153 (66%), Gaps = 5/153 (3%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXX----XXIIVSLAPIDPDQDLTKWEAVIKGPQGTP 56
           MSR++KEYK IQ  L                 II  L PI    DLT W+A IKGPQGTP
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPIS-TSDLTHWQAQIKGPQGTP 59

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMS 116
           Y    F L I  P  YP  PP   FQP SMPHCNVN+ TG ICLDIL++ HWTP WNLM+
Sbjct: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMT 119

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           T+KAIW+LLKDPVP+SPLNVD+AN+LR  D SA
Sbjct: 120 TMKAIWILLKDPVPDSPLNVDIANILRVNDQSA 152

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  162 bits (410), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 105/149 (70%), Gaps = 7/149 (4%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60
           MSR  KEYKTI K L             +IV +   +P +DLT+WEA+I+GP GTPY G 
Sbjct: 1   MSRAAKEYKTITKVLKEGDEVYSQ----LIVGM---EPKEDLTRWEALIRGPSGTPYEGC 53

Query: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120
           NF L++++PQEYP  PP+ +F+P +MPH NV++ TGEICLDIL + HW+P W+L+  ++A
Sbjct: 54  NFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQA 113

Query: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           I  LL +PV  SPLNVD+AN+L+  D++A
Sbjct: 114 IGQLLDEPVSSSPLNVDIANILKANDMNA 142

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  154 bits (389), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 95/149 (63%), Gaps = 10/149 (6%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60
           M+RI +EYK IQ  L             ++VSL PID   DL++W   I+GP GTPY G 
Sbjct: 1   MARIAREYKHIQATLGSESS--------LVVSLEPID--GDLSRWAGEIRGPTGTPYEGH 50

Query: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120
            F L + +   YPT PP   F  RSMPHCNVNY TG ICL+IL  +HW+P W+L+  L+A
Sbjct: 51  TFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEA 110

Query: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           I  LL DP P+SPL++DLAN+LR  D SA
Sbjct: 111 IIQLLSDPEPDSPLDIDLANILRAQDRSA 139

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  149 bits (375), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 101/149 (67%), Gaps = 9/149 (6%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60
           + R++KE + I+K+L              I  L P+   ++  KW AV+KGP  TPY+  
Sbjct: 3   LKRLLKEKRLIEKELSGYSES--------IELLEPV-AFENFLKWRAVLKGPVNTPYHKH 53

Query: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120
           +F L I +P EYP VPP   F+P SMPHCNV ++TG+ICL+IL+ +HW+PVWNLM  + A
Sbjct: 54  SFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVA 113

Query: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           ++ LL++PV +SPLN+DLAN+LR GD SA
Sbjct: 114 LYQLLQEPVVDSPLNIDLANILRAGDTSA 142

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  147 bits (372), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 70/147 (47%), Positives = 94/147 (63%), Gaps = 7/147 (4%)

Query: 3   RIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNF 62
           R+ KEY+ + K L              I+SLAP+  +++L KWE++I GP  TPY+G  F
Sbjct: 4   RLAKEYRALSKTLGRDPEYA------YIISLAPVS-EENLRKWESLITGPPDTPYFGHEF 56

Query: 63  ILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKAIW 122
            L I   + YP  PP  +FQ R MPHCNV++++G ICL +L   HWTP W+L+  + AIW
Sbjct: 57  TLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIW 116

Query: 123 LLLKDPVPESPLNVDLANLLRFGDLSA 149
           LLL  P P+SPL+VDLA L+R GD SA
Sbjct: 117 LLLASPEPDSPLDVDLACLVRAGDRSA 143

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  146 bits (368), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 74/149 (49%), Positives = 96/149 (64%), Gaps = 2/149 (1%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60
           MSRI+KEYK I K L             II SL PID + DL+KWEA+I GP  TPY   
Sbjct: 19  MSRIVKEYKVILKTLASDDPIANPYRG-IIESLNPID-ETDLSKWEAIISGPSDTPYENH 76

Query: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120
            F + I +P  YP  PP   F   ++ HCNV   TGEICL+ILK + WTPVW+L+  + A
Sbjct: 77  QFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHA 136

Query: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           +W LL++PV +SPL+VD+ N++R GD+SA
Sbjct: 137 VWRLLREPVCDSPLDVDIGNIIRCGDMSA 165

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  144 bits (364), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 96/149 (64%), Gaps = 2/149 (1%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60
           MSRI KEY+ I+K L             II SL P D + DL+KWEA I GP+ TPY  +
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRG-IIESLNPTD-ETDLSKWEATICGPEHTPYERY 58

Query: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120
            F + I +P  YP  PP   F+  ++ HCN+N +TGEICLDILK   WTPVW+L+  + A
Sbjct: 59  QFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHA 118

Query: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           +W LL++PV +SPL+VD+ N++R GD  A
Sbjct: 119 VWRLLREPVCDSPLDVDMGNIIRCGDKRA 147

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  142 bits (359), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 74/149 (49%), Positives = 94/149 (63%), Gaps = 2/149 (1%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60
           MSRI KEY  IQK L             +I SL PID + DL+KWEA+I GP  TPY  +
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQG-LIESLNPID-ETDLSKWEAIIIGPTHTPYEHY 58

Query: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120
            F + I +P  YP  PP   F   ++ HCN+   TGEICLDILK + WTPVW+L+  + A
Sbjct: 59  RFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHA 118

Query: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           IW LLK+PV +SPL+VD+ N++R GD  A
Sbjct: 119 IWRLLKEPVYDSPLDVDMGNIIRCGDTGA 147

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  142 bits (358), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 74/155 (47%), Positives = 101/155 (65%), Gaps = 14/155 (9%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60
           M+RI KE   I+K L              +V LAP+D D DL++W AVIKGP  TPYY +
Sbjct: 1   MARISKELLKIRKALEHGDSE-------FLVDLAPVD-DSDLSRWFAVIKGPAETPYYPY 52

Query: 61  NFILYITIPQEYPTVPPFFEFQP------RSMPHCNVNYNTGEICLDILKQDHWTPVWNL 114
            F L I +P  YP VPP  +F        R  PHCNV+  TGEICLDILK + W+P+W++
Sbjct: 53  EFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDI 112

Query: 115 MSTLKAIWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           +  ++AI +LL++PVP+SPL+VD+AN+L+  D+SA
Sbjct: 113 LHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  141 bits (355), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 93/149 (62%), Gaps = 2/149 (1%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60
           MSRI KEY+ I K L             II SL PID + DL++WEA I GP  TPY  +
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRG-IIRSLNPID-ETDLSRWEAKIYGPSHTPYENY 58

Query: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120
            F + I +P  YP  PP   F+   + HCNV   TGEICLDILK + WTPVW+L+  + A
Sbjct: 59  QFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHA 118

Query: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           +W LL++PV +SPL+VD+ N++R  D SA
Sbjct: 119 VWRLLREPVCDSPLDVDMGNIIRCADESA 147

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  140 bits (354), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 95/147 (64%), Gaps = 9/147 (6%)

Query: 3   RIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNF 62
           R++KEY+ ++K+L             II SL PID D DLT W A I GP  TPY+G +F
Sbjct: 5   RLLKEYQVVKKELGNHKN--------IISSLEPIDSD-DLTNWTATILGPPNTPYHGHSF 55

Query: 63  ILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKAIW 122
            L I +  EYP  PP   F    MPHCN+ + TG+ICL+IL   +W+PVWNL++ + AI+
Sbjct: 56  DLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIY 115

Query: 123 LLLKDPVPESPLNVDLANLLRFGDLSA 149
            LL DPV +SPLN+DL+N+L+  D SA
Sbjct: 116 QLLSDPVTDSPLNIDLSNILKIKDTSA 142

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  139 bits (349), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 70/147 (47%), Positives = 91/147 (61%), Gaps = 7/147 (4%)

Query: 3   RIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNF 62
           R+ KEYKT+ K L              I  L P+  D +L  WEA I GP  TPY G  F
Sbjct: 4   RLAKEYKTLLKTLKEDPAYSH------IRKLRPVS-DDNLYVWEADITGPSDTPYQGHEF 56

Query: 63  ILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKAIW 122
            L ITIP  YP  PP  +F  R +PHCNV++ +G IC+++L++ HW+P W+L+  + AIW
Sbjct: 57  SLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIW 116

Query: 123 LLLKDPVPESPLNVDLANLLRFGDLSA 149
           LLL +P P+SPL+VDLA L R GD SA
Sbjct: 117 LLLANPEPDSPLDVDLACLRRAGDYSA 143

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  133 bits (335), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 69/151 (45%), Positives = 97/151 (64%), Gaps = 11/151 (7%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPI-DPDQDLTKWEAVIKGPQGTPYYG 59
           MSRIIKEY  I+K                + +L P+ +   DL+ W ++I GP+ +PY+ 
Sbjct: 1   MSRIIKEYNHIRK---------LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHN 51

Query: 60  FNFILYITIPQEYPTVPPFFEFQPRSMP-HCNVNYNTGEICLDILKQDHWTPVWNLMSTL 118
            +F+L I IP EYP++PP  +F   S+P HCNVN+ TGEICL+ILK ++W+PVWNL+ ++
Sbjct: 52  KSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSV 111

Query: 119 KAIWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           +AI  LL  P P SPLN+DL+ LL   D  A
Sbjct: 112 QAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  132 bits (332), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 96/152 (63%), Gaps = 10/152 (6%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60
           + RI KE+K+++K L              I+ L P D   ++  W A I GP  TPY   
Sbjct: 3   LQRITKEFKSVRKTLAEDPSYNH------ILKLEPKD-TGNMYHWIADISGPPETPYASA 55

Query: 61  NFILYITIPQEYPTVPPFFEFQPRS---MPHCNVNYNTGEICLDILKQDHWTPVWNLMST 117
            F L + +P +YP  PP  +F P S   + HCNV++ TGEICLDIL ++HW+PVW+L+  
Sbjct: 56  VFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHV 115

Query: 118 LKAIWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           + AIW+LL +PVPESPLNVD+AN+L+ GDL A
Sbjct: 116 IHAIWILLGEPVPESPLNVDIANVLKAGDLEA 147

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  128 bits (322), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 92/142 (64%), Gaps = 10/142 (7%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPI-DPDQDLTKWEAVIKGPQGTPYYG 59
           M RI++EYK +QKQL              ++SLAP+ + + DL +WEA  +GP+ TPY G
Sbjct: 1   MRRILREYKQLQKQLALHPA---------VLSLAPVGEENGDLHRWEAHFQGPENTPYAG 51

Query: 60  FNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLK 119
           F F L I +P+ YP  PP   F P  + H N+ ++TGE+CLD+LK + W+PV+NL+  ++
Sbjct: 52  FTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVE 111

Query: 120 AIWLLLKDPVPESPLNVDLANL 141
           AI  LL +P  +SPL+VDL+ L
Sbjct: 112 AISTLLAEPGVDSPLDVDLSRL 133

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  127 bits (318), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 94/151 (62%), Gaps = 19/151 (12%)

Query: 2   SRIIKEYK---TIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYY 58
           SRI+KEYK   ++Q Q               I++L PI  D DLT WE  IKGP  +P+ 
Sbjct: 3   SRILKEYKDSRSLQSQY--------------ILALDPISTD-DLTHWECTIKGPLHSPFA 47

Query: 59  GFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTL 118
              F L I IPQ YP   P  +F+P +MPH NVN+ TGEICLDIL  + W+PV+N+   +
Sbjct: 48  NHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTN-WSPVFNIQYIV 106

Query: 119 KAIWLLLKDPVPESPLNVDLANLLRFGDLSA 149
           +AI  LL +P  +SPLN+DLANLLRF DL A
Sbjct: 107 EAIVWLLNEPNFKSPLNLDLANLLRFDDLKA 137

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  126 bits (317), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 81/118 (68%), Gaps = 2/118 (1%)

Query: 32  SLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNV 91
           +L P DP  DLT WEA ++GPQGTPY G +F L +T+P +YPT+PP   F  R+MPH NV
Sbjct: 23  NLHPTDP-ADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNV 81

Query: 92  NYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLRFGDLSA 149
            ++TGE+CLD L    WTPV +L   + A+  LL +P PESPLN++LA L R GD  A
Sbjct: 82  KWDTGEVCLDTLAGG-WTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKA 138

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  117 bits (294), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 84/140 (60%), Gaps = 9/140 (6%)

Query: 2   SRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFN 61
           SR++ EYK I++QL              I+ L P      L+KWEA   GP+ TPY  F 
Sbjct: 10  SRMLAEYKQIREQLQSHES---------ILMLCPAGDGGSLSKWEAQFCGPENTPYADFT 60

Query: 62  FILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKAI 121
           F L I IP+ YP  PP   F P  + H N+ ++TGE+CLD+LK + W+P++NL+  ++AI
Sbjct: 61  FTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAI 120

Query: 122 WLLLKDPVPESPLNVDLANL 141
             LL +P  +SPL+VDLA L
Sbjct: 121 RTLLAEPGVDSPLDVDLAKL 140

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  104 bits (260), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 89/143 (62%), Gaps = 11/143 (7%)

Query: 1   MSRIIKEYKTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60
           MSRI+KEY  +QK+L              I  LAP+D D DL++W    +GP  +P+ GF
Sbjct: 1   MSRIVKEYMGLQKRLQTPEFSW-------ISFLAPVD-DDDLSEWVCRFQGPSESPFEGF 52

Query: 61  NFILYITIP-QEYP-TVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTL 118
              L ITI  ++YP +  P   F+PR++ H NV ++TGEICLD+LK D WTP++ L+  +
Sbjct: 53  ELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVV 111

Query: 119 KAIWLLLKDPVPESPLNVDLANL 141
            AI  LL DP  +SPL++D+A +
Sbjct: 112 GAIRDLLADPGLDSPLDLDIAQI 134

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 82.8 bits (203), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 82.8 bits (203), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 82.8 bits (203), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 82.8 bits (203), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 82.4 bits (202), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 82.4 bits (202), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 82.4 bits (202), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFV-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 82.4 bits (202), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 82.4 bits (202), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 82.4 bits (202), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 82.0 bits (201), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 20  VSASPL-PD-NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPN 76

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 77  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 81.6 bits (200), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQ 131

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 81.6 bits (200), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           +S +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  ISASPL-PD-NVMLWNAMIIGPSDTPYEDGTFRLVLEFDEEYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 81.3 bits (199), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 4/111 (3%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           +S  P+D D DLT W   I GPQGTPY G  F + +  P+ YP  PP  +F    M H N
Sbjct: 28  ISAFPVD-DNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKFV-SPMWHPN 85

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANL 141
           V+  +G ICLDILK+  W+ V+N+ + L ++  LL +P  +SPLN   A L
Sbjct: 86  VD-KSGNICLDILKE-KWSAVYNVETILLSLQSLLGEPNNKSPLNAVAAEL 134

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 81.6 bits (200), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSGSPL-PD-NVMIWNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFI-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 80.9 bits (198), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   ++YP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 80.5 bits (197), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   ++YP  PP  +F    M H N
Sbjct: 9   VSASPL-PD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPN 65

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 66  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 80.5 bits (197), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 66/113 (58%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   ++YP  PP  +F    M H N
Sbjct: 9   VSASPL-PD-NVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPN 65

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 66  V-YANGEICLDIL-QNRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 80.1 bits (196), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (57%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP  PP  +F      H N
Sbjct: 9   VSASPL-PD-NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIF-HPN 65

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 66  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 80.1 bits (196), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (57%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  T Y    F L +   +EYP  PP  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           ++DLT W A+I GP+ TPY G  F L       YP  PP  +F    M H NV+  +G I
Sbjct: 43  EEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKFI-SPMWHPNVDM-SGNI 100

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANL 141
           CLDILK D W+ V+N+ + L ++  LL++P   SPLN   A L
Sbjct: 101 CLDILK-DQWSAVYNVETILLSLQALLEEPNNSSPLNAVAAEL 142

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (57%), Gaps = 4/111 (3%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           +S  P+D D DLT W   I GP+ TPY G  F + +  PQ YP  PP  +F    M H N
Sbjct: 28  ISAFPVD-DNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFL-SPMWHPN 85

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANL 141
           V+  +G ICLDILK+  W+ V+N+ + L ++  LL +P   SPLN   A L
Sbjct: 86  VD-KSGNICLDILKE-KWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAEL 134

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 79.0 bits (193), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (57%), Gaps = 5/113 (4%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           VS +P+ PD ++  W A+I GP  TPY    F L +   +EYP   P  +F    M H N
Sbjct: 24  VSASPL-PD-NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFL-SEMFHPN 80

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           V Y  GEICLDIL Q+ WTP +++ S L +I  L  DP P SP NV+ A L +
Sbjct: 81  V-YANGEICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 78.2 bits (191), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 66/110 (60%), Gaps = 3/110 (2%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           +SLA +  + D+   +    GP GTPY+G  FI+ I +P EYP  PP  +F  + + H N
Sbjct: 22  ISLAFV-SESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPLEYPFKPPKMQFDTK-VYHPN 79

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLAN 140
           ++  TG ICLDILK + W+PV  L ++L ++  LL+ P P  P + ++A 
Sbjct: 80  ISSVTGAICLDILK-NSWSPVLTLKTSLISLQALLQSPEPNDPQDAEVAK 128

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 78.2 bits (191), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 60/101 (59%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY G NFI+ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHHLKGSFYGPPGTPYEGGNFIVDIQVPLEYPFKPPKMQFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 77.0 bits (188), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 61/105 (58%), Gaps = 3/105 (2%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D +++LTKW   I GP  +PY G  F + +T P  YP  PP  +F    M H NV+  +G
Sbjct: 37  DHEENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKFV-SPMWHPNVDL-SG 94

Query: 97  EICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANL 141
            ICLD+LK+  W+ V+N+ + L ++  LL +P   SPLN   A L
Sbjct: 95  NICLDVLKE-KWSAVYNVQTILLSLQALLGEPNNSSPLNAIAAEL 138

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 76.6 bits (187), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 62/107 (57%), Gaps = 4/107 (3%)

Query: 35  PIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYN 94
           P+D D DLT W   I GPQGTPY    F + +  P+ YP  PP  +F    M H NV+  
Sbjct: 32  PVD-DNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKFV-SPMWHPNVD-K 88

Query: 95  TGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANL 141
           +G ICLDILK+  W+ V+N+ + L ++  LL +P   SPLN   A L
Sbjct: 89  SGNICLDILKE-KWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAEL 134

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 61/101 (60%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY+G  F++ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHHLKGTFLGPPGTPYHGGKFVVDIQVPLEYPFKPPKMQFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L ++L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NSWSPVLTLKTSLISLQALLQSPEPNDPQDAEVA 127

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 77.8 bits (190), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY G  F++ I IP EYP  PP  +F  + + H NV+  TG I
Sbjct: 29  ESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVEYPYKPPQMKFDTK-VYHPNVSSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + WTPV  L S L ++  LL+ P P  P +  +A
Sbjct: 88  CLDILK-NAWTPVITLKSALISLQALLQSPEPNDPQDAQVA 127

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 59/102 (57%), Gaps = 2/102 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY G  FI+ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPMEYPFKPPMMKFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLAN 140
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A 
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ 128

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 63/111 (56%), Gaps = 4/111 (3%)

Query: 31  VSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCN 90
           +S  P D D DLT W   I GPQGTPY    F + +  P+ YP  PP  +F    M H N
Sbjct: 28  ISAFPED-DNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKFV-SPMWHPN 85

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANL 141
           V+  +G ICLDILK+  W+ V+N+ + L ++  LL +P   SPLN   A L
Sbjct: 86  VDM-SGNICLDILKE-KWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAEL 134

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 76.6 bits (187), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 59/101 (58%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY G  FI+ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPMEYPFKPPKMKFDSK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 75.1 bits (183), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 29  DDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   L   L +I  LL D  P+ PL  ++A++ +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 76.6 bits (187), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 59/101 (58%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY G  F++ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 75.1 bits (183), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 59/103 (57%), Gaps = 3/103 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + DL  W  +I GP+GTPY    F + +  P  YP VPP  +F    M H NV+  +G I
Sbjct: 39  EDDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKFI-SPMWHPNVDM-SGNI 96

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANL 141
           CLDILK D W+ V+N+ + L ++  L ++P   SPLN   A L
Sbjct: 97  CLDILK-DQWSAVYNVQTILLSLQSLFEEPNNSSPLNAVAAEL 138

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 76.3 bits (186), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 59/101 (58%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY G  F++ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 76.3 bits (186), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 59/101 (58%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY G  F++ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 74.7 bits (182), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 29  DDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   L   L +I  LL D  P+ PL  ++A++ +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 74.7 bits (182), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 29  DDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   L   L +I  LL D  P+ PL  ++A++ +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 74.7 bits (182), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 29  DDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   L   L +I  LL D  P+ PL  ++A++ +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 76.3 bits (186), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 59/101 (58%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY G  F++ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 76.3 bits (186), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 59/101 (58%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY G  FI+ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHHLKGSFFGPPGTPYEGGQFIIDIEVPMEYPFKPPKMKFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 74.7 bits (182), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + DLT+W  VI GP+GTPY    F L +    +YP  PP   F    M H NV+  +G I
Sbjct: 36  EDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTFV-SPMWHPNVDM-SGNI 93

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANL 141
           CLDILK D W+ V+N+ + L ++  LL++P   SPLN   A L
Sbjct: 94  CLDILK-DQWSAVYNVQTILLSLQALLEEPNNGSPLNAIAAEL 135

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 73.9 bits (180), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 85

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   L   L +I  LL D  P+ PL  ++A++ +
Sbjct: 86  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 73.9 bits (180), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 28  DDLFHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 85

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   L   L +I  LL D  P+ PL  ++A++ +
Sbjct: 86  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 29  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   L   L +I  LL D  P+ PL  ++A++ +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 85

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   L   L +I  LL D  P+ PL  ++A++ +
Sbjct: 86  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N ++G IC
Sbjct: 29  DDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNIN-SSGNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   L   L +I  LL D  P+ PL  ++A + +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYK 129

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N ++G IC
Sbjct: 29  DDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNIN-SSGNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   L   L +I  LL D  P+ PL  ++A + +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYK 129

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N ++G IC
Sbjct: 29  DDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNIN-SSGNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   L   L +I  LL D  P+ PL  ++A + +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYK 129

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 58/103 (56%), Gaps = 3/103 (2%)

Query: 41  DLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICL 100
           DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G ICL
Sbjct: 43  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNICL 100

Query: 101 DILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           DILK D W+P   L   L +I  LL D  P+ PL  ++A++ +
Sbjct: 101 DILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 142

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 59/101 (58%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY G  F++ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHHLKGSFLGPPGTPYEGGRFMIDIEVPMEYPFKPPKMKFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 75.1 bits (183), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 59/101 (58%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+ + +    GP  TPY G  FI+ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHRLKGSFLGPPETPYQGGRFIIDIEVPMEYPFKPPKMKFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 74.7 bits (182), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 59/101 (58%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY G  FI+ I +P EYP  PP  +F  + + H NV+  TG I
Sbjct: 29  ESDIHHLKGSFLGPPGTPYDGGLFIVDIEVPMEYPFKPPKMKFDTK-VYHPNVSSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + DLTKW  +I GP GTPY G  F + +  PQ YP   P   F    M H NV+  +G I
Sbjct: 41  EDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTFV-SPMWHPNVDM-SGNI 98

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANL 141
           CLDILK D W+ V+N+ + L ++  LL++P   SPLN   A L
Sbjct: 99  CLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N ++G IC
Sbjct: 29  DDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTK-IYHPNIN-SSGNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   L   L ++  LL D  P+ PL  ++A + +
Sbjct: 87  LDILK-DQWSPALTLSKVLLSVCSLLTDANPDDPLVPEIAQIYK 129

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 85

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   +   L +I  LL D  P+ PL  ++A++ +
Sbjct: 86  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 85

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   +   L +I  LL D  P+ PL  ++A++ +
Sbjct: 86  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 85

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   +   L +I  LL D  P+ PL  ++A++ +
Sbjct: 86  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 85

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   +   L +I  LL D  P+ PL  ++A++ +
Sbjct: 86  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            D+  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 29  DDIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   +   L +I  LL D  P+ PL  ++A+L +
Sbjct: 87  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYK 129

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            D+  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 29  DDVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   +   L +I  LL D  P+ PL  ++A+L +
Sbjct: 87  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYK 129

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            D+  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 29  DDVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   +   L +I  LL D  P+ PL  ++A+L +
Sbjct: 87  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYK 129

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 74.3 bits (181), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 55/89 (61%), Gaps = 2/89 (2%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP GTPY    +I+ I +P EYP  PP  +FQ + + H NV+  TG ICLDILK + W+P
Sbjct: 41  GPPGTPYENGKYIVDIEVPMEYPFKPPKMKFQTK-VYHPNVSSVTGAICLDILK-NAWSP 98

Query: 111 VWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           V  L S L ++  LL+ P P  P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 73.9 bits (180), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 54/89 (60%), Gaps = 2/89 (2%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP GTPY    FI+ I +P EYP  PP  +F  + + H NV+  TG ICLDILK + W+P
Sbjct: 41  GPPGTPYENGKFIVDIEVPMEYPFKPPKMKFDTK-VYHPNVSSVTGAICLDILK-NAWSP 98

Query: 111 VWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           V  L S L ++  LL+ P P  P + ++A
Sbjct: 99  VITLKSALISLQALLQSPEPNDPQDAEVA 127

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 72.0 bits (175), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            D+  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 29  DDIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNIC 86

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   +   L +I  LL D  P+ PL  ++A++ +
Sbjct: 87  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 71.6 bits (174), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            D+  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 28  DDIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFTTK-IYHPNINAN-GNIC 85

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   +   L +I  LL D  P+ PL  ++A++ +
Sbjct: 86  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 71.6 bits (174), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 58/104 (55%), Gaps = 3/104 (2%)

Query: 40  QDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEIC 99
            D+  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G IC
Sbjct: 28  DDVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFTTK-IYHPNINAN-GNIC 85

Query: 100 LDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           LDILK D W+P   +   L +I  LL D  P+ PL  ++A++ +
Sbjct: 86  LDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP  TPY G  FI+ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHHLKGSFLGPPETPYQGGRFIVDIEVPMEYPFKPPKMKFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 73.2 bits (178), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 58/103 (56%), Gaps = 3/103 (2%)

Query: 41  DLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICL 100
           DL  W+A I GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G ICL
Sbjct: 118 DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNICL 175

Query: 101 DILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           DILK D W+P   +   L +I  LL D  P+ PL  ++A++ +
Sbjct: 176 DILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 217

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 72.4 bits (176), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP  TPY G  FI+ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  EADIHHLKGSFLGPPETPYEGGKFIVDIEVPMEYPFKPPKMKFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 72.4 bits (176), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +    GP GTPY    F++ I +P EYP  PP  +F  + + H N++  TG I
Sbjct: 29  ESDIHHLKGSFIGPPGTPYENGAFVVDIEVPMEYPFKPPQMKFDTK-VYHPNISSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 60/103 (58%), Gaps = 3/103 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           ++DLTKW  +I GP GTPY G  F + +   Q YP   P   F    M H NV+  +G I
Sbjct: 41  EEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFV-SPMWHPNVDM-SGNI 98

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANL 141
           CLDILK D W+ V+N+ + L ++  LL++P   SPLN   A L
Sbjct: 99  CLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 71.6 bits (174), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + D+   +   +GP  TPY    F++ I +P EYP  PP  +F  + + H NV+  TG I
Sbjct: 29  ESDIHHLKGTFQGPPETPYDRGQFVVDIEVPMEYPFKPPKMKFDTK-VYHPNVSSVTGAI 87

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+PV  L S L ++  LL+ P P  P + ++A
Sbjct: 88  CLDILK-NAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 69.3 bits (168), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           + + DLTKW  +I GP GTPY G  F + +   Q YP   P   F    M H NV+  +G
Sbjct: 39  ESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRFV-SPMWHPNVDM-SG 96

Query: 97  EICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANL 141
            ICLDILK D W+ V+N+ + L ++  LL++P   SPLN   A L
Sbjct: 97  NICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 67.4 bits (163), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 70/147 (47%), Gaps = 16/147 (10%)

Query: 9   KTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITI 68
           KT QK+L              IV  A    + DL  W+ +I+GP  TPY G  F   +  
Sbjct: 3   KTAQKRLLKELQQLMKDSSTGIV--AGPRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEF 60

Query: 69  PQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILK------------QDHWTPVWNLMS 116
           P++YP  PP   F P S+ H N+ Y+ GE+C+ IL             ++ W+PV ++  
Sbjct: 61  PKDYPLSPPKLTFTP-SILHPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLLR 143
            L ++  +L +P  ES  NVD   L R
Sbjct: 119 ILLSVMSMLSEPNVESGANVDACILWR 145

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 63.5 bits (153), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 52/93 (55%), Gaps = 3/93 (3%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP  +PY G  F L I  P +YP  PP   F  + + H N+N N G ICLDILK D W+P
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK-IYHPNINAN-GNICLDILK-DQWSP 58

Query: 111 VWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
              L   L +I  LL D  P+ PL  ++A++ +
Sbjct: 59  ALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 91

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 64.7 bits (156), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   DL KWEA I G +GT + G  + + +  P EYP+ PP  +F P    H NV Y +G
Sbjct: 33  DGSMDLQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKF-PAGFYHPNV-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            ICL IL +D  W P   L   +  +  LL  P P SP
Sbjct: 91  TICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 64.7 bits (156), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   DL KWEA I G +GT + G  + + +  P EYP+ PP  +F P    H NV Y +G
Sbjct: 33  DGSMDLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYHPNV-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            ICL IL +D  W P   L   +  +  LL  P P SP
Sbjct: 91  TICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 64.7 bits (156), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 70/147 (47%), Gaps = 16/147 (10%)

Query: 9   KTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITI 68
           KT QK+L              IV+  P+  D +L  W+ +I+GP  +PY G  F   +  
Sbjct: 3   KTAQKRLMKELQQLLRDSPDGIVA-GPVSED-NLFLWDCLIEGPADSPYEGGVFNARLQF 60

Query: 69  PQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDIL------------KQDHWTPVWNLMS 116
           P++YP  PP   F P S+ H NV Y  GE+C+ IL              + W+PV ++  
Sbjct: 61  PRDYPLSPPKLTFTP-SILHPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEK 118

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLLR 143
            L ++  +L +P  ES  N+D   L R
Sbjct: 119 ILLSVMSMLSEPNVESGANIDACILWR 145

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 64.3 bits (155), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   DL KWEA I G +GT + G  + + +  P EYP+ PP  +F P    H NV Y +G
Sbjct: 33  DGSMDLQKWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYHPNV-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            ICL IL +D  W P   L   +  +  LL  P P SP
Sbjct: 91  TICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 64.3 bits (155), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 63/123 (51%), Gaps = 14/123 (11%)

Query: 33  LAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVN 92
           LA    + +L  W+ +I+GP  TPY G  F   +  P++YP  PP   F P S+ H N+ 
Sbjct: 25  LAAPKSESNLFLWDCLIQGPPDTPYEGGIFNARLDFPKDYPLSPPKLTFTP-SILHPNI- 82

Query: 93  YNTGEICLDILK------------QDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLAN 140
           Y+ GE+C+ IL             ++ W+PV ++   L ++  +L +P  ES  NVD   
Sbjct: 83  YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANVDACI 142

Query: 141 LLR 143
           L R
Sbjct: 143 LWR 145

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 63.9 bits (154), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 60/117 (51%), Gaps = 14/117 (11%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D +L  W+ +I+GP  TPY G  F   +  P++YP  PP   F P S+ H N+ Y  GE+
Sbjct: 31  DDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEV 88

Query: 99  CLDIL------------KQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           C+ IL             ++ W+PV ++   L ++  +L +P  ES  N+D   L R
Sbjct: 89  CISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 72/147 (48%), Gaps = 16/147 (10%)

Query: 9   KTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITI 68
           KT QK+L              I++ +PID D +L +W+ +I GP  + Y G  F   +  
Sbjct: 3   KTAQKRLLKELEKLTKDSPEGILA-SPID-DSNLFQWDCLIMGPPDSCYEGGVFNARLDF 60

Query: 69  PQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ------------DHWTPVWNLMS 116
           P++YP  PP   FQP S+ H N+ Y  GE+C+ IL              + W+PV ++  
Sbjct: 61  PKDYPLNPPKLTFQP-SILHPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEM 118

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLLR 143
            L ++  +L +P  ES  N+D   L R
Sbjct: 119 ILLSVMSILSEPNIESGANIDACILWR 145

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 62.8 bits (151), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 58/117 (49%), Gaps = 14/117 (11%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + DL  W+ ++ GP  TPY G  F   +  P +YP  PP   F P S+ H NV Y  GE+
Sbjct: 31  ESDLFTWDCLVAGPPDTPYAGGLFNCQLQFPTDYPLSPPTLTFTP-SILHPNV-YPNGEV 88

Query: 99  CLDILK------------QDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           C+ IL             ++ W+PV ++   L ++  +L +P  ES  N+D   L R
Sbjct: 89  CISILHAPGSDPNMYELPEERWSPVQSVEKILLSVVSMLSEPNVESGANIDACILWR 145

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 62.4 bits (150), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 71/147 (48%), Gaps = 16/147 (10%)

Query: 9   KTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITI 68
           KT Q++L              IV+  P D + DL  W+ +++GP  +PY G  F   +  
Sbjct: 3   KTAQRRLLKELQQLMRDPPPGIVA-GPQD-ESDLFLWDCLVQGPPDSPYEGGVFEAQLRF 60

Query: 69  PQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI------------LKQDHWTPVWNLMS 116
           P++YP  PP   F P S+ H NV Y  GE+C+ I            L ++ W+PV ++  
Sbjct: 61  PRDYPLSPPKLTFVP-SVLHPNV-YPNGEVCISILHAPGEDPNQYELAEERWSPVQSVEK 118

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLLR 143
            L ++  +L +P  ES  N+D   L R
Sbjct: 119 ILLSVVSMLSEPNVESGANIDACVLWR 145

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 62.4 bits (150), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 71/147 (48%), Gaps = 16/147 (10%)

Query: 9   KTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITI 68
           KT QK+L              IV+  P D + ++ +W+ +I GP  TPY    F   +  
Sbjct: 5   KTAQKRLLKEYQQLIRESPPGIVA-GPSD-ENNMFEWDCLISGPPETPYENGVFNATLLF 62

Query: 69  PQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI------------LKQDHWTPVWNLMS 116
           P++YP  PP   F P S+ H N+ Y  GE+C+ I            L ++ W+PV ++  
Sbjct: 63  PKDYPLSPPKLTFTP-SLLHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 120

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLLR 143
            L ++  +L +P  ES  N+D + L R
Sbjct: 121 ILLSVMSMLSEPNIESGANIDASILYR 147

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 61.6 bits (148), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 57/101 (56%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D +L  ++  I+GPQ +PY    F L + +P++YP   P   F  + + H N++   G I
Sbjct: 29  DDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK ++W+P   + + L +I  LL  P P  PL  D+A
Sbjct: 87  CLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 61.2 bits (147), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D +L  +E  I+GPQ +PY    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 29  DDNLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK  +W+P   + + L +I  LL  P P  PL  D+A
Sbjct: 87  CLDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 61.6 bits (148), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 70/147 (47%), Gaps = 16/147 (10%)

Query: 9   KTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITI 68
           KT QK+L              IV+  P++ ++++  W+ +I GP  +PY G  F   +  
Sbjct: 3   KTAQKRLMKEMQQLLKDCPEGIVA-GPVN-EENMFLWDCLIAGPPDSPYEGGIFNARLQF 60

Query: 69  PQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDIL------------KQDHWTPVWNLMS 116
           P +YP  PP   F P S+ H NV Y  GE+C+ IL              + W+PV ++  
Sbjct: 61  PTDYPLSPPKLTFTP-SILHPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEK 118

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLLR 143
            L ++  +L +P  ES  N+D   L R
Sbjct: 119 ILLSVMSMLSEPNVESGANIDACILWR 145

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 61.6 bits (148), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   DL KWEA I G   T + G  + + +  P EYP+ PP  +F P    H NV Y +G
Sbjct: 33  DGSMDLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYHPNV-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            ICL IL +D  W P   L   +  +  LL  P P SP
Sbjct: 91  TICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 61.6 bits (148), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 69/147 (46%), Gaps = 16/147 (10%)

Query: 9   KTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITI 68
           KT QK+L              IV+  P   D +L  W+ +I GP  +PY G  F   +  
Sbjct: 3   KTAQKRLLKELQQLARDSPEGIVA-GPKSED-NLFLWDCLITGPPDSPYEGGVFNAMLEF 60

Query: 69  PQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI------------LKQDHWTPVWNLMS 116
           P++YP  PP   F P S+ H N+ Y  GE+C+ I            L ++ W+PV ++  
Sbjct: 61  PKDYPLSPPRLTFTP-SILHPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEK 118

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLLR 143
            L ++  +L +P  ES  N+D   L R
Sbjct: 119 ILLSVTSMLSEPNVESGANIDACILWR 145

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D +L  +E  ++GP G+PY    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 29  DDNLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK  +W+P   + + L +I  LL  P P  PL  D+A
Sbjct: 87  CLDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (54%), Gaps = 3/102 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + +L  ++  I+GPQ +PY    F L + +P EYP  PP   F  + + H N++   G I
Sbjct: 29  EDNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRFLTK-IYHPNID-RLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLAN 140
           CLD+LK + W+P   + + L +I  LL  P P  PL  D+A 
Sbjct: 87  CLDVLKTN-WSPALQIRTVLLSIQALLATPNPNDPLANDVAK 127

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D +L  +   I+GP+G+PY    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 29  DDNLRYFSVTIEGPEGSPYEHGIFDLELFLPDDYPMESPKVRFLTK-IYHPNID-RLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK + W+P   + + L +I  LL  P P  PL  D+A
Sbjct: 87  CLDVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 71/147 (48%), Gaps = 16/147 (10%)

Query: 9   KTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITI 68
           KT QK+L              IV+  P   D ++ +W+ +++GP  +PY G  F   +  
Sbjct: 3   KTAQKRLLKELQQLMKDSPPGIVA-GPKTED-NIFQWDCLVQGPPDSPYEGGVFNAQLDF 60

Query: 69  PQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILK------------QDHWTPVWNLMS 116
           P++YP  PP   F P S+ H N+ Y  GE+C+ IL             ++ W+PV ++  
Sbjct: 61  PKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEK 118

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLLR 143
            L ++  +L +P  ES  N+D   L R
Sbjct: 119 ILLSVMSMLSEPNIESGANIDACILWR 145

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 37  DPDQDLTKWEAV-IKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNT 95
           +P +D  ++ AV I+GP+ +PY    F L + +P +YP   P   F  R + H N++   
Sbjct: 26  EPHEDNLRYFAVTIEGPEESPYENGVFELELYLPDDYPMEAPKVRFLTR-IYHPNID-RL 83

Query: 96  GEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           G ICLD+LK ++W+P   + + L +I  LL  P P  PL  D+A
Sbjct: 84  GRICLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 69/147 (46%), Gaps = 16/147 (10%)

Query: 9   KTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITI 68
           KT QK+L              IV+  P   D +L  W+ +I GP  +PY G  F   +  
Sbjct: 3   KTAQKRLFKELQQLLKDSPEGIVA-GPKSED-NLFVWDCLISGPPDSPYQGGVFNATLEF 60

Query: 69  PQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI------------LKQDHWTPVWNLMS 116
           P++YP  PP   F P S+ H N+ Y  GE+C+ I            L ++ W+PV ++  
Sbjct: 61  PKDYPLSPPKLLFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLLR 143
            L ++  +L +P  ES  N+D   L R
Sbjct: 119 ILLSVMSMLSEPNVESGANIDACILWR 145

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 69/147 (46%), Gaps = 16/147 (10%)

Query: 9   KTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITI 68
           KT QK+L              IV+  P   D +L  W+ +I GP  +PY G  F   +  
Sbjct: 3   KTAQKRLFKELQQLLKDSPEGIVA-GPRSED-NLFLWDCLISGPPDSPYQGGVFNATLEF 60

Query: 69  PQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI------------LKQDHWTPVWNLMS 116
           P++YP  PP   F P S+ H N+ Y  GE+C+ I            L ++ W+PV ++  
Sbjct: 61  PKDYPLSPPKLLFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLLR 143
            L ++  +L +P  ES  N+D   L R
Sbjct: 119 ILLSVMSMLSEPNVESGANIDACILWR 145

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 70/147 (47%), Gaps = 16/147 (10%)

Query: 9   KTIQKQLXXXXXXXXXXXXXIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITI 68
           KT QK+L              IV+  P + + DL  W+ +I+GP  TPY    F   +  
Sbjct: 3   KTAQKRLFKEYQQLIRDSPPGIVA-GPAN-ENDLFLWDCLIQGPPDTPYEHGVFNAQLRF 60

Query: 69  PQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILK------------QDHWTPVWNLMS 116
           P++YP  PP   F P ++ H N+ Y  GE+C+ IL             ++ W+PV ++  
Sbjct: 61  PRDYPLSPPTLTFTP-AILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLLR 143
            L ++  +L +P  ES  N+D   L R
Sbjct: 119 ILLSVMSMLSEPNVESGANIDACILWR 145

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 59.7 bits (143), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D +L  ++  I+GP+ +PY    F L + +P +YP   P   F  R + H N++   G I
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFLTR-IYHPNID-RLGRI 76

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK  +W+P   + + L +I  LL  P P  PL  D+A
Sbjct: 77  CLDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 59.7 bits (143), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   DL +WEA I G QGT +    + L I  P EYP+ PP  +  P +  H NV Y +G
Sbjct: 33  DGTMDLQRWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKL-PANFYHPNV-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            ICL IL +D  W P   L      I  LL  P P SP
Sbjct: 91  TICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 58.9 bits (141), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           +++L  ++  I+GPQ +PY    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK + W+P   + + L ++  LL  P P  PL  D+A
Sbjct: 87  CLDVLKTN-WSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 58.9 bits (141), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + +L  ++  I+GPQ + Y    F L + +P EYP  PP   F  + + H N++   G I
Sbjct: 29  EDNLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRFLTK-IYHPNID-RLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK + W+P   + + L +I  LL  P P  PL  D+A
Sbjct: 87  CLDVLKTN-WSPALQIRTVLLSIQALLATPNPNDPLANDVA 126

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 58.9 bits (141), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 49/99 (49%), Gaps = 3/99 (3%)

Query: 36  IDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNT 95
            D   +L KWEA I G  GT +    + L I  P +YP+ PP  +F P    H NV Y +
Sbjct: 32  TDGSMNLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKF-PAGFYHPNV-YPS 89

Query: 96  GEICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
           G ICL IL +D  W P   L   L  +  LL  P P SP
Sbjct: 90  GTICLSILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSP 128

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 60.1 bits (144), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 60/106 (56%), Gaps = 7/106 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D ++ ++     GPQGTPY    + L++ +P  YP   P   F  + + H N++  +G I
Sbjct: 26  DDNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDAASGSI 84

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           CLD++    W+P+++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 85  CLDVINS-TWSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 58.9 bits (141), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 59/117 (50%), Gaps = 14/117 (11%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + +L  W+ +++GP  T Y G  F   +  P++YP  PP   F P S+ H N+ Y  GE+
Sbjct: 31  ENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEV 88

Query: 99  CLDILK------------QDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           C+ IL             ++ W+PV ++   L ++  +L +P  ES  N+D   L R
Sbjct: 89  CISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSMLSEPNIESGANIDACILWR 145

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 59/117 (50%), Gaps = 14/117 (11%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + +L  W+ +++GP  T Y G  F   +  P++YP  PP   F P S+ H N+ Y  GE+
Sbjct: 31  ENNLFVWDCLVQGPPDTAYEGGIFNARLDFPKDYPLSPPKLTFTP-SILHPNI-YPNGEV 88

Query: 99  CLDILK------------QDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           C+ IL             ++ W+PV ++   L ++  +L +P  ES  N+D   L R
Sbjct: 89  CISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D +L  ++  I+GP+ +PY    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 76

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK  +W+P   + + L +I  LL  P P  PL  D+A
Sbjct: 77  CLDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + +L  ++  I+GPQ +PY    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK  +W+P   + + L ++  LL  P P  PL  D+A
Sbjct: 87  CLDVLKT-NWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D +L  ++  I+GP+ +PY    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK  +W+P   + + L +I  LL  P P  PL  D+A
Sbjct: 87  CLDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D +L  ++  I+GP+ +PY    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 76

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK  +W+P   + + L +I  LL  P P  PL  D+A
Sbjct: 77  CLDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + +L  ++  I+GPQ +PY    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK ++W+P   + + L ++  LL  P P  PL  D+A
Sbjct: 87  CLDVLK-NNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 14/111 (12%)

Query: 45  WEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI-- 102
           W+ +I+GP  TPY    F   +  P++YP  PP   F P S+ H N+ Y  GE+C+ I  
Sbjct: 37  WDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILH 94

Query: 103 ----------LKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
                     L ++ W+PV ++   L ++  +L +P  ES  N+D   L R
Sbjct: 95  SPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 14/111 (12%)

Query: 45  WEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI-- 102
           W+ +I+GP  TPY    F   +  P++YP  PP   F P S+ H N+ Y  GE+C+ I  
Sbjct: 37  WDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILH 94

Query: 103 ----------LKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
                     L ++ W+PV ++   L ++  +L +P  ES  N+D   L R
Sbjct: 95  SPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 41  DLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICL 100
           +L KWEA I G +GT +    F + +  P EYP+ PP  +F P    H N+ Y +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 94

Query: 101 DILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            IL +D  W P   L   +  +  LL  P P SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 14/111 (12%)

Query: 45  WEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI-- 102
           W+ +I+GP  TPY    F   +  P++YP  PP   F P S+ H N+ Y  GE+C+ I  
Sbjct: 37  WDCLIQGPPDTPYADGVFNTKLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILH 94

Query: 103 ----------LKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
                     L ++ W+PV ++   L ++  +L +P  ES  N+D   L R
Sbjct: 95  SPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 14/111 (12%)

Query: 45  WEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI-- 102
           W+ +I+GP  TPY    F   +  P++YP  PP   F P S+ H N+ Y  GE+C+ I  
Sbjct: 37  WDCLIQGPPDTPYADGIFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILH 94

Query: 103 ----------LKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
                     L ++ W+PV ++   L ++  +L +P  ES  N+D   L R
Sbjct: 95  SPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 51/99 (51%), Gaps = 3/99 (3%)

Query: 36  IDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNT 95
           +D   +L  WEA I G + T ++G  + + I  P EYP+ PP  +F P    H N+ Y +
Sbjct: 32  VDGSMNLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKF-PAGFYHPNI-YPS 89

Query: 96  GEICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
           G +CL IL +D  W P   L   +  +  LL  P P SP
Sbjct: 90  GTVCLSILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + +L  ++  I+GPQ +PY    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRFLTK-IYHPNID-KLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK  +W+P   + + L ++  LL  P P  PL  D+A
Sbjct: 87  CLDVLKT-NWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 56/104 (53%), Gaps = 4/104 (3%)

Query: 37  DPDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNT 95
           +P +D L  +   ++GP G+PY    F L + +P +YP   P   F  + + H N++   
Sbjct: 26  EPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTK-IYHPNID-RL 83

Query: 96  GEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           G ICLD+LK + W+P   + + L ++  LL  P P  PL  D+A
Sbjct: 84  GRICLDVLKTN-WSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 49/102 (48%), Gaps = 3/102 (2%)

Query: 33  LAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVN 92
           L   D   DL  WEA I G  GT +    + + I  P EYP+ PP  +F P    H N+ 
Sbjct: 29  LKKADGTMDLQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKF-PAGFYHPNI- 86

Query: 93  YNTGEICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
           Y +G +CL IL +D  W P   L   +  +  LL  P P SP
Sbjct: 87  YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   +L KWEA I G +GT +    + + I  P EYP+ PP  +F P    H N+ Y +G
Sbjct: 33  DGSMNLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            +CL IL +D  W P   L      +  LL  P P SP
Sbjct: 91  TVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   +L KWEA I G +GT +    + + I  P +YP+ PP  +F P    H N+ Y +G
Sbjct: 33  DGSMNLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            +CL IL +D  W P   +   L  +  LL  P P+SP
Sbjct: 91  TVCLSILNEDQDWKPAITMKQILLGVQDLLTSPNPDSP 128

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   +L +WEA I G +GT ++   + L I  P EYP+ PP  +  P    H NV Y +G
Sbjct: 33  DGSLNLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKL-PAGFYHPNV-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            ICL IL +D  W P   L      I  LL  P P SP
Sbjct: 91  TICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   +L KWEA I G +GT +    F + I  P +YP+ PP  +F P    H N+ Y +G
Sbjct: 33  DGSMNLQKWEAGIPGKEGTIWKDGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            +CL IL +D  W P   L      +  LL  P P SP
Sbjct: 91  TVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D +L  ++  I+GP+ +PY    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 25  DDNLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 82

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLDILK + W+P   + + L ++  LL  P P  PL  D+A
Sbjct: 83  CLDILKTN-WSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   +L KWEA I G +GT +    + + I  P +YP+ PP  +F P    H N+ Y +G
Sbjct: 33  DGSMNLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            +CL IL +D  W P   L   +  +  LL  P P+SP
Sbjct: 91  TVCLSILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSP 128

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 56.6 bits (135), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 41  DLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICL 100
           +L KWEA I G +GT +    F + I  P +YP+ PP  +F P    H N+ Y +G +CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 59

Query: 101 DILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            IL +D  W P   L      +  LL  P P SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 56/94 (59%), Gaps = 7/94 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP+ TPY G  + L++ +P  YP   P   F  + + H N++  +G ICLD++    W+P
Sbjct: 39  GPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSICLDVINS-TWSP 96

Query: 111 VWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           +++L++ ++  W+   LLK+P    PLN + ANL
Sbjct: 97  LYDLLNIVE--WMLPGLLKEPNGSDPLNNEAANL 128

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 4/105 (3%)

Query: 37  DPDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNT 95
           +P +D L  ++  I+GP  +PY    F L + +P++YP   P   F  + + H N++   
Sbjct: 26  EPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTK-IYHPNID-RL 83

Query: 96  GEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLAN 140
           G ICLD+LK  +W+P   + + L +I  LL  P P  PL  D+A 
Sbjct: 84  GRICLDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   +L KWEA I G +GT +    + + I  P +YP+ PP  +F P    H N+ Y +G
Sbjct: 33  DGSMNLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKF-PAGFYHPNI-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            +CL IL +D  W P   +   L  +  LL  P P SP
Sbjct: 91  TVCLSILNEDQDWKPAITMKQILLGVQDLLTSPNPNSP 128

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 56.2 bits (134), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 41  DLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICL 100
           DL +WEA I G  GT +    + + I  P EYP+ PP   F P+   H NV Y +G ICL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMF-PKGFYHPNV-YPSGTICL 59

Query: 101 DILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            IL ++  W P   L   +  +  LL  P P SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 56.6 bits (135), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   +L KWEA I G +GT +    + + I  P EYP+ PP  +  P +  H NV Y +G
Sbjct: 33  DGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKL-PANFYHPNV-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            ICL IL +D  W P   L      I  LL  P P SP
Sbjct: 91  TICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 56.6 bits (135), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 53/101 (52%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D +L  +   ++GP  +PY    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 29  DDNLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK  +W+P   + + L +I  LL  P P  PL  D+A
Sbjct: 87  CLDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 57.8 bits (138), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 60/106 (56%), Gaps = 7/106 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D ++ ++     GP+GTPY    + L++ +P  YP   P   F  + + H N++  +G I
Sbjct: 26  DDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDAASGSI 84

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           CLD++    W+P+++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 85  CLDVINS-TWSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 57.4 bits (137), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 58/103 (56%), Gaps = 7/103 (6%)

Query: 42  LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLD 101
           + ++     GP+ TPY G  + L++ +P  YP   P   F  + + H N++  +G ICLD
Sbjct: 17  MQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDAASGSICLD 75

Query: 102 ILKQDHWTPVWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           ++    W+P+++L++ L+  W+   LLK+P    PLN + A L
Sbjct: 76  VINS-AWSPLYDLLNILE--WMIPGLLKEPNGSDPLNNEAATL 115

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 57.8 bits (138), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 59/116 (50%), Gaps = 14/116 (12%)

Query: 36  IDPDQDLTKWE-AVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYN 94
           +D D ++  W   V+   + + Y+G  F   +  P+++P  PP F F P ++ H NV Y 
Sbjct: 33  LDDDSNIFSWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YR 90

Query: 95  TGEICLDILKQ-----------DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
            G +C+ IL Q           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 91  DGRLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 56.2 bits (134), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 37  DPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           D   +L KWEA I G +GT +    + + I  P EYP+ PP   F P    H N+ Y +G
Sbjct: 33  DGTMNLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRF-PAGFYHPNI-YPSG 90

Query: 97  EICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
            +CL IL +D  W P   L   +  +  LL  P P SP
Sbjct: 91  TVCLSILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 59/116 (50%), Gaps = 14/116 (12%)

Query: 36  IDPDQDLTKWE-AVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYN 94
           +D D +L  W   V+   + + Y+G  F   +  P+++P  PP F F P ++ H NV Y 
Sbjct: 33  LDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YR 90

Query: 95  TGEICLDILKQ-----------DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
            G +C+ IL Q           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 91  DGRLCISILHQGGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 56.6 bits (135), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 60/106 (56%), Gaps = 7/106 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D ++ ++     GP+GTPY    + L++ +P  YP   P   F  + + H N++  +G I
Sbjct: 26  DDNMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDAASGSI 84

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           CLD++    W+P+++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 85  CLDVINS-TWSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 56.6 bits (135), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (58%), Gaps = 7/94 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP+ TPY G  + L++ +P  YP   P   F  + + H N++  +G ICLD++    W+P
Sbjct: 40  GPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSICLDVINST-WSP 97

Query: 111 VWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           +++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 98  LYDLLNIIE--WMIPGLLKEPNGSDPLNNEAAGL 129

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 59/116 (50%), Gaps = 14/116 (12%)

Query: 36  IDPDQDLTKWE-AVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYN 94
           +D D +L  W   V+   + + Y+G  F   +  P+++P  PP F F P ++ H NV Y 
Sbjct: 33  LDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YR 90

Query: 95  TGEICLDILKQ-----------DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
            G +C+ IL Q           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 91  DGRLCISILHQGGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 59/116 (50%), Gaps = 14/116 (12%)

Query: 36  IDPDQDLTKWE-AVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYN 94
           +D D ++  W   V+   + + Y+G  F   +  P+++P  PP F F P ++ H NV Y 
Sbjct: 33  LDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YR 90

Query: 95  TGEICLDILKQ-----------DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
            G +C+ IL Q           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 91  DGRLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 59/116 (50%), Gaps = 14/116 (12%)

Query: 36  IDPDQDLTKWE-AVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYN 94
           +D D ++  W   V+   + + Y+G  F   +  P+++P  PP F F P ++ H NV Y 
Sbjct: 33  LDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMKFPEDFPFSPPNFRFTP-AIYHPNV-YR 90

Query: 95  TGEICLDILKQ-----------DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
            G +C+ IL Q           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 91  DGRLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 54.7 bits (130), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + +L  +   I+GP+ + Y    F L + +P +YP   P   F  + + H N++   G I
Sbjct: 29  EDNLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRFLTK-IYHPNID-RLGRI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           CLD+LK ++W+P   + + L +I  LL  P P  PL  D+A
Sbjct: 87  CLDVLK-NNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 48/99 (48%), Gaps = 3/99 (3%)

Query: 36  IDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNT 95
            D   +L KWEA I G +GT +    + + I  P EYP+ PP  +  P    H NV Y +
Sbjct: 32  TDGTMNLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKL-PAGFYHPNV-YPS 89

Query: 96  GEICLDILKQDH-WTPVWNLMSTLKAIWLLLKDPVPESP 133
           G ICL IL ++  W P   L      I  LL  P P SP
Sbjct: 90  GTICLSILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P+++P  PP F F P ++ H NV Y  G +C+ IL Q           
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P+++P  PP F F P ++ H NV Y  G +C+ IL Q           
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P+++P  PP F F P ++ H NV Y  G +C+ IL Q           
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 55.8 bits (133), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P ++P  PP F F P ++ H NV Y  G +C+ IL Q           
Sbjct: 54  YHGGYFKAQMKFPDDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHQSGNPTSDEPDE 111

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 112 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 145

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 55.8 bits (133), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P+++P  PP F F P ++ H NV Y  G +C+ IL Q           
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 55.8 bits (133), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P+++P  PP F F P ++ H NV Y  G +C+ IL Q           
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 58/116 (50%), Gaps = 14/116 (12%)

Query: 36  IDPDQDLTKWE-AVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYN 94
           +D D ++  W   V+   + + Y+G  F   +  P ++P  PP F F P ++ H NV Y 
Sbjct: 33  LDDDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YR 90

Query: 95  TGEICLDILKQ-----------DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
            G +C+ IL Q           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 91  DGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P+++P  PP F F P ++ H NV Y  G +C+ IL Q           
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 55.5 bits (132), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P+++P  PP F F P ++ H NV Y  G +C+ IL Q           
Sbjct: 55  YHGGYFKSQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTTDEPDA 112

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 55.5 bits (132), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P+++P  PP F F P ++ H NV Y  G +C+ IL Q           
Sbjct: 55  YHGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 54.7 bits (130), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 7/94 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP+ TPY    + L++ +P  YP   P   F  + + H N++  +G ICLD++    W+P
Sbjct: 37  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSICLDVINS-TWSP 94

Query: 111 VWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           +++L++ L+  W+   LLK+P    PLN + A L
Sbjct: 95  LYDLINILE--WMIPGLLKEPNGSDPLNNEAATL 126

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 55.1 bits (131), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 58/116 (50%), Gaps = 14/116 (12%)

Query: 36  IDPDQDLTKWE-AVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYN 94
           +D D ++  W   V+   + + Y+G  F   +  P+++P  PP F F P ++ H NV Y 
Sbjct: 33  LDDDSNIFLWNVGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YR 90

Query: 95  TGEICLDILK-----------QDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
            G +C+ IL             + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 91  DGRLCISILHTSGDPTSEEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 55.1 bits (131), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 49/98 (50%), Gaps = 13/98 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P ++P  PP F F P ++ H NV Y  G +C+ IL Q           
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
           + W+PV  + S L +I  LL+DP   SP NVD A   R
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFR 150

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 54.3 bits (129), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 59/106 (55%), Gaps = 7/106 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + ++ ++    +GP+ TPY    + L++ +P  YP   P   F  + + H N++  +G I
Sbjct: 14  NDNMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIL-HPNIDVASGSI 72

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           CLD++    W+P+++L + ++  W+   LLK+P    PLN + A L
Sbjct: 73  CLDVINS-TWSPLYDLKNIVE--WMIPGLLKEPNGSDPLNNEAATL 115

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 54.7 bits (130), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 58/116 (50%), Gaps = 14/116 (12%)

Query: 36  IDPDQDLTKWE-AVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYN 94
           +D D ++  W   V+   + + Y+G  F   +  P+++P  PP F F P ++ H NV Y 
Sbjct: 33  LDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YR 90

Query: 95  TGEICLDILK-----------QDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
            G +C+ IL             + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 91  DGRLCISILHTSGDPTSEEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 54.7 bits (130), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P ++P  PP F F P ++ H NV Y  G +C+ IL Q           
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV  + S L +I  LL+DP   SP NVD A
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 55.1 bits (131), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P ++P  PP F F P ++ H NV Y  G +C+ IL Q           
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV ++ S L +I  LL+DP   SP NVD A
Sbjct: 113 ETWSPVQSVESVLISIVSLLEDPNISSPANVDAA 146

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 54/94 (57%), Gaps = 7/94 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP+ TPY    + L++ +P  YP   P   F  + + H N++  +G ICLD++    W+P
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSICLDVINS-TWSP 95

Query: 111 VWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           +++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 96  LYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 58/106 (54%), Gaps = 7/106 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + ++ ++     GP+ TPY    + L++ +P  YP   P   F  +   H N++  +G I
Sbjct: 26  NDNMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDVASGSI 84

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           CLD++    W+P+++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 85  CLDVINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 54/94 (57%), Gaps = 7/94 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP+ TPY    + L++ +P  YP   P   F  + + H N++  +G ICLD++    W+P
Sbjct: 39  GPKDTPYENGVWRLHVELPDNYPFKSPSIGFVNK-IYHPNIDIASGSICLDVINS-TWSP 96

Query: 111 VWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           +++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 97  LYDLLNIVE--WMIPGLLKEPNGSDPLNNEAATL 128

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 54/94 (57%), Gaps = 7/94 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP+ TPY    + L++ +P  YP   P   F  + + H N++  +G ICLD++    W+P
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSICLDVINS-TWSP 95

Query: 111 VWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           +++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 96  LYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G  F   +  P+++P  PP F+F P  + H NV Y  G++C+ IL Q           
Sbjct: 62  YHGGYFQSQMKFPKDFPFSPPQFKFIP-PIYHPNV-YRDGKLCISILHQSGDAMTSEPDN 119

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV ++ S L +I  LL+DP   SP NVD A
Sbjct: 120 ETWSPVQSVESVLISIVSLLEDPNVSSPANVDAA 153

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 54/94 (57%), Gaps = 7/94 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP+ TPY    + L++ +P  YP   P   F  + + H N++  +G ICLD++    W+P
Sbjct: 39  GPKDTPYENGCWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSICLDVINS-TWSP 96

Query: 111 VWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           +++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 97  LYDLLNIVE--WMIPGLLKEPNGSDPLNNEAAGL 128

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 54/94 (57%), Gaps = 7/94 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP+ TPY    + L++ +P  YP   P   F  + + H N++  +G ICLD++    W+P
Sbjct: 56  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSICLDVINS-TWSP 113

Query: 111 VWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           +++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 114 LYDLLNIVE--WMIPGLLKEPNGSDPLNNEAATL 145

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 54/94 (57%), Gaps = 7/94 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP+ TPY    + L++ +P  YP   P   F  + + H N++  +G ICLD++    W+P
Sbjct: 39  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDAASGSICLDVINST-WSP 96

Query: 111 VWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           +++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 97  LYDLLNIVE--WMIPGLLKEPNGSDPLNNEAATL 128

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 57/103 (55%), Gaps = 7/103 (6%)

Query: 42  LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLD 101
           + ++     GP+ TPY    + L++ +P  YP   P   F  + + H N++  +G ICLD
Sbjct: 17  MQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDAASGSICLD 75

Query: 102 ILKQDHWTPVWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           ++    W+P+++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 76  VINS-TWSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL 115

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 54/94 (57%), Gaps = 7/94 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP+ TPY    + L++ +P  YP   P   F  + + H N++  +G ICLD++    W+P
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSICLDVINS-TWSP 95

Query: 111 VWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           +++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 96  LYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 5/114 (4%)

Query: 31  VSLAPIDPDQDLTKWE--AVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPH 88
           VSL  + P +D ++     +   P    Y G  F   +T  + YP  PP      + + H
Sbjct: 30  VSLTTLVPPEDTSRSPLLQITICPDEGFYNGGRFKFNLTTSESYPIDPPSVVCL-QKIYH 88

Query: 89  CNVNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLL 142
            N++ N G+ICL+IL++D W+P  ++ S +  +  L  +P P  PLN D A+ L
Sbjct: 89  PNIDLN-GKICLNILRED-WSPALDIQSVIVGLLFLFLEPNPRDPLNKDAASTL 140

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 52.0 bits (123), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 54/94 (57%), Gaps = 7/94 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP+ TPY    + L++ +P  YP   P   F  + + H N++  +G ICLD++    W+P
Sbjct: 61  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSICLDVINST-WSP 118

Query: 111 VWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           +++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 119 LYDLLNIVE--WMIPGLLKEPNGSDPLNNEAATL 150

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 72  YPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPE 131
           YP  PP  +F  + + H N++ N G+ICL+IL++D W+PV +L S +  +  L  +P P 
Sbjct: 95  YPIEPPVVKFL-KKIYHPNIDLN-GKICLNILRED-WSPVLDLQSIIIGLMFLFLEPNPR 151

Query: 132 SPLNVDLANLLR 143
            PLN+    LL+
Sbjct: 152 DPLNLKAGELLK 163

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 52.0 bits (123), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 58/106 (54%), Gaps = 7/106 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + ++ ++     GP+ TPY    + L++ +P  YP   P   F  + + H N++  +G I
Sbjct: 28  NDNMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSI 86

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           CLD++    W+P+++L + ++  W+   LLK+P    PLN + A L
Sbjct: 87  CLDVINST-WSPLYDLKNIVE--WMIPGLLKEPNGSDPLNNEAATL 129

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 51.2 bits (121), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 60/118 (50%), Gaps = 13/118 (11%)

Query: 31  VSLAPIDPDQDLTKWEAVI------KGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPR 84
           VS+  I    D+TK   ++      +G     ++ F F    TI + YP  PP      +
Sbjct: 58  VSMHVISHPSDITKQPELLLILSIDEGFYNLGHFRFQF----TINENYPIEPPKVVCLTK 113

Query: 85  SMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLL 142
            + H N+N  TGEICL+IL++D W+P  +L S +  +  L  +P P+ PLN   A+ L
Sbjct: 114 -IYHPNIN-RTGEICLNILRED-WSPALDLQSVIIGLLFLFIEPNPKDPLNKQAADTL 168

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 53/94 (56%), Gaps = 7/94 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
           GP  TPY    + L++ +P  YP   P   F  + + H N++  +G ICLD++    W+P
Sbjct: 38  GPDETPYEKGVWRLHVELPDNYPYKSPSIGFVNK-IFHPNIDIASGSICLDVINS-TWSP 95

Query: 111 VWNLMSTLKAIWL---LLKDPVPESPLNVDLANL 141
           +++L++ ++  W+   LLK+P    PLN + A L
Sbjct: 96  LYDLINIVE--WMIPGLLKEPNGTDPLNNEAAGL 127

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 55/104 (52%), Gaps = 6/104 (5%)

Query: 44  KWEAVIKGPQGTPYYGFNFILY-ITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI 102
           K E +++  +G  YY +  I + +   + YP  PP      + + H N++   G +CL+I
Sbjct: 63  KLEVIVRPDEG--YYNYGSINFNLDFNEVYPIEPPKV-VCLKKIFHPNIDL-KGNVCLNI 118

Query: 103 LKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLLRFGD 146
           L++D W+P  +L S +  +  L  +P P  PLN D A LL  G+
Sbjct: 119 LRED-WSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGE 161

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 50/98 (51%), Gaps = 13/98 (13%)

Query: 53  QGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ------- 105
           + + Y G  F   +  P  +P  PP F+F P  + H NV Y  G++C+ IL Q       
Sbjct: 52  EDSIYNGGYFKSEMKFPSNFPYSPPHFKFVP-PIYHPNV-YKDGKLCISILHQSGDSMTS 109

Query: 106 ----DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
               + W+PV ++ S L +I  LL+DP   SP NVD +
Sbjct: 110 EPDNETWSPVQSVESVLISIISLLEDPNISSPANVDAS 147

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 53/111 (47%), Gaps = 3/111 (2%)

Query: 29  IIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPH 88
           + + ++P DP         VI  P    Y   +F   +     YP  PP    + R + H
Sbjct: 54  LTICISPTDPSSLDNPLLDVIISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCRNR-IYH 112

Query: 89  CNVNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
            N++   G++CL+IL++D W+P  +L S +  +  L  +P  + PLN D A
Sbjct: 113 PNIDVQ-GKVCLNILRED-WSPALDLQSIIVGLLFLFLEPNAKDPLNTDAA 161

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 51/100 (51%), Gaps = 6/100 (6%)

Query: 44  KWEAVIKGPQGTPYYG-FNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI 102
           K E  +   +G   +G  NF L     + YP  PP      R + H N+++  G +CL+I
Sbjct: 62  KLEITVNPDEGYYTHGSINFSLDFN--EVYPIEPPKVACLKR-IFHPNIDF-KGNVCLNI 117

Query: 103 LKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLL 142
           L++D W+P  +L S +  +  L  +P P  PLN D A LL
Sbjct: 118 LRED-WSPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLL 156

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 48.1 bits (113), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 6/100 (6%)

Query: 44  KWEAVIKGPQGTPYYGFNFILY-ITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI 102
           K E V+   +G  YY    I + +   + YP  PP      + + H N++ N G +CL+I
Sbjct: 62  KLEVVVSPDEG--YYNHGSISFSLDFNEVYPIEPPKVTCL-KKIFHPNIDLN-GNVCLNI 117

Query: 103 LKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLL 142
           L++D W+P  +L S +  +  L  +P P  PLN D A L 
Sbjct: 118 LRED-WSPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLF 156

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 48/86 (55%), Gaps = 3/86 (3%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMS 116
           Y   +F   ++    YP  PP  +    ++ H N++YN G ICL++L++D WTPV +L +
Sbjct: 155 YKHGHFGFSVSFKDSYPIDPPIVKCL-TTIYHPNIDYN-GNICLNVLRED-WTPVLDLQT 211

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLL 142
            +  +  L  +P P+ PLN   A+ +
Sbjct: 212 IVIGLLFLFLEPNPKDPLNKHAAHTM 237

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMS 116
           Y G  +   + I   YP  PP  +   R + H N++ + G +CL++L++D WTP  ++ S
Sbjct: 72  YAGGTYYFNVFIKDTYPMEPPVVKCMHR-IYHPNIDID-GNVCLNLLRED-WTPALDIQS 128

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLL 142
            +  I  L  +P    PLN D A  L
Sbjct: 129 IIIGILFLFHEPNGRDPLNKDAAKTL 154

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 10/112 (8%)

Query: 34  APIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMP---HCN 90
           AP D  +D      ++   +G  Y   +F   +T  ++YP  PP    Q R M    H N
Sbjct: 53  APTDQSRDPPLLRLIVSPDEGF-YRKGHFTFEMTFTEKYPIEPP----QVRCMNQIFHPN 107

Query: 91  VNYNTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLL 142
           ++   G+ICL+IL++D W+P  +L S +  I  L  +     PLN   A+LL
Sbjct: 108 IDLQ-GKICLNILRED-WSPALDLQSVIIGILFLFLEVSGRDPLNKQAASLL 157

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 6/100 (6%)

Query: 44  KWEAVIKGPQGTPYYGFNFILY-ITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI 102
           K E  +   +G  YY    I + +   + YP  PP      + + H N++   G +CL+I
Sbjct: 62  KLEVTVSPDEG--YYNHGSINFGLDFNEVYPIEPPKVACL-KKIFHPNIDL-KGNVCLNI 117

Query: 103 LKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLL 142
           L++D W+P  +L S +  +  L  +P P  PLN D A L 
Sbjct: 118 LRED-WSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLF 156

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 3/83 (3%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMS 116
           Y G NF   +   ++YP  PP  +   R + H N++ + G +CL+IL+QD WTP  +L S
Sbjct: 66  YKGGNFTFELLFNEQYPMEPPKVKCLNR-IYHPNIDTD-GRVCLNILRQD-WTPALDLQS 122

Query: 117 TLKAIWLLLKDPVPESPLNVDLA 139
            +  +  L  +     PLN   A
Sbjct: 123 VIIGLLFLFLEISGVDPLNKQAA 145

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQ----------- 105
           Y+G      +  P+ +P  PP F F P  + H NV ++ G +C+ IL +           
Sbjct: 56  YHGAYLTGLLCFPRNFPFSPPTFLFCP-PIYHPNV-FSNGSLCISILHECGDDTNEEPDS 113

Query: 106 DHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
           + W+PV  + + L +I  LL DP   SP NVD A
Sbjct: 114 ETWSPVQTVETVLISIISLLDDPNVSSPANVDAA 147

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 18/101 (17%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFE-----FQPRSMPHCNVNYNTGEICLDILKQDHWTPV 111
           Y G  F    T  + YP  PP        F P   PH       G+ICL+IL++D W+P 
Sbjct: 76  YKGGKFRFTATFLETYPIDPPKVICNNKIFHPNIDPH-------GKICLNILRED-WSPA 127

Query: 112 WNLMSTLKAIWLLLKDPVPESPLNVDLANL-----LRFGDL 147
            +L   +  +  L ++P    PLN + A +     L FG+L
Sbjct: 128 LDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDKLEFGNL 168

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
            P+  PY G  F   +   + YP  PP        + H N++ N G+ICL+IL++D W+P
Sbjct: 76  SPREGPYLGGAFKFNLKFNEMYPIEPPS-AICLNKIFHPNIDLN-GKICLNILRED-WSP 132

Query: 111 VWNLMSTLKAIWLLLKDPVPESPLNVDLANLL-----RFGDL 147
             +L S +  +  L  D     PLN   A +L     RF +L
Sbjct: 133 ALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVLANDRNRFCEL 174

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (47%), Gaps = 8/119 (6%)

Query: 34  APIDPDQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNY 93
           +PIDP         +   P    Y G +F   +     YP  PP      + + H N++ 
Sbjct: 55  SPIDPGSRSPPLLEITAYPDEGFYKGGHFTFKLEFNDAYPIEPPTVICTSK-LYHPNIDI 113

Query: 94  NTGEICLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLANLL-----RFGDL 147
           + G++CL+IL++D W+P  ++ S +  +  LL +P  + PLN D A +L     RF  L
Sbjct: 114 D-GKVCLNILRED-WSPALDVQSIIIGLLFLLLEPNAKDPLNKDAAMMLSTDTARFASL 170

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 48/91 (52%), Gaps = 3/91 (3%)

Query: 52  PQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPV 111
           P+   Y G +F   +     YP  PP  +    ++ H N++Y +G ICL++L++D W+PV
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCL-NTIYHPNIDY-SGNICLNVLRED-WSPV 139

Query: 112 WNLMSTLKAIWLLLKDPVPESPLNVDLANLL 142
            +L + +  +  L  +P    PLN   A+ +
Sbjct: 140 MDLQTVVLGLLFLFLEPNGSDPLNRQAADTM 170

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + ++ +W  +I GPQ TPY G  +   +T P +YP  PP         P+     NT  +
Sbjct: 31  ESNILEWHYIIIGPQDTPYDGGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKENT-RL 86

Query: 99  CLDI--LKQDHWTPVWNLMSTLKAI 121
           CL +     D W P W++ + L  +
Sbjct: 87  CLSMSDYHPDTWNPGWSVATILNGL 111

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D+++ +W  VI GP  TPY G  +   +  P EYP  PP       S P+     +T  +
Sbjct: 31  DENILEWHYVITGPPDTPYEGGQYHGTLHFPPEYPFKPPAIRI---STPNGRFKQHT-RL 86

Query: 99  CLDI--LKQDHWTPVWNLMSTLKAI 121
           CL +     D W P W++ + L  +
Sbjct: 87  CLSMSDYHPDTWNPSWSVATILNGL 111

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           ++++ +W  VI GP  TPY G  +   +T P +YP  PP         P+     NT  +
Sbjct: 31  EENILEWHYVISGPPDTPYDGGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKENT-RL 86

Query: 99  CLDI--LKQDHWTPVWNLMSTLKAIWLLL 125
           CL +     D W P W++ + L  +   +
Sbjct: 87  CLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 38  PDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           P++D + +W  +I GP  TPY G  +   +T P +YP  PP         P+     NT 
Sbjct: 29  PNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIRM---VTPNGRFKPNT- 84

Query: 97  EICLDI--LKQDHWTPVWNLMSTLKAI 121
            +CL +     D W P W++ + L  +
Sbjct: 85  RLCLSMSDYHPDTWNPGWSVSTILNGL 111

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 38  PDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           P++D + +W  VI GP  TPY G  +   +T P +YP  PP         P+     NT 
Sbjct: 29  PNEDNILEWHYVITGPPETPYEGGQYHGTLTFPSDYPYKPPAIRM---VTPNGRFKENT- 84

Query: 97  EICLDI--LKQDHWTPVWNLMSTLKAI 121
            +CL +     D W P W++ + L  +
Sbjct: 85  RLCLSMSDYHPDLWNPGWSVSTILTGL 111

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 38  PDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           P++D + +W  +I GP  TPY G  +   +T P +YP  PP         P+     NT 
Sbjct: 29  PNEDNILEWHYIITGPAETPYKGGQYHGTLTFPSDYPYKPPAIRM---VTPNGRFKPNT- 84

Query: 97  EICLDI--LKQDHWTPVWNLMSTLKAI 121
            +CL +     D W P W++ + L  +
Sbjct: 85  RLCLSMSDYHPDTWNPGWSVSTILNGL 111

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 7/91 (7%)

Query: 38  PDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           P++D + +W  +I GP  TPY G  +   +T P +YP  PP         P+     NT 
Sbjct: 29  PNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKPNT- 84

Query: 97  EICLDI--LKQDHWTPVWNLMSTLKAIWLLL 125
            +CL +     D W P W++ + L  +   +
Sbjct: 85  RLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 7/91 (7%)

Query: 38  PDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           P++D + +W  +I GP  TPY G  +   +T P +YP  PP         P+     NT 
Sbjct: 29  PNEDNILEWHYIITGPPDTPYDGGQYHGTLTFPNDYPYKPPAIRM---ITPNGRFKENT- 84

Query: 97  EICLDI--LKQDHWTPVWNLMSTLKAIWLLL 125
            +CL +     D W P W++ + L  +   +
Sbjct: 85  RLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMS 116
           Y   +F    T    YP  PP      +   H N++   G +CL+IL++D W+PV ++ S
Sbjct: 73  YKCGHFKFCATFKDTYPIEPPKVTLLSKIF-HPNIDLQ-GNVCLNILRED-WSPVLDVQS 129

Query: 117 TLKAIWLLLKDPVPESPLNVDLANLL 142
            L  + +L  +P    PLN   A++L
Sbjct: 130 ILIGLLMLFLEPNATDPLNKVAADVL 155

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 41.2 bits (95), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + ++ +W  +I GP  TPY G  +   +T P +YP  PP         P+     NT  +
Sbjct: 31  ENNILEWHYIITGPPDTPYVGGQYHGTLTFPSDYPFKPPAIRMI---TPNGRFKENT-RL 86

Query: 99  CLDI--LKQDHWTPVWNLMSTLKAI 121
           CL +     D W P W++ + L  +
Sbjct: 87  CLSMSDYHPDLWNPGWSVATILNGL 111

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 3/93 (3%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
            P    Y    F   +   + YP  PP      + + H N++ + G+ICL+IL++D W+P
Sbjct: 75  SPDEGYYKSGKFKFDLKFNENYPIEPPIVLCMNK-IFHPNIDLD-GKICLNILRED-WSP 131

Query: 111 VWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
             +L S +  +  L  +   + PLN + AN+L 
Sbjct: 132 ALDLNSIIIGLLYLFLECNAKDPLNKEAANILH 164

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 3/93 (3%)

Query: 51  GPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTP 110
            P    Y    F   +   + YP  PP      + + H N++ + G+ICL+IL++D W+P
Sbjct: 76  SPDEGYYKSGKFKFDLKFNENYPIEPPIVLCMNK-IFHPNIDLD-GKICLNILRED-WSP 132

Query: 111 VWNLMSTLKAIWLLLKDPVPESPLNVDLANLLR 143
             +L S +  +  L  +   + PLN + AN+L 
Sbjct: 133 ALDLNSIIIGLLYLFLECNAKDPLNKEAANILH 165

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 40.4 bits (93), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 38  PDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           P++D + +W  VI GP  TPY    +   +T P +YP  PP         P+     NT 
Sbjct: 29  PNEDNILEWHYVITGPSDTPYSSGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKENT- 84

Query: 97  EICLDILKQ--DHWTPVWNLMSTLKAI 121
            +CL +     D W P W++ + L  +
Sbjct: 85  RLCLSMSDYHPDLWNPGWSVSTILTGL 111

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + ++ +W  +I GP  TPY+   +   +T P +YP  PP         P+     NT  +
Sbjct: 31  ENNILEWHYIITGPADTPYFEGQYHGTLTFPSDYPYKPPAIRM---VTPNGRFRENT-RL 86

Query: 99  CLDI--LKQDHWTPVWNLMSTLKAI 121
           CL +     + W P W++ + L  +
Sbjct: 87  CLSMSDYHPNTWNPSWSVSTILNGL 111

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 6/89 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + ++ +W  VI GP  +PY+   +   +T P +YP  PP         P+     NT  +
Sbjct: 31  ESNILEWHYVITGPPDSPYHDGQYHGTLTFPSDYPYKPPAIRM---VTPNGRFKENT-RL 86

Query: 99  CLDI--LKQDHWTPVWNLMSTLKAIWLLL 125
           CL +     D W P W++ + L  +   +
Sbjct: 87  CLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 7/91 (7%)

Query: 38  PDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           P++D + +W  +I GP  TPY    +   +T P +YP  PP         P+     NT 
Sbjct: 29  PNEDNILEWHYIITGPADTPYKAGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKPNT- 84

Query: 97  EICLDI--LKQDHWTPVWNLMSTLKAIWLLL 125
            +CL +     D W P W++ + L  +   +
Sbjct: 85  RLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 6/89 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + ++ +W  VI GP  TPY    +   +T P +YP  PP         P+     NT  +
Sbjct: 31  EDNILEWHYVITGPPSTPYENGQYHGTLTFPSDYPFNPPAIRM---ITPNGRFKENT-RL 86

Query: 99  CLDI--LKQDHWTPVWNLMSTLKAIWLLL 125
           CL +     + W P W++++ L  +   +
Sbjct: 87  CLSMSDYHPEAWNPAWSVVTILNGLLSFM 115

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 7/79 (8%)

Query: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMS 116
           Y+ F+     T P E P V          + H N++   G +CL+IL++D W+PV +L S
Sbjct: 77  YFRFSLFFKDTYPIEPPAVKCV-----NKIYHPNID-TQGNVCLNILRED-WSPVLDLQS 129

Query: 117 TLKAIWLLLKDPVPESPLN 135
            +  +  L  +P  + PLN
Sbjct: 130 VVIGLLFLFLEPNDKDPLN 148

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 7/87 (8%)

Query: 38  PDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           P++D + +W  VI GP  TPY G  +   +  P +YP  PP         P      +T 
Sbjct: 29  PNEDNVLEWHYVITGPPDTPYMGGQYHGTLVFPSDYPFKPPAIRM---VTPSGRFKEDT- 84

Query: 97  EICLDI--LKQDHWTPVWNLMSTLKAI 121
            +CL +     D W P W++ + L  +
Sbjct: 85  RLCLSMSDYHPDTWNPSWSVSTILTGL 111

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 40/89 (44%), Gaps = 6/89 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + ++ +W  +I GP  +PY+   +   +T P +YP  PP         P+     NT  +
Sbjct: 31  EANILEWHYIINGPPDSPYFEGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKENT-RL 86

Query: 99  CLDI--LKQDHWTPVWNLMSTLKAIWLLL 125
           CL +     D W P W++ + L  +   +
Sbjct: 87  CLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 7/87 (8%)

Query: 38  PDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           P++D + +W  VI GP  TPY G  +   +  P +YP  PP         P      +T 
Sbjct: 29  PNEDNILEWHYVITGPPDTPYEGGQYHGTLVFPSDYPFKPPAIRM---VTPSGRFKEDT- 84

Query: 97  EICLDI--LKQDHWTPVWNLMSTLKAI 121
            +CL +     D W P W++ + L  +
Sbjct: 85  RLCLSMSDYHPDTWNPSWSVSTILTGL 111

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 37/89 (41%), Gaps = 6/89 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           + ++  W  +I GP GTPY    +   +T P +YP  PP         P      NT  +
Sbjct: 31  ESNILDWHYIITGPPGTPYENGQYHGTLTFPSDYPFQPPAIRM---VTPSGRFQENT-RL 86

Query: 99  CLDI--LKQDHWTPVWNLMSTLKAIWLLL 125
           CL +       W P W++ + L  +   +
Sbjct: 87  CLSMSDYHPTTWNPGWSVSTILNGLLSFM 115

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 38  PDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           P++D + +W  +I GP  TPY    +   +T P +YP  PP         P+     NT 
Sbjct: 29  PNEDNILEWHYIITGPPDTPYKDGQYHGTLTFPSDYPYKPPAIRM---ITPNGRFKENT- 84

Query: 97  EICLDI--LKQDHWTPVWNLMSTLKAI 121
            +CL +     D W P W++ + L  +
Sbjct: 85  RLCLSMSDYHPDLWNPGWSVNTILNGL 111

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 36.2 bits (82), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 38  PDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           P++D + +W  +I GP  +PY    +   +T P +YP  PP         P+     NT 
Sbjct: 29  PNEDNILEWHYIITGPPDSPYSEGQYHGTLTFPTDYPYKPPAIRM---ITPNGRFKENT- 84

Query: 97  EICLDI--LKQDHWTPVWNLMSTLKAI 121
            +CL +     D W P W++ + L  +
Sbjct: 85  RLCLSMSDYHPDLWNPSWSVSTILTGL 111

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 35.8 bits (81), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 6/83 (7%)

Query: 45  WEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDI-- 102
           W  VI GP  TPY    +   +  P +YP  PP         P+     NT  +CL +  
Sbjct: 37  WHYVITGPPETPYEDGQYHGTLVFPNDYPFNPPAIRML---TPNGRFRENT-RLCLSMSD 92

Query: 103 LKQDHWTPVWNLMSTLKAIWLLL 125
              D W P W++ + L  +   +
Sbjct: 93  YHPDTWNPSWSVATILTGLLSFM 115

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 7/87 (8%)

Query: 38  PDQD-LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTG 96
           P++D + +W  +I GP  TPY    +   +  P +YP  PP         P+     NT 
Sbjct: 29  PNEDNILEWHYIITGPPDTPYTDGQYHGTLVFPADYPFKPPAIRM---ITPNGRFKENT- 84

Query: 97  EICLDI--LKQDHWTPVWNLMSTLKAI 121
            +C+ +     D W P W++ + L  +
Sbjct: 85  RLCMTMSDYHPDTWNPAWSVATILMGL 111

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 34.3 bits (77), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 41/100 (41%), Gaps = 6/100 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D  +TKW   I GP  + +    + L I     YP  PP   F  +    C VN  TGEI
Sbjct: 35  DITMTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPC-VNQTTGEI 93

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDL 138
             D     H    W    T++ + L L+  +  +P N  L
Sbjct: 94  QTDF----HTLRDWKRAYTMETLLLDLRKEMA-TPANKKL 128

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 33.1 bits (74), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 4/88 (4%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D  +TKW   I GP  + +    + + I     YP  PP  +F  +    C VN  TGE+
Sbjct: 35  DITMTKWNGTILGPPHSNHENRIYSVLIECGPSYPDEPPKVKFVSKINLPC-VNSTTGEV 93

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLK 126
              + ++ H    W    T++ + L L+
Sbjct: 94  ---VKEKFHTLKEWKRSYTMETVLLELR 118

>Suva_3.11 Chr3 complement(15902..17041) [1140 bp, 379 aa] {ON}
           YCL008C (REAL)
          Length = 379

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 50/124 (40%), Gaps = 24/124 (19%)

Query: 32  SLAPIDPDQDLTKWEAVIKGPQGTPYY--------GFNFILYITIPQEYPTVPPFFEFQ- 82
           SLA +D    L     V   P G+P          G +  L + IP  YP  PPF     
Sbjct: 35  SLALLDKFHRLRPRTRVFTHPDGSPQLLLSIYGTVGDSLPLIMWIPNLYPVKPPFISIDL 94

Query: 83  --------PRSMPHCNVNYNTGEICLDILKQDHWTPV-WNLMSTLKAIWLLL----KDPV 129
                     S+P      + G I L IL  DHW P   +L++ ++ +  LL    +DPV
Sbjct: 95  ETFDVSTISSSLPVQAYIDSDGRIALPIL--DHWNPATMSLIAVVQELMGLLNEPSQDPV 152

Query: 130 PESP 133
           P  P
Sbjct: 153 PSLP 156

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 32.0 bits (71), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 40/97 (41%), Gaps = 6/97 (6%)

Query: 42  LTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLD 101
           +TKW   I GP  + +    + L I     YP  PP   F  +    C VN  TGE+  D
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPC-VNPTTGEVQTD 59

Query: 102 ILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDL 138
                H    W    T++ + L L+  +  +P N  L
Sbjct: 60  F----HTLRGWKRAYTMETLLLDLRKEM-ATPANKKL 91

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 32.3 bits (72), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 41/100 (41%), Gaps = 6/100 (6%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D  +TKW   I GP  + +    + L I     YP  PP   F  +    C VN  TGE+
Sbjct: 35  DITMTKWNGTILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPC-VNPTTGEV 93

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDL 138
             D     H    W    T++ + L L+  +  +P N  L
Sbjct: 94  QTDF----HTLRDWKRAYTMETLLLDLRKEM-ATPANKKL 128

>KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.187
           YGL087C
          Length = 138

 Score = 32.0 bits (71), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 5/101 (4%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D  +TKW   I GP  + +    + L I     YP  PP  +F  +    C V+  TG +
Sbjct: 35  DITMTKWNGTILGPPHSNHENRIYSLEIVCGDRYPDEPPLVKFISKVNLPC-VDQTTGVV 93

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPESPLNVDLA 139
             +     H    W    T++ + L L+  +  +P N  L+
Sbjct: 94  SAEKF---HTLRDWKRSYTMQTVLLDLRKEMG-TPANKKLS 130

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 140

 Score = 31.2 bits (69), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 4/88 (4%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D  +T W   I GP  + +    + + I     YP  PP  +F  +    C V+  TGE+
Sbjct: 37  DITMTNWNGTILGPPHSNHENRIYSVAIECGANYPDEPPLIKFVSKINLPC-VDQTTGEV 95

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLK 126
             D   Q H    W    T++ + L L+
Sbjct: 96  KHD---QFHTLRDWKRSYTMETLLLDLR 120

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 31.2 bits (69), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 40/94 (42%), Gaps = 4/94 (4%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D  +T W   I GP  + +    + + I    EYP  PP  +F  +    C V+  TGE+
Sbjct: 35  DITMTTWNGTILGPPHSNHENRIYSVVIKCGDEYPDKPPTVKFISKINLPC-VDQATGEV 93

Query: 99  CLDILKQDHWTPVWNLMSTLKAIWLLLKDPVPES 132
             ++    H    W    T++ + L L+  +  S
Sbjct: 94  ETNMF---HTLRDWKRSYTMETLLLDLRKEMASS 124

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 138

 Score = 30.8 bits (68), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 8/90 (8%)

Query: 39  DQDLTKWEAVIKGPQGTPYYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEI 98
           D  +T W   I GP  + +    + + I   + YP  PP   F  +    C V+ NTGE+
Sbjct: 35  DITMTHWNGTILGPPHSNHENRIYSVAIECGEAYPDQPPKIRFLSKVNLPC-VDQNTGEV 93

Query: 99  CLDILKQDHWTPV--WNLMSTLKAIWLLLK 126
                K++ ++ +  W    T++ + L L+
Sbjct: 94  -----KKEQFSTLRDWKRSYTMETLLLDLR 118

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.141    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,074,099
Number of extensions: 662311
Number of successful extensions: 1634
Number of sequences better than 10.0: 270
Number of HSP's gapped: 1334
Number of HSP's successfully gapped: 270
Length of query: 163
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 62
Effective length of database: 41,900,133
Effective search space: 2597808246
Effective search space used: 2597808246
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)