Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G009003.497ON1279125160210.0
NCAS0E007703.497ON115090819670.0
ZYRO0D09790g3.497ON1180119818560.0
Suva_7.4223.497ON112789518200.0
Skud_7.4453.497ON112389617810.0
YGR134W (CAF130)3.497ON112290217480.0
Smik_6.2303.497ON112489617200.0
KAFR0C020003.497ON106688017080.0
SAKL0F02596g3.497ON1132118916880.0
TDEL0D056503.497ON107792116670.0
KNAG0B007703.497ON103888216060.0
Kpol_480.123.497ON111486516020.0
Kwal_47.188863.497ON1105119215970.0
KLTH0G02442g3.497ON1113117415370.0
Ecym_12323.497ON120494315260.0
AFR316W3.497ON119177415160.0
TPHA0A056803.497ON107486313251e-162
CAGL0I10428g3.497ON116376412811e-155
TBLA0C045103.497ON13077989281e-104
KLLA0E03961g3.497ON11328828772e-98
NDAI0I011506.204ON523106745.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00900
         (1279 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...  2323   0.0  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   762   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   719   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...   705   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...   690   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...   677   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...   667   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   662   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...   654   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   646   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   623   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   621   0.0  
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   619   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   596   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   592   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   588   0.0  
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   514   e-162
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   498   e-155
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   362   e-104
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   342   2e-98
NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204     33   5.7  

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score = 2323 bits (6021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1155/1251 (92%), Positives = 1155/1251 (92%)

Query: 17   TIPDMHQPTFTTIQTAPDTNLEPVREPEVKFKTSADDDSNFYSEEDEIMLTPMSELIPTI 76
            TIPDMHQPTFTTIQTAPDTNLEPVREPEVKFKTSADDDSNFYSEEDEIMLTPMSELIPTI
Sbjct: 17   TIPDMHQPTFTTIQTAPDTNLEPVREPEVKFKTSADDDSNFYSEEDEIMLTPMSELIPTI 76

Query: 77   FTNHKFKIYKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILN 136
            FTNHKFKIYKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILN
Sbjct: 77   FTNHKFKIYKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILN 136

Query: 137  YLFDTKRKPPTVQNKILRKTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFL 196
            YLFDTKRKPPTVQNKILRKTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFL
Sbjct: 137  YLFDTKRKPPTVQNKILRKTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFL 196

Query: 197  LTFHPLSNIETPSIILDSNYNMLTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIP 256
            LTFHPLSNIETPSIILDSNYNMLTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIP
Sbjct: 197  LTFHPLSNIETPSIILDSNYNMLTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIP 256

Query: 257  QFNGHFQWYTSLPNDKPLYIKEXXXXXXXXXXXKILSSESFIEIITRSNHDFEDDKSFKM 316
            QFNGHFQWYTSLPNDKPLYIKE           KILSSESFIEIITRSNHDFEDDKSFKM
Sbjct: 257  QFNGHFQWYTSLPNDKPLYIKESSNSCNTSSSNKILSSESFIEIITRSNHDFEDDKSFKM 316

Query: 317  SKTSKPVVLWAIEEILSRLSFKDSSRYKKNNINGNGQNYPQMERAQNQSDINYLNRNDGA 376
            SKTSKPVVLWAIEEILSRLSFKDSSRYKKNNINGNGQNYPQMERAQNQSDINYLNRNDGA
Sbjct: 317  SKTSKPVVLWAIEEILSRLSFKDSSRYKKNNINGNGQNYPQMERAQNQSDINYLNRNDGA 376

Query: 377  DEYDDDYLHRIDDLKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDS 436
            DEYDDDYLHRIDDLKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDS
Sbjct: 377  DEYDDDYLHRIDDLKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDS 436

Query: 437  SPLLELQFKLMLGLVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTH 496
            SPLLELQFKLMLGLVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTH
Sbjct: 437  SPLLELQFKLMLGLVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTH 496

Query: 497  VCFQMVKIINNCMEKLNCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGN 556
            VCFQMVKIINNCMEKLNCNDLQKLYDLTGFQGENNKEELL            TDRFVDGN
Sbjct: 497  VCFQMVKIINNCMEKLNCNDLQKLYDLTGFQGENNKEELLQQQQQQQQQQQQTDRFVDGN 556

Query: 557  WRSTLEQWLPHGLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLI 616
            WRSTLEQWLPHGLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLI
Sbjct: 557  WRSTLEQWLPHGLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLI 616

Query: 617  LVLGLDIDRSEEAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTF 676
            LVLGLDIDRSEEAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTF
Sbjct: 617  LVLGLDIDRSEEAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTF 676

Query: 677  MSPHGRKLCNGALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYD 736
            MSPHGRKLCNGALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYD
Sbjct: 677  MSPHGRKLCNGALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYD 736

Query: 737  DYNAALKENHEDLGKTLKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILXXXXXXXXX 796
            DYNAALKENHEDLGKTLKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKIL         
Sbjct: 737  DYNAALKENHEDLGKTLKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILQDDDDGNGD 796

Query: 797  XXXXXXXXXXXTPKNVASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYST 856
                       TPKNVASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYST
Sbjct: 797  EQQGEQEEQEGTPKNVASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYST 856

Query: 857  SYSFIDDSSLDTMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKDQL 916
            SYSFIDDSSLDTMINLTSKASTQKLNHDDSI      ASSIKEEQNDMIMKDLLKGKDQL
Sbjct: 857  SYSFIDDSSLDTMINLTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKGKDQL 916

Query: 917  HSNIINPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNG 976
            HSNIINPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNG
Sbjct: 917  HSNIINPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNG 976

Query: 977  YRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPFANNNECKNELLHELMLGKKIVDNHTY 1036
            YRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPFANNNECKNELLHELMLGKKIVDNHTY
Sbjct: 977  YRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPFANNNECKNELLHELMLGKKIVDNHTY 1036

Query: 1037 PFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTXXXXXXXXXXXXX 1096
            PFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTT             
Sbjct: 1037 PFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTEDISINSDEIENN 1096

Query: 1097 XXHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIXXXXXXXXXX 1156
              HGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGI          
Sbjct: 1097 ENHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGILKEAKELFFK 1156

Query: 1157 XXSDIXXXXXXXXXXXXXXXXXXXXRKSSESNGKWEGSRIGKMNDFNKRLLRLLAPIHSG 1216
              SDI                    RKSSESNGKWEGSRIGKMNDFNKRLLRLLAPIHSG
Sbjct: 1157 LKSDIEETSESTDGGDDDDFESIDSRKSSESNGKWEGSRIGKMNDFNKRLLRLLAPIHSG 1216

Query: 1217 DTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPKVGHSL 1267
            DTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPKVGHSL
Sbjct: 1217 DTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPKVGHSL 1267

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/908 (47%), Positives = 564/908 (62%), Gaps = 92/908 (10%)

Query: 395  EKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVDPL 454
            + VYSFDLN D +  + +N++ +T KRH++LN+L+N+N   ++PLL LQF  M GLVDPL
Sbjct: 275  QTVYSFDLNTDKTFEL-DNVVSHTAKRHRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPL 333

Query: 455  SQPPPNDKHIISLDLLYQLFIAILYPNF-EIFQNNLGFNWKTHVCFQMVKIINNCMEKLN 513
            SQPPPN+K +ISL LLY +FI ++YPN  E F  N GFNWK H+CF MVK+INN M  L 
Sbjct: 334  SQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILK 393

Query: 514  CNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLNTQD 573
            C++  KL D+     +N++                T+   D  W+  L +W+PHG+NTQD
Sbjct: 394  CDNFNKLNDIINSNNDNDE---------------GTENDDDDAWKLKLNEWIPHGINTQD 438

Query: 574  LELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHETY 633
            LEL+YM+ I+A YT+ +L  ++PIQ+NPFL  LI LWK L+ I++LGLDIDRSEEA +T+
Sbjct: 439  LELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTF 498

Query: 634  KTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCDI 693
             TPLLV+ATIRGA++LR+VVATILNN+++ N+HDFKHE LNTFMSPHGRKLC GALY DI
Sbjct: 499  STPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADI 558

Query: 694  KLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKTL 753
            +  AA++ ALG +L ++ +LL+ L+ GDRFDEDI YMF+YEYDDY               
Sbjct: 559  RSHAAAILALGAELEDVTDLLTDLQAGDRFDEDIRYMFDYEYDDY--------------- 603

Query: 754  KSNDDNSDIYVLNEVK-LDRYQRRCNCIFEDDKILXXXXXXXXXXXX-----------XX 801
              ND   D+    E++ +  + RRCNCIFEDD I+                         
Sbjct: 604  --NDFKDDVEEQEEMEIMGSFPRRCNCIFEDDNIINDDTDNINENDEDDDDEQEEYVDAI 661

Query: 802  XXXXXXTPKNVASFQDPLGKRNLD-YAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSF 860
                  TP N  +  D +  RN    + RSK++FEFDY GKDWRDIPRGFN+YYS SY F
Sbjct: 662  EGVTKDTPHNNLNPHDAIRTRNSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHF 721

Query: 861  IDDSSLDTMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKDQLHSNI 920
            I    ++T+  LTSKA+ +KL  +DS       AS IK EQ+ MI K+LLK     H+ +
Sbjct: 722  IKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELLK-----HNTV 776

Query: 921  INPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRV 980
             +P   ++ E +    +ATPDDI+D W ++  F  ML+ N++++WRLMDEMLMCNGYRRV
Sbjct: 777  KHPHA-AENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRV 835

Query: 981  LIWYITHMKLNHSLIQYIFELLMGLRGSPFA---NNNECKNELLHELMLG----KKIVDN 1033
            LIW+ITHM+LNHSLIQYIFEL+MGLRGSPF+   +  + KN+LLHE+M G    K+IV +
Sbjct: 836  LIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTS 895

Query: 1034 HTY-PFSRQGPLILSDIETKMLLQEFFSNAAIYF----DNDLATNEGDGQLEHTTXXXXX 1088
             TY PFSRQGPLILS+IE KMLLQEFF+NAAIYF    +N+  TN  +G+          
Sbjct: 896  LTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSNNEGTTNNDNGE---------- 945

Query: 1089 XXXXXXXXXXHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIXX 1148
                         S+YS GL+KLIC MV SL+EN KFDF KS+C FELQTLLMNWIGI  
Sbjct: 946  ----GIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIP 1001

Query: 1149 XXXXXXXXXXSDIXXXXXXXXXXXXXXXXXXXXRKSSESNGKWEGSRIGKMND------- 1201
                      S +                      S   +G      I + +        
Sbjct: 1002 EAEDLFFTLKSGVSSSSTKTGRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSPPNE 1061

Query: 1202 --FNKRLLRLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILP 1259
              FNKRL+ LL P    D D N+   T   R  ++ YSF  +   V GRKVVY+D+ +LP
Sbjct: 1062 SIFNKRLVSLL-PKRINDKDENAAVST--LRHFIERYSFDEE-APVYGRKVVYSDEIVLP 1117

Query: 1260 LPKVGHSL 1267
            LP     +
Sbjct: 1118 LPAADQPI 1125

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 110/229 (48%), Gaps = 32/229 (13%)

Query: 58  YSEEDEIMLTPMSELIPTIFTNHKFKIYKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIM 117
           Y+    +  TP+ EL          + Y+P++  L + L D+     +  +  +++ S++
Sbjct: 23  YAMAQLVTYTPLRELFAE-------RNYQPSLSQLLNLLSDDAL---LNNLTPIQEHSLL 72

Query: 118 LETLVIAYFTTKSGQSILNYLFDTKRKPPT-----------------VQNKILRKTWEVN 160
           +E ++I + +T+SG+ + + LF+ K +  T                   ++ LRK W  N
Sbjct: 73  VECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRKKWSSN 132

Query: 161 EFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNMLT 220
           +  +  F  FL+ N +  IN+DK+ EP  KL + FL  F   +N+  P+ ILD+ YN+L 
Sbjct: 133 KLYFLKFTKFLLVNADGNINVDKYTEPIYKLPLNFL--FDDNTNL-MPTFILDNKYNLLQ 189

Query: 221 DYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYTSLP 269
           DY+ A    L  ++K T+ N        I + +   QF   + WY  LP
Sbjct: 190 DYIYACGPLLKCVMKDTLENGICLDLPGIYKLDIDLQF--PYPWYDLLP 236

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/1198 (38%), Positives = 654/1198 (54%), Gaps = 172/1198 (14%)

Query: 113  KFSIMLETLVIAYFTTKSGQSILNYLFDTKRKPP-----TVQNKILRKT----------- 156
            K+S++LE +++A  TT++G S+L  L  +   P      + Q K L +            
Sbjct: 84   KYSLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPKCISNQRKWLAQVERKGKLHSDLI 143

Query: 157  --WEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDS 214
              W+ ++ ++  F+ FL++N++  +  +  N+ E K+ + FL+     S      +ILD 
Sbjct: 144  SQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQ----SKYRAAELILDP 199

Query: 215  NYNMLTDYLDAT----SNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYTSLPN 270
            +YN+L DY  A       WL   I       G     T+I YNR+  F+G+F WYT    
Sbjct: 200  SYNLLVDYFLAVVPLCEKWLRRAISY---GNGVHLKRTVINYNRVYDFSGYFTWYT---- 252

Query: 271  DKPLYIKEXXXXXXXXXXXKILSSESFIEIITR-SNHDFEDDKSFKMSKTSKPVVLWAIE 329
                                         + TR SNH F   +       S    + A+ 
Sbjct: 253  -----------------------------LQTRGSNHPFVSQQILFDLIDSDDKEIEAVS 283

Query: 330  EILS-----RLSFKDSSRYKKNNINGNGQN---YPQMERAQNQSDINYLNRNDGADEYDD 381
            +I S     R+   D  R    +I+    N   Y   +R+               +EY D
Sbjct: 284  QIESNDQEERIQIIDQIRSAIQDISSASLNSGFYGDEDRS-------------ALEEYSD 330

Query: 382  DYLHRIDDLKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLE 441
            +Y H+++      E+V+SFDLN DGS+ +P NLM +   RH+IL K+L  N+  SSPLL+
Sbjct: 331  NYHHQVNQ----NEQVFSFDLNQDGSLELP-NLMSHAAVRHEILMKVLKLNN-SSSPLLQ 384

Query: 442  LQFKLMLGLVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFE-IFQNNLGFNWKTHVCFQ 500
            LQFK++ GLVDPL+QP PNDKH+ISLDLLYQ+F+  L P  +   +   G +W+ HVCF 
Sbjct: 385  LQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFN 444

Query: 501  MVKIINNCMEKLNCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRST 560
            M KII+  + +LN +D ++L  +      NN                 +D  VD  WRS 
Sbjct: 445  MQKIIDASLVRLNFDDFERLNSI------NN-----------------SDDNVD--WRSQ 479

Query: 561  LEQWLPHGLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLG 620
            L++WLPHG NTQDLEL+ MV I+A YT+ KL   +PIQLNPFL +LI+LWK LT +++LG
Sbjct: 480  LDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLG 539

Query: 621  LDIDRSEEAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPH 680
            L+IDR EE  ET+ TPL+V+ATIRGA+ALR++VAT+LN ++E   HD KHE+LNTFMSPH
Sbjct: 540  LEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPH 599

Query: 681  GRKLCNGALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNA 740
            GRKLC GALY +++  AA+L ALG +L ++ +L S L+PGDRFDED+ YMFEYE++DYN 
Sbjct: 600  GRKLCQGALYAELRSHAAALLALGSELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYN- 658

Query: 741  ALKENHEDLGKTLKSND--DNSDIYVLNEVKLDRYQRRCNCIFEDDKILXXXXXXXXXXX 798
             L    ED     K +D  D+S  +         + RRCNCIF                 
Sbjct: 659  DLSSREEDYSGFDKYDDYTDSSKTHARK-----GFGRRCNCIF-------DDDEMLEDED 706

Query: 799  XXXXXXXXXTPKNVASFQDPLGKRNLD-----YAVRSKTTFEFDYSGKDWRDIPRGFNIY 853
                      PK +   Q+P    ++      +A+RS  +FEFDYSGKDWRDIPR  N+Y
Sbjct: 707  YENEYEGHKAPKQILPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPRMSNLY 766

Query: 854  YSTSYSFIDDSSLDTMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGK 913
            YS +Y F++D   +T+I+LT+KA+ Q L+  +S+      A+ +K EQ+++++ ++ +  
Sbjct: 767  YSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELH 826

Query: 914  DQ---LHSNIINPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDE 970
             Q     S +I+ L +            +PDDI++ W     F +M++ N E++WRLMDE
Sbjct: 827  HQNGSRGSQVIDKLKD-----------ISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDE 875

Query: 971  MLMCNGYRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPFANNNECKN--ELLHELMLGK 1028
            MLMC+G+RRVLIW+ITHM+LNHSLI YIFEL+MGLR S F  NNE  N  E + E+    
Sbjct: 876  MLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKS-FDENNENDNGDESISEMTKEA 934

Query: 1029 KIVDNHTYPFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTXXXXX 1088
              V   + PFSRQG + LS IETKMLLQEFF+NAAI+         G+  +E        
Sbjct: 935  PEVRT-SLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEWIGEEPMEDEATINDG 993

Query: 1089 XXXXXXXXXXHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIXX 1148
                        VS+Y++GLMKLIC+MV + I+  KFDF +S+C FELQTLLMNWI I  
Sbjct: 994  ENG--------NVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIP 1045

Query: 1149 XXXXXXXXXXSDIXXXXXXXXXXXXXXXXXXXXRKSSES---NGKWEGSRIGKMNDFNKR 1205
                      + +                     K   S   N    G+     +++N++
Sbjct: 1046 EAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVD-SEYNRK 1104

Query: 1206 LLRLLAPIHSGDTDLNSDTVTTPFRGLLKNYSF-TSKPKKVAGRKVVYTDDEILPLPK 1262
            L+ LL+P+     +   +      R  +K YSF T+ P  + GRKVVY  +EILPLP+
Sbjct: 1105 LISLLSPVMHRKEE---NAAVVALRNFIKKYSFDTTVP--LIGRKVVYEGNEILPLPE 1157

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/895 (43%), Positives = 549/895 (61%), Gaps = 76/895 (8%)

Query: 381  DDYLHRIDDLKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLL 440
            D  +HR     + +E++YSF+LN DG++ +P N+M ++  RH++L K+LN      +PLL
Sbjct: 276  DTIIHRT---VNDQEQIYSFELNQDGTLQIP-NVMEHSLLRHELLFKILNLTPV-LTPLL 330

Query: 441  ELQFKLMLGLVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQ-NNLGFNWKTHVCF 499
            E QF  + GLVDPL+QP PNDKHIIS+D LYQLF+ ++YP+ +  Q +N  ++WK ++CF
Sbjct: 331  EQQFSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICF 390

Query: 500  QMVKIINNCMEKLNCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRS 559
             M KII+  M +LNC   +KL  +      NN ++ +                   +WR+
Sbjct: 391  NMQKIIDATMLRLNCFGFEKLNSI------NNTDDTV-------------------HWRT 425

Query: 560  TLEQWLPHGLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVL 619
             L  WLPHGLNTQDLELLYM+ ILA YT+ KL  EIPIQLNPFL +L++LWK L+ +++L
Sbjct: 426  QLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILL 485

Query: 620  GLDIDRSEEAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSP 679
             L+IDR EE   TY+TPL+V+ATIRGA+ALRSV+A +LN  ++ NDHDFKHE+LNTFMSP
Sbjct: 486  ALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSP 545

Query: 680  HGRKLCNGALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYN 739
            +GRKLC+GALY D++   ASL ALG  + ++ +L + L+ GDRFDEDI YMF+YE +DYN
Sbjct: 546  YGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYN 605

Query: 740  AALKE-NHEDLGKTLKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILXXXXXXXXX-- 796
             +  +   E+LG+ + S +          +    YQRRCNCIF DDK++           
Sbjct: 606  ESFSDCGDEELGEGVNSGEKTK-----TSIHNGFYQRRCNCIFNDDKLVAEDGANASTNN 660

Query: 797  -XXXXXXXXXXXTPKNVASFQDPLGKRNLD-YAVRSKTTFEFDYSGKDWRDIPRGFNIYY 854
                           N A         +++ Y+VRS++TFEFDYSG+DWRD+P+ FNIYY
Sbjct: 661  DSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYY 720

Query: 855  STSYSFIDDSSLDTMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKD 914
            S SYSFI +  LD + NLT + +T+KL+ ++S+      AS +K EQ+ MI+ DL     
Sbjct: 721  SPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFT 780

Query: 915  QLHSNI--INPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEML 972
             +  N    +  + S +  +      TPDDI++ W ++  F  ML+ N +++WRLMDEML
Sbjct: 781  SIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEML 840

Query: 973  MCNGYRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPF---ANNNECKNELLHELMLGKK 1029
            MC GYRR+LIW++TH++L HSLI Y+FEL+MGLRG+PF   A++ + K+++++E++  K+
Sbjct: 841  MCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQ 900

Query: 1030 IVDNHT-YPFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTXXXXX 1088
              +N +  PFSRQGP++LSDIETKMLLQEFF NAAI+  +     EG+            
Sbjct: 901  KNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEGEDA---------- 950

Query: 1089 XXXXXXXXXXHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIXX 1148
                        VS+YS+GL+KLIC MV +LI N KF FTKS+C FELQTLLM WIGI  
Sbjct: 951  ----------DKVSLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILP 1000

Query: 1149 XXXXXXXXXXSDIXXXXXXXXXXXXXXXXXXXXRKSSESNGKWEGSRIGKMNDFNKRLLR 1208
                      S +                        +S  K     I K+N      ++
Sbjct: 1001 EAKDLFFQIKSRLAMEEDGITDNTVQHKDKTDL--DLDSGKKPNTKSISKLN------MK 1052

Query: 1209 LLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPKV 1263
            +L+   S  T+ + ++  +  R  + +YSF ++     GR+VV+ DD+ILPLPK 
Sbjct: 1053 ILSLFPSNPTENDDNSAISTLRSFITDYSFDTQV-VAPGRRVVFHDDKILPLPKA 1106

 Score = 93.6 bits (231), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 100/194 (51%), Gaps = 21/194 (10%)

Query: 85  YKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILNYLFDTKRK 144
           Y P++ENL+  L DE   L  ++I+    F ++ E L +  FTTKSG+SIL  +  +  K
Sbjct: 45  YTPSVENLEKLLYDETI-LNDQEIR----FPLLFEALSVTLFTTKSGKSILQTMKASTSK 99

Query: 145 PPTVQNKILR----------KTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIK 194
                 K             ++W+ ++ L   F+ F++ NK   + ID++N P+ KL + 
Sbjct: 100 ERKAWEKSFENHDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLS 159

Query: 195 FLLTFHPLSNIETPSIILDSNYNMLTDYLDATSNWLILLI--KMTILNVGPFFYNTIIRY 252
           FL+    +S +  PSIIL+  YNML DYL A S  +  LI    T       F  T+ +Y
Sbjct: 160 FLI----VSKVNLPSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQY 215

Query: 253 NRIPQFNGHFQWYT 266
           +R+ +F   + WY+
Sbjct: 216 DRMIEFRNFYFWYS 229

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/896 (43%), Positives = 547/896 (61%), Gaps = 102/896 (11%)

Query: 394  EEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVDP 453
            +E++YSF+L+ DG++ +P N+M ++  RH++L K+LN  S   +PLLELQF  + GLVDP
Sbjct: 283  QEQIYSFELDQDGTLQIP-NIMEHSLMRHELLFKILNLPSV-LTPLLELQFCNLCGLVDP 340

Query: 454  LSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQ-NNLGFNWKTHVCFQMVKIINNCMEKL 512
            L QP PND+ +IS+D L+QLF+ ++YP+ +  Q +N  ++WK + CF M KII+  M +L
Sbjct: 341  LMQPSPNDEQVISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRL 400

Query: 513  NCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLNTQ 572
            NC+D ++L  +      NN + ++                   +WR+ L +WLPHGLNTQ
Sbjct: 401  NCSDFERLNSV------NNTDSVI-------------------HWRTQLHKWLPHGLNTQ 435

Query: 573  DLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHET 632
            DLELLYM+ ILA YT+ KL  +IPIQLNPFL +L++LWK L+ +++L L+IDR EE + T
Sbjct: 436  DLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEENGT 495

Query: 633  YKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCD 692
            Y+TPL+V+ATIRGA+ALRSV+A++LN  ++ NDHDFKHE+LNTFMSP+GRKLC+GALY D
Sbjct: 496  YETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYAD 555

Query: 693  IKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKT 752
            ++   ASL ALG  + ++ +L + L+ GDRFDEDI YMF+YE +DYN    E+ ++    
Sbjct: 556  LRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNEPFSESDDE---- 611

Query: 753  LKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILXXXXXXXXXXXXXXXXXXXXTPKNV 812
              + D NS   + +      YQRRCNCIF DDK++                     P NV
Sbjct: 612  QLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISGNSNMENEMPNNV 671

Query: 813  --------------ASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSY 858
                          AS  +PL       +VRS++TFEFDYSG+DWRD+P+ FN+YYS SY
Sbjct: 672  NVIPSTATTNSNRFASSINPL-------SVRSRSTFEFDYSGEDWRDVPKDFNMYYSPSY 724

Query: 859  SFIDDSSLDTMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKDQLHS 918
            SFI +  LD + NLT + +T+KLN DDSI      AS +K EQ+ MI+ DL     ++  
Sbjct: 725  SFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNFAEIDE 784

Query: 919  N----IINPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMC 974
            N      N +  +  E+ R T   TPDDI++ W ++  F  ML+ N +++WRLMDEMLMC
Sbjct: 785  NPEAKSSNNITKTNNEELRRT---TPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMC 841

Query: 975  NGYRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPF---ANNNECKNELLHELMLGK-KI 1030
             GYRR+LIW++TH++L HSLI Y+FEL+MGLRG PF   A++ + K+++++E++  K K 
Sbjct: 842  TGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRKN 901

Query: 1031 VDNHTYPFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTXXXXXXX 1090
             D    PFSRQGP++LSDIETKMLLQEFF NAAI+  +     E +   +          
Sbjct: 902  EDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNDEEENEDGEK---------- 951

Query: 1091 XXXXXXXXHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIXXXX 1150
                      +S+YS+GL+KLIC MV +LI N KF FTKS+C FELQTLLM WIG+    
Sbjct: 952  ----------ISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEA 1001

Query: 1151 XXXXXXXXSDIXXXXXXXXXXXXXXXXXXXXRKSSESNGKWEGSR---IGKMNDFNKRLL 1207
                    + +                     + ++ N   E  R       ++ N +LL
Sbjct: 1002 KDLFFQIKTRLAMEEDSDKDG-----------QQNDDNKDLEVERRPHTKSNSELNVKLL 1050

Query: 1208 RLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPKV 1263
             L     +G+ D   ++  +  R  + +Y F ++     GRKVV+ D +ILPL K 
Sbjct: 1051 NLFPSNPAGNND---NSAISTLRSFITDYPFDTQITP-PGRKVVFYDGKILPLSKA 1102

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 109/198 (55%), Gaps = 21/198 (10%)

Query: 81  KFKIYKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILNYLFD 140
           K K Y P++ENL+  L +E   L+ +KI+     SI+ E L I  FTTKSG+SIL  +  
Sbjct: 39  KDKNYVPSLENLEKLLYNESI-LDDQKIR----LSILFEALSIILFTTKSGKSILQAVQA 93

Query: 141 TKRKPPTVQNKILR----------KTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENK 190
           +  K   +  + LR          + W+ N+ L+  F+ FL+ NK   + IDK+N PE K
Sbjct: 94  STLKEKKLWAQSLRDDDSNYASVVQGWKDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYK 153

Query: 191 LSIKFLLTFHPLSNIETPSIILDSNYNMLTDYLDATSNWLILLIKM-TILNVGPFFYNTI 249
           L + FL+    +S I  PSIIL+  +NML DYL + S  +  LI+  +I +        I
Sbjct: 154 LPLSFLI----VSKINFPSIILNEGHNMLKDYLYSMSGRIDCLIRGNSITSRSALVVKKI 209

Query: 250 IR-YNRIPQFNGHFQWYT 266
           ++ Y+RI +F+  + WY+
Sbjct: 210 LKDYDRIVEFHNLYFWYS 227

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/902 (42%), Positives = 544/902 (60%), Gaps = 112/902 (12%)

Query: 394  EEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVDP 453
            +E++YSF+LN DG++ +P N+M ++  RH++L K+LN  +   +PLLELQF  + GLVDP
Sbjct: 280  QEQIYSFELNQDGTLEIP-NVMEHSLLRHELLFKILNLTTV-LTPLLELQFSTLCGLVDP 337

Query: 454  LSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQ-NNLGFNWKTHVCFQMVKIINNCMEKL 512
            L QP PNDKHIIS+D L+QLF+ ++  + +  Q +N  ++WK ++CF M KII+  M +L
Sbjct: 338  LMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRL 397

Query: 513  NCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLNTQ 572
            NC      +D       NN                 TD  V  +W++ L +WLPHGLNTQ
Sbjct: 398  NC------FDFDILNSVNN-----------------TDNAV--HWKTQLHRWLPHGLNTQ 432

Query: 573  DLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHET 632
            DLELLYM+ ILA YT+ KL  +IPIQLNPFL +LI+LWK L+ +++L L+IDR EE + T
Sbjct: 433  DLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGT 492

Query: 633  YKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCD 692
            Y+TPL+V+ATIRGA+ALRSV+AT+LN  ++ NDHDFKHE+LNTFMSP+GRKLC+GALY D
Sbjct: 493  YETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYAD 552

Query: 693  IKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKE-NHEDLGK 751
            ++   ASL ALG  + ++ +L + L+ GDRFDEDI YMF+YE +DY+ +  E +H  L +
Sbjct: 553  LRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDESFSESDHGGLDE 612

Query: 752  TL-----KSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILXXXXXXXXXXXX------- 799
            ++     K    +++++         ++RRCNCIF DDK++                   
Sbjct: 613  SVVNPTEKIASGSNNVF---------FRRRCNCIFNDDKLVAEDGANEAFGSTNSENVEG 663

Query: 800  -------XXXXXXXXTPKNVASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNI 852
                           T  +V +  +PL       +VRS++TFEFDYSG+DWRD+PR FN+
Sbjct: 664  AMHNNRNAVHNATTATSDHVVTSPNPL-------SVRSRSTFEFDYSGEDWRDVPRDFNM 716

Query: 853  YYSTSYSFIDDSSLDTMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKG 912
            YYS SYSFI +  LD + +LT + +T+KLN ++SI      AS ++ EQ+ MI+ DL   
Sbjct: 717  YYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADL--- 773

Query: 913  KDQLHSNIINPLVNSKEEKERSTV------VATPDDIFDYWFDKDVFVEMLHFNEELSWR 966
             +   S  IN  V  +   + S +        TPDDI++ W ++  F  ML+ N +++WR
Sbjct: 774  -ESNFSASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWR 832

Query: 967  LMDEMLMCNGYRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPF---ANNNECKNELLHE 1023
            LMDEMLMC GYRR+LIW++TH++L HSLI Y+FEL+MGLRG PF   A++ + K+++++E
Sbjct: 833  LMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYE 892

Query: 1024 LMLGK-KIVDNHTYPFSRQGPLILSDIETKMLLQEFFSNAAIYFDND-LATNEGDGQLEH 1081
            ++  K K  D    PFSRQGP++LSDIETKMLLQEFF NAAI+  +        DG+   
Sbjct: 893  ILKKKQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNNEEENEDGE--- 949

Query: 1082 TTXXXXXXXXXXXXXXXHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLM 1141
                               +S+YS+GL++LIC MV +LI N KF FTKS+C FELQTLLM
Sbjct: 950  ------------------KISLYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLM 991

Query: 1142 NWIGIXXXXXXXXXXXXSDIXXXXXXXXXXXXXXXXXXXXRKSSESNGKWEGSRIGKMND 1201
             WIGI            + +                    RK+S+   K       ++N 
Sbjct: 992  TWIGILPEAKDLFFKIKTRL-----AMEEEDSADTMQHEGRKNSDIEKKLNAKPASELN- 1045

Query: 1202 FNKRLLRLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLP 1261
                 L+LL    S   + +  +     R  + +YSF ++     GR+VV+ D +ILPLP
Sbjct: 1046 -----LKLLNLFPSKPANKDDSSPINTLRSFIADYSFDTQVNP-PGRRVVFYDGKILPLP 1099

Query: 1262 KV 1263
            K 
Sbjct: 1100 KA 1101

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 107/211 (50%), Gaps = 28/211 (13%)

Query: 68  PMSELIPTIFTNHKFKIYKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFT 127
           P+ EL+       K K Y P++ENL+  L +E  F + +        +++LE L+I  FT
Sbjct: 33  PLQELL-------KDKNYVPSVENLEKILYNETMFNDQKICS-----NLLLEALIITLFT 80

Query: 128 TKSGQSIL-----NYLFDTKRKPPTVQN-----KILRKTWEVNEFLYFCFIDFLIRNKNN 177
           T SG+S L     + L + K    + +N       +  +W+ N+ L   F+ FL+ NK  
Sbjct: 81  TISGKSALRLIQTSSLKERKSWAQSFENNSSSYASIVLSWKDNDILLLKFLRFLLANKTA 140

Query: 178 EINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNMLTDYLDATSNWLILLIKM- 236
            + I+++N PE KL + FL+    +S I  PSI+L+  YN+L DYL + +  +  LI   
Sbjct: 141 PLQINRYNLPEYKLPLSFLI----VSKITIPSILLNETYNLLKDYLYSITGRIESLISCS 196

Query: 237 TILNVGPFFYNTIIR-YNRIPQFNGHFQWYT 266
           +  +        I++ YNR+ +    + WY+
Sbjct: 197 STFDKPALVVRKILKDYNRMIECRNFYFWYS 227

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/896 (43%), Positives = 542/896 (60%), Gaps = 100/896 (11%)

Query: 394  EEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVDP 453
            +E++YSF+LN+DG++ +P N+M ++  RH++L K+LN     S+PLLELQF  + GLVDP
Sbjct: 282  QEQIYSFELNHDGTLEIP-NVMKHSLLRHELLFKILNLTPV-STPLLELQFSTLCGLVDP 339

Query: 454  LSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQ-NNLGFNWKTHVCFQMVKIINNCMEKL 512
            L QP PNDKHIIS+D L++LF+ ++YP  +  Q +N  ++WK + CF M KII+  M +L
Sbjct: 340  LMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRL 399

Query: 513  NCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLNTQ 572
            NC      +D       NN                 TD  V  +WR+ L +WLPHGLNTQ
Sbjct: 400  NC------FDFNILNSVNN-----------------TDSSV--HWRTQLHRWLPHGLNTQ 434

Query: 573  DLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHET 632
            DLELLYM+ ILA YT+ KL  ++PIQLNPFL +LI+LWK L+ +++L L+IDR EE + T
Sbjct: 435  DLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGT 494

Query: 633  YKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCD 692
            Y+TPL+V+ATIRGA+ALRSV+ATILN  ++ N+HDFKHE+LNTFMSP+GRKL +GALY D
Sbjct: 495  YETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYAD 554

Query: 693  IKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHED---- 748
            ++  +ASL A G  + ++ +L + L+ GDRFDEDI YMF+YE  DY+ +  E+ ++    
Sbjct: 555  LRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYDESFSESDDEGLEE 614

Query: 749  ----LGKTLKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILXXXXXXXXXXXXXXXXX 804
                  + +KS++DN +++          QRRCNCIF DDK++                 
Sbjct: 615  GIVNAREKIKSSNDN-NVFC---------QRRCNCIFNDDKLVAEDGLNEVFESTCNRNG 664

Query: 805  XXXTPKNV-------ASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTS 857
                  N+        +  + +      ++VR+++TFEFDYSG+DWRD+PR FN+YYS S
Sbjct: 665  ERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPS 724

Query: 858  YSFIDDSSLDTMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDL---LKGKD 914
            Y FI D  LD + NLT + +T+KLN ++SI      AS +K EQ+ M++ DL   L G  
Sbjct: 725  YPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNLTGIS 784

Query: 915  QLHSNIINPLVNSKEEKE--RSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEML 972
            + H+   N    SK + E  R T   TPDDI++ W ++  F  ML+ N +++WRLMDEML
Sbjct: 785  K-HAEGENSTSISKTDNEELRRT---TPDDIYEIWSEESAFERMLNVNHDVAWRLMDEML 840

Query: 973  MCNGYRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPF---ANNNECKNELLHELMLGK- 1028
            MC GYRR+LIW+ TH++L HSLI Y+FEL+MGLRG  F   A++ + K+++++E++  K 
Sbjct: 841  MCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQ 900

Query: 1029 KIVDNHTYPFSRQGPLILSDIETKMLLQEFFSNAAIYF-DNDLATNEGDGQLEHTTXXXX 1087
            K  D  + PFSRQGP+ILSDIETKMLLQEFF NAAI+   N+      DG+         
Sbjct: 901  KNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLSSNNSEEENEDGE--------- 951

Query: 1088 XXXXXXXXXXXHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIX 1147
                         +S+YS+GL++LIC MV +LI N KF FTKS+C FELQTLLM WIGI 
Sbjct: 952  ------------KISLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGIL 999

Query: 1148 XXXXXXXXXXXSDIXXXXXXXXXXXXXXXXXXXXRKSSESNGKWEGSRIGKMNDFNKRLL 1207
                       + +                    R+S +   K       K        L
Sbjct: 1000 PEAKDLFFEIKTRL-----AMEEDNDTGTMQHEGRRSLDIEKKLN----TKPASKLNLKL 1050

Query: 1208 RLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPKV 1263
              L P +S D   NS   T   R  + +YSF ++     GRKVV+ D +ILPL K 
Sbjct: 1051 LSLFPSNSADNGENSAINT--LRNFITDYSFDTQVNP-PGRKVVFYDGKILPLTKA 1103

 Score = 88.2 bits (217), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 108/212 (50%), Gaps = 28/212 (13%)

Query: 66  LTPMSELIPTIFTNHKFKIYKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAY 125
             P+ EL+       K K Y P++ENL+  L DE     M   +KV+ FS++ E L I  
Sbjct: 31  FVPLQELL-------KDKNYVPSVENLEKVLCDE----TMLNDQKVR-FSLLFEALAITL 78

Query: 126 FTTKSGQSILNYL--FDTKRKPPTVQN--------KILRKTWEVNEFLYFCFIDFLIRNK 175
           FTT SG+SIL  +  F +K++    Q+          +  +W+ N+ L   F+ FL+ NK
Sbjct: 79  FTTNSGKSILQSIQTFTSKKRKLWAQSFENNNSNYASIVFSWKDNDILLLKFVRFLLANK 138

Query: 176 NNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNMLTDYLDATSNWL--ILL 233
              + ID++N PE+KL + FL+    +S I  PSI+L+  YN+L DYL + +  +  +L+
Sbjct: 139 TMPLKIDRYNLPEHKLPLSFLI----VSKINIPSILLNEGYNLLKDYLYSITGRIEELLM 194

Query: 234 IKMTILNVGPFFYNTIIRYNRIPQFNGHFQWY 265
                         T+  Y+R+ +    + WY
Sbjct: 195 CSPKFNQPALVVKRTLKDYDRMIECENCYCWY 226

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/880 (43%), Positives = 543/880 (61%), Gaps = 128/880 (14%)

Query: 397  VYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVDPLSQ 456
            ++SFDLN  G +    NL+ +++ RHQI+  +LN N  DS P L+ QF L+ GLVDPL+Q
Sbjct: 270  IFSFDLNETGDLP---NLIKHSEMRHQIIYDILNLNQIDS-PFLKKQFLLICGLVDPLTQ 325

Query: 457  PPPNDKHIISLDLLYQLFIAILYPNFEIFQNN--LGFNWKTH---VCFQMVKIINNCMEK 511
            P PN++HIIS+DL+YQLF+ ++Y     F NN   G + +     +CF M KII+  +  
Sbjct: 326  PQPNNEHIISIDLIYQLFMGLMYK----FNNNELAGKDKELQHFTICFNMQKIISRSLVL 381

Query: 512  LNCNDLQKLYD-LTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLN 570
            LNCND   L   L  F  +                           +++ L +WLPHG+N
Sbjct: 382  LNCNDYDTLSTILNDFPND---------------------------YKTALNKWLPHGIN 414

Query: 571  TQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAH 630
            TQDLEL+YM+ I+A YT+ KL   +PIQLNPFL TL++LWK L+ ++++GL+IDR EE++
Sbjct: 415  TQDLELIYMINIIAIYTIYKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESN 474

Query: 631  ETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALY 690
            ETY TP++V+ATIRGA+ALR+V+ATILN+++   +HDFKHE+ NTFMSPHGRKLC+GAL 
Sbjct: 475  ETYDTPIIVRATIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALL 534

Query: 691  CDIKLFAASLYALG-MDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDL 749
             D++  AA++ ALG  +L ++  LL+ L+ GDRFDED+ Y+FEYEY DYN   +E+ +  
Sbjct: 535  ADLRSHAAAILALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNELGEEDEQ-- 592

Query: 750  GKTLKSNDDNSDIYVLNEV-KLDRYQRRCNCIFEDDKILXXXXXXXXXXXXXXXXXXXXT 808
                 +N+       L E+ K    +RRCNCIFEDDK+L                    +
Sbjct: 593  -----TNE-------LEELEKRSVKKRRCNCIFEDDKMLEDYEYYEVGNESRREDMNLES 640

Query: 809  PKNVASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLDT 868
             K+          R   Y+VR  + FEFDYSGKDWRD+PRGFN+YYS SY FI +  L T
Sbjct: 641  DKS----------RTNPYSVRVNSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGT 690

Query: 869  MINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKDQLHSNIINPLVNSK 928
            +++ T KA+T+KL+ +DS+      AS +K EQ  MI+++        +SN  N   +++
Sbjct: 691  VLHFTLKATTEKLSDEDSLLLLQSVASCVKLEQEKMILEN--------YSNTKN--CSTE 740

Query: 929  EEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIWYITHM 988
            E+ +R     TPDD+++ W ++  F  M++ N+E++WRLMDEMLMCNGYRRVL+W+ITHM
Sbjct: 741  EDLDRE---VTPDDVYEIWCEESAFERMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHM 797

Query: 989  KLNHSLIQYIFELLMGLRG----SPFANNNECKNELLHELMLGKKIVDNHTYPFSRQGPL 1044
            ++NHSL+ YIFEL+MGLRG    S    ++  K+ LL ++M  KK   +   PFSRQG +
Sbjct: 798  EINHSLVHYIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMMTDKK--GSEKVPFSRQGSI 855

Query: 1045 ILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTXXXXXXXXXXXXXXXHGVSMY 1104
            ILS+IETKMLLQEFF+NAAI+F  +   N      E+                   VS+Y
Sbjct: 856  ILSEIETKMLLQEFFTNAAIFFSTNDTANMSSNDSEN-------------------VSLY 896

Query: 1105 SMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIXXXXXXXXXXXXSDIXXX 1164
            ++GL+KLIC MV +L+ N KFDF+KS+C FELQTLLMNWIGI            +++   
Sbjct: 897  AIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANV--- 953

Query: 1165 XXXXXXXXXXXXXXXXXRKSSESNGKWEGSRIGKMNDFNKRLLRLL-APIHSGDTDLNSD 1223
                                S+S+G    S  G+++ +N +LL LL +P +SG   L + 
Sbjct: 954  ------------GEPSMEGKSDSDGT--DSNEGELSWYNSKLLALLPSPTNSG---LENP 996

Query: 1224 TVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPKV 1263
             + T  R  LK YSFT+K   V GRKV+Y DD+ILP+PK+
Sbjct: 997  AIET-LRSFLKKYSFTNKV-PVVGRKVIYKDDKILPIPKL 1034

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 86/169 (50%), Gaps = 23/169 (13%)

Query: 115 SIMLETLVIAYFTTKSGQSILNYLFDTKRKPPTVQN--------------KILR-KTWEV 159
           S++LE LVI+ FTTKSG SIL+ L +        Q               K L+ + W+ 
Sbjct: 51  SVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLESSSGDLNYKYLKHELWQS 110

Query: 160 NEFLYFC-FIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDS-NYN 217
           N   Y   F  FL++N+    +++ ++  + KL ++ L+     SNI   S+IL+S NYN
Sbjct: 111 NRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRLINSE--SNI--ISLILNSDNYN 166

Query: 218 MLTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYT 266
           +L D++     ++  LI   +   G  F+  I +YNRI + NG   WYT
Sbjct: 167 LLLDFIMFFQPYMNDLISYIV--EGNKFFEIIAKYNRIYELNGFHTWYT 213

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1189 (36%), Positives = 631/1189 (53%), Gaps = 165/1189 (13%)

Query: 108  IKKVKKF--SIMLETLVIAYFTTKSGQSILNYLFDTK---------------RKPPTVQN 150
            I  V++F  +++ E L+++ F T  G SIL   +D                 +   T   
Sbjct: 38   IPHVEEFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGY 97

Query: 151  KILRKTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSI 210
            K L K W  +  +   F D L++NKN  +   K N  E KLS+ FLL      + +   +
Sbjct: 98   KKLVKRWSTSTLVLLRFTDLLLQNKNVPLEYTKHNTAEYKLSLIFLL------DKQNEFL 151

Query: 211  ILDSNYNMLTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYTSLPN 270
            ILD +YN+L DYL        ++  + + N+       + +YN++P+FNG   WYT    
Sbjct: 152  ILDPDYNLLLDYLLHAKP---MIESILLGNIPGLLKALVYQYNKLPEFNGCHTWYT---- 204

Query: 271  DKPLYIKEXXXXXXXXXXXKILSSESFIEIITRSNHDFEDDKSFKMSKTSKPVVL-WAIE 329
                               + +  + FI +  +          F  SK   P +  W +E
Sbjct: 205  -----------FRTHYHGTQEIFHKFFIALTDK----------FTASKEIMPELEGWFVE 243

Query: 330  EILSRLSFKDSSRYKKNNINGNGQNYPQMERAQNQSDINYLNRNDGADEYDDDYLHRIDD 389
              +SR    DS   K       G +Y                 +   D++++DY  +   
Sbjct: 244  GPVSR----DSGCIKPIT----GDDY---------------TSSAAIDDFNEDYWTQ--Q 278

Query: 390  LKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLG 449
              + +E+VYSF+LN DG++ +P N+  +TK+RH  L K+L  N  D +PLL+  F     
Sbjct: 279  KTNTQEQVYSFELNEDGTLEIP-NVFAHTKRRHDALYKVLGLND-DPTPLLKSCFLTFCC 336

Query: 450  LVDPLSQPPPNDKHIISLDLLYQLFIAILYPNF--EIFQNNLGFNWKTHVCFQMVKIINN 507
            L DP++QPPPNDKHI+SLDLL  +F+ ++YP    ++ Q      W  H+CF + KIIN 
Sbjct: 337  LADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQKIINA 396

Query: 508  CMEKLNCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPH 567
             + +LNC+D  +L ++      NN ++ +                   +WR  L +WLP 
Sbjct: 397  TLSRLNCDDFTRLNEI------NNSDDSV-------------------DWRKNLYKWLPQ 431

Query: 568  GLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSE 627
            GLNTQDLEL+YMV ILA+YT+ KL    PIQ+NPFL  +I+LWK LT +++LGL+IDR E
Sbjct: 432  GLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLE 491

Query: 628  EAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNG 687
            E  ET+ TP++V+ATIRGASALRSV+ATI+N +  Y  HDFKHE +N FMSPHGRKLCNG
Sbjct: 492  EEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNG 551

Query: 688  ALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHE 747
            ALY D++  AA++ ALG++L  + +LLS L+PGDRFDED+ YMF+YE+DDYN    E   
Sbjct: 552  ALYADLRSHAATMLALGIELETLTDLLSDLQPGDRFDEDVKYMFDYEFDDYNEVDTE--- 608

Query: 748  DLGKTLKSNDDNSDIYVLNEVKLDR-YQRRCNCIFEDDKILXXXXXXXXXXXXXXXXXXX 806
                 L ++D+  DI     +K  R Y +RC+C+F+DD ++                   
Sbjct: 609  -----LMADDELEDIESRERIKEVRGYYKRCHCVFDDDSLV-----PENEDGGGEEGDQE 658

Query: 807  XTPKNVA-SFQDPL-GKRNL-------DYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTS 857
             T K++  S +D L  ++N+         AVRS+ T EFD++G+DWRDIPRG N YY+ +
Sbjct: 659  DTKKHLQDSHEDQLPPQQNVVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDA 718

Query: 858  YSFIDDSSLDTMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKDQLH 917
            Y F+     D +  L  +A+ +KL  + +       A+ +K EQ + I++  L  +D   
Sbjct: 719  YIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGDK 778

Query: 918  SNIINPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGY 977
            S+    +    E         T D I++ W +  +F +M++ N +L WR+MDEMLMC+GY
Sbjct: 779  SSNATTIKTENE--------LTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGY 830

Query: 978  RRVLIWYITHMKLNHSLIQYIFELLMGLRGSPFANNNECKNELLHEL--MLGKKIVDNHT 1035
            RRVLIW+ITH+++NHS+I YIFEL+MGLRG+    ++E K++ L  L  +         T
Sbjct: 831  RRVLIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELT 890

Query: 1036 YPFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTXXXXXXXXXXXX 1095
             PFSRQGP+ILS IE  MLLQEFF+NAAI+F + L         E               
Sbjct: 891  LPFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLR--------ESFDSENEELDENFED 942

Query: 1096 XXXHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIXXXXXXXXX 1155
                 V  + +GLMKL+C MV +L++ KKFDFT S+  FELQTLLMNWIGI         
Sbjct: 943  EDEFSVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFF 1002

Query: 1156 XXXSDIXXXXXXXXXXXXXXXXXXXXRKSSESNGKWEGSRIGKMND----FNKRLLRLLA 1211
               S I                     K SE +   +     +MND     NK+L+ L+ 
Sbjct: 1003 KLKSQIVATSQDTQEQGTPV-------KESEKD-DIDAPDTLEMNDTMSEHNKKLMMLIP 1054

Query: 1212 PIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPL 1260
            P   G T  N     T  RG +  YS T+K   V GRK++Y DDEI+ +
Sbjct: 1055 P---GTT--NERNALTALRGFIGKYSLTNK-TAVFGRKIIYQDDEIMGM 1097

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/921 (43%), Positives = 531/921 (57%), Gaps = 103/921 (11%)

Query: 355  YPQMERAQNQSDINYLNRNDGADEYDDDYLHRIDDLKDGEEKVYSFDLNNDGSITMPENL 414
            Y +M R  N+  IN     D A      Y HRI       E VYSFD+N DGS+ +P N+
Sbjct: 219  YHEMVRPSNERAIN-----DTAS-----YHHRISQ----HENVYSFDINQDGSLEIP-NI 263

Query: 415  MLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVDPLSQPPPNDKHIISLDLLYQLF 474
            M +   RH IL  L+     DS PLL+ QFKLM GLVDPL+QPPPNDKHIISLDLLYQ+ 
Sbjct: 264  MSHASVRHDILQNLMRLPLCDS-PLLQWQFKLMAGLVDPLTQPPPNDKHIISLDLLYQML 322

Query: 475  IAILYPNFEIFQNNLGFNWKTHVCFQMVKIINNCMEKLNCNDLQKLYDLTGFQGENNKEE 534
            + ++ P       + G +WK H+CF M KII   +++LN  D   L  +      NN +E
Sbjct: 323  LGLMEPAISNTLGSDGCDWKFHLCFNMQKIIQASLKRLNLQDFDTLNSI------NNSDE 376

Query: 535  LLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLNTQDLELLYMVMILASYTLQKLNHE 594
                               D +WR  L  WLPHGLNTQ+LEL+YM+ ILA YT+ KL  +
Sbjct: 377  -------------------DVSWRDNLHSWLPHGLNTQNLELIYMIDILAVYTIYKLYED 417

Query: 595  IPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHETYKTPLLVKATIRGASALRSVVA 654
            +P+QLNPFL  +I+LWK LT +++LGL+IDR EE HET++TP+LV+ATIRGA+ALR+VVA
Sbjct: 418  LPVQLNPFLSPMISLWKNLTCVILLGLEIDRFEEEHETFETPVLVRATIRGAAALRAVVA 477

Query: 655  TILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCDIKLFAASLYALGMDLIEIRNLL 714
            TILN +++   HDF HE LNTFMSPHGRKLC GALY D++  AA+L ALG +L ++ NLL
Sbjct: 478  TILNGHVDTYKHDFMHEPLNTFMSPHGRKLCQGALYADLRSHAAALLALGTELEDVTNLL 537

Query: 715  SYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKTLKSNDDNSDIYVLNEVKLDRYQ 774
            + L+ GDRFDED+ YMFEYE D+YN    E+ +D GK             + + K+   Q
Sbjct: 538  ADLQAGDRFDEDVRYMFEYECDNYNEGDSESEKD-GK-----------LAVEQPKI--LQ 583

Query: 775  RRCNCIFEDDKILXXXXXXXXXXXXXXXXXXXXTPKNVASFQDPLGKRNLDYAVRSKTTF 834
            RRCNCIF+DD++                           S    +       AVRS   F
Sbjct: 584  RRCNCIFDDDEMAEDEDFDGENDEAFFSKHLILQQNAQTSLS--MSSSGKPRAVRSGGAF 641

Query: 835  EFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLDTMINLTSKASTQKLNHDDSIXXXXXXA 894
            EFDYSGKDWRDIPRG N YYS  + FI+  SL +++ LT KAS++KL   +S+      A
Sbjct: 642  EFDYSGKDWRDIPRGSNFYYSPDFEFIESPSLSSLLALTKKASSEKLVEKESLTLLRSVA 701

Query: 895  SSIKEEQNDMIMKDLLKGKDQLHSNIINPLVNSK-EEKERSTVVATPDDIFDYWFDKDVF 953
            S +K EQ+++ +            N+I+P  +S+ +E+ R+     PDDI++ W +   F
Sbjct: 702  SCVKNEQDEITL-----------GNLIDPHQDSQADEESRNADKIEPDDIYEMWCENSTF 750

Query: 954  VEMLHFNEELSWRLMDEMLMCNGYRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPFANN 1013
             ++++FN  L+W+LMDEML+C GYRRVLIW+ITHM+LNHSLI YIFEL+MGLRG+   N+
Sbjct: 751  EKIVYFNHTLAWKLMDEMLLCIGYRRVLIWFITHMELNHSLIHYIFELVMGLRGNSDEND 810

Query: 1014 NEC--KNELLHELMLGKKIVDNHTYPFSRQGPLILSDIETKMLLQEFFSNAAIYF----- 1066
             +       L ++    K+    +  FSRQG L LS IETKMLLQEFF+NAAI+      
Sbjct: 811  RDVDLAGPPLQDV---DKVKGELSVGFSRQGALQLSTIETKMLLQEFFTNAAIFISKKSE 867

Query: 1067 -DNDLATNEGDGQLEHTTXXXXXXXXXXXXXXXHGVSMYSMGLMKLICIMVSSLIENKKF 1125
               D+A  E + +                      VS+Y+MGLMKLIC MV + I  +KF
Sbjct: 868  ESTDIANEEQNNE------------NRDLNGNSENVSLYAMGLMKLICFMVRTFINKEKF 915

Query: 1126 DFTKSDCNFELQTLLMNWIGIXXXXXXXXXXXXSDIXXXXXXXXXXXXXXXXXXXXRKSS 1185
            DF++S+C FELQ LLMNWIGI            S I                    +  +
Sbjct: 916  DFSESECVFELQALLMNWIGIIPEAKTLFFELKSLI---AGFSTATSVQEQKNAEVKNDT 972

Query: 1186 ESNGKWEGSRIGKMN----DFNKRLLRLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSK 1241
            + +   E S +   N    +FN++L+ LL P+     +   +      R  +K  SF + 
Sbjct: 973  QEDVPKEQSPVRVSNTAGFEFNRKLMTLLPPLVKNKEE---NAAMQTLRSFIKTSSFLNT 1029

Query: 1242 PKKVAGRKVVYTDDEILPLPK 1262
               V GRK+VY DD+ILPLPK
Sbjct: 1030 -VPVIGRKIVYEDDKILPLPK 1049

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 90/180 (50%), Gaps = 12/180 (6%)

Query: 91  NLQDFLEDEHFFLEMRKIKKVK----KFSIMLETLVIAYFTTKSGQSILNYLFDTKRKPP 146
           NLQ     E     +R+ K +K    + S++ ETL+IA FTT++G S+L  LF    K  
Sbjct: 20  NLQPLKGVEGLAEALREEKVLKNDQWRPSLICETLIIALFTTRAGISLLP-LFSESAKRK 78

Query: 147 TVQNKILRKTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIE 206
            V  ++L   W  +E L   F  +++ N+++ I    F +   KL + FL+     S   
Sbjct: 79  RVGPRVLE--WHNDEELMLRFFSYILENRSSRIEPRLFEKARWKLPLFFLIE----SKFL 132

Query: 207 TPSIILDSNYNMLTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYT 266
             S++LD NYN+L DY+   +  +   +       G FF +T++ YNR+ +     +WY+
Sbjct: 133 AASMVLDQNYNLLLDYVHTITPMIKRWVHRAFTQ-GTFFKDTVVCYNRVYELKDSSEWYS 191

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/882 (41%), Positives = 497/882 (56%), Gaps = 107/882 (12%)

Query: 395  EKVYSFDL-----NNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLG 449
            E VY FDL     N  G+ T+  +LM  + +RH+IL ++LN    DS  L E QFK M+ 
Sbjct: 225  EHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYE-QFKCMIS 283

Query: 450  LVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTHVCFQMVKIINNCM 509
            LVDPL+QPPP+D +++SLDLLY+LF+A L  N +  QN+        +CF M KII   +
Sbjct: 284  LVDPLTQPPPSDTYVVSLDLLYKLFLAFLPKNQDTEQNDTFL-----LCFNMQKIITRTL 338

Query: 510  EKLNCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGL 569
             +L C D  KL  ++  Q E +  +                     N+R  L++W+P+GL
Sbjct: 339  WRLKCWDYAKLTSISKKQTEGDNSQY--------------------NYRDHLKEWVPNGL 378

Query: 570  NTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEA 629
            NTQDLELLYMV I+A YT+      +PIQLNPFL  LI+LWK L+ +L+L L++DR EEA
Sbjct: 379  NTQDLELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEA 438

Query: 630  HETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGAL 689
            ++T+ TPLLV+ATIRGASALR+VVA +LN ++  N+HDFKHE LNTFMSPHGRKLC G+L
Sbjct: 439  NDTFDTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSL 498

Query: 690  YCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAA--LKENHE 747
            Y D++  AA++ +LG+DL ++  LLS L+PGDRFDEDI YMFEYEY+DYN      E+ +
Sbjct: 499  YADLRSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDED 558

Query: 748  DLGKTLKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILXXXXXXXXXXXXXXXXXXXX 807
                   +    + I   NE      +RRCNCIF DDKI+                    
Sbjct: 559  AAAAATTATASAAAITAANEGTGASQKRRCNCIFTDDKIIQSDESKVSLG---------- 608

Query: 808  TPKNVASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLD 867
                        G +N  Y+VR+K++FEFDYSG DWRD+PRG N+Y+  SY F+    L 
Sbjct: 609  ------------GGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLA 656

Query: 868  TMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKDQLHSNIINPLVNS 927
               N++SKA+  KLN  +S       AS+IK EQ  +IM  +    + +           
Sbjct: 657  EFRNVSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVG-------- 708

Query: 928  KEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIWYITH 987
                     + TPD+I+D WF   VF  +L  N+EL+W+LMDE+LMC+GYRRVL+W++TH
Sbjct: 709  ------DDGLLTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTH 762

Query: 988  MKLNHSLIQYIFELLMGLRGSPFANN---NECKNELLHELMLGKKIVDNHTYPFSRQGPL 1044
            M+LNHS+I YIFEL+MGLRG   + +    E + + LH LM      +  T  FSRQG L
Sbjct: 763  MELNHSVIHYIFELVMGLRGQELSADVTLEEQRKQALHNLM-EIDTPNGGTLMFSRQGNL 821

Query: 1045 ILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTXXXXXXXXXXXXXXXHGVSMY 1104
             LS+IE KMLLQEFF+NAAI+     +        +                    VS+Y
Sbjct: 822  ALSEIEVKMLLQEFFTNAAIFLSASESEEPESETSD--------------------VSLY 861

Query: 1105 SMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIXXXXXXXXXXXXSDIXXX 1164
            S+GL+KLIC MV +LI N KF+F+KS+C FELQTLLMNW+GI             +I   
Sbjct: 862  SIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNISDT 921

Query: 1165 XXXXXXXXXXXXXXX-------XXRKSSESNGKWEGSRIGKMNDFNKRLLRLLAPIHSGD 1217
                                        ++N   E      +++FNK+L+ LL P  +  
Sbjct: 922  KTATTTTTTTSALGAPGDIFPTLTDADDDNNAVAE-----NLSEFNKKLVMLL-PRATQS 975

Query: 1218 TDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILP 1259
                S       R  ++ +S +S+   V GR++V    +ILP
Sbjct: 976  EGKGSSQAIDALRNFMRKHSLSSE-IPVLGRRIVRRGSQILP 1016

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 78/166 (46%), Gaps = 18/166 (10%)

Query: 110 KVKKFSIMLETLVIAYFTTKSGQSILNYL-------FDTKRKPPTVQNKILRKTW---EV 159
           +V +F  +LE  V+  FTT  GQ +   L       F   + P  +  ++ R  W    +
Sbjct: 4   RVPQFDSLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQV-RTAWTEEAL 62

Query: 160 NEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNML 219
           +++++  F   + R+  +   I ++NEP  KL +  L      S      ++L+++Y++L
Sbjct: 63  SKYIHL-FFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFP----SEFSKARLVLNTDYDVL 117

Query: 220 TDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWY 265
            D+++     L  LI+  +   G      + +Y R+ +F+ +F W+
Sbjct: 118 LDFVNTVRPQLKGLIRQAV--QGSLVDPIVRKYGRVYEFHDYFHWF 161

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/865 (41%), Positives = 511/865 (59%), Gaps = 87/865 (10%)

Query: 413  NLMLNTKKRHQILNKLLNSNSFD----SSPLLELQFKLMLGLVDPLSQPPPNDKHIISLD 468
            +LM  T KRH  L+KL+  +  +    +SPLL++Q+K +L L+DPL+QP PND H+IS+D
Sbjct: 300  DLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISID 359

Query: 469  LLYQLFIAILYPNFE-IFQNNLGFNWKTHVCFQMVKIINNCMEKLNCNDLQKLYDLTGFQ 527
            LL  +F+ ++ P  +    N+ G +W+ H+CF M +II   +  LNCND ++L    G  
Sbjct: 360  LLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERL----GTV 415

Query: 528  GENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLNTQDLELLYMVMILASYT 587
             E+                         +WRS L  WLP GLNTQ+LEL+YM  ILA YT
Sbjct: 416  DESK------------------------DWRSQLHLWLPRGLNTQNLELVYMSCILAVYT 451

Query: 588  LQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHETYKTPLLVKATIRGAS 647
            + KL  + P+  NPFL +LI+LWK LT +++ GL IDR EE+++++ TP++V+ATIRGA+
Sbjct: 452  IYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAA 511

Query: 648  ALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCDIKLFAASLYALGMDL 707
            ALRS+VAT+LN  ME   HDF HE+LNTFMSPHGRKLC+GALY D+K + AS+ ALG + 
Sbjct: 512  ALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYTASILALGAEF 571

Query: 708  IEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKTLKSNDDNSDIYVLNE 767
             E+ +L+SYL+ GD+FDED+ YMFEYEY+DYN    E +ED   + ++ ++    Y  N 
Sbjct: 572  QEVTDLVSYLQAGDQFDEDVKYMFEYEYEDYN----EIYED--SSNENEENEEIDYAFN- 624

Query: 768  VKLDRYQRRCNCIFEDDKILXXXX---------XXXXXXXXXXXXXXXXTPKNVASFQDP 818
                  +RRCNCIF DD ++                             T K + S    
Sbjct: 625  ------KRRCNCIFSDDNLIEEEEDDEEESDVEKTSDIDGEIATKSKEHTEKTIESDSGL 678

Query: 819  LGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLDTMINLTSKAST 878
              + +  +AVRSK+ FEFDYSGKDWRDIPR +N+YYS  Y+FID   L+T+  LT KA++
Sbjct: 679  SNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATS 738

Query: 879  QKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKDQLHSNIINPLVNSKEEKERSTVVA 938
            +KL  +++       AS++K EQ+ MI  +LL+              ++ +E E +   A
Sbjct: 739  EKLTKEEAALLLCSVASTVKNEQDRMIFGNLLEQDKS----------STADEHEDTKKEA 788

Query: 939  TPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIWYITHMKLNHSLIQYI 998
            TPDDI++ W ++  F  +LHFN +L+W+LMDEMLMC+GYRRVLIW+ITHM+L+HSLI YI
Sbjct: 789  TPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYI 848

Query: 999  FELLMGLRGSPFANNNECKNELLHELMLGKKIVD--NHTYPFSRQGPLILSDIETKMLLQ 1056
            F+L+MG RG      +  KN  +    + + I D  +++  FSR G L LS++ET+M+LQ
Sbjct: 849  FDLMMGSRG--INKTDTSKN--VKSTFITENISDSNSNSLKFSRMGHLKLSELETRMILQ 904

Query: 1057 EFFSNAAIYF-DNDLATNEGDGQLEHTTXXXXXXXXXXXXXXXHGVSMYSMGLMKLICIM 1115
            E F+NAAIYF D    +N+     +++T                G S+YS+GLMKLICIM
Sbjct: 905  ELFTNAAIYFSDKARKSNQSILTPDYSTEEEEFDEENEG-----GYSIYSVGLMKLICIM 959

Query: 1116 VSSLIENKKFDFTKSDCNFELQTLLMNWIGIXXXXXXXXXXXXSDIXXXXXXXXXXXXXX 1175
            VS LIEN KF+  +SDC FELQTLLM WI I            S +              
Sbjct: 960  VSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSL------SEFSHVEN 1013

Query: 1176 XXXXXXRKSSESNGKWEGSRIGKMNDFNKRLLRLLAPIHSGDTDLNSDTVTTPFRGLLKN 1235
                    +S  + K    +  +   +N+ LL+L+ P   G  +   + +   FR  +K+
Sbjct: 1014 SELASIEGASTKSHKQLVDKNSESYKYNEILLKLIPPTFGGKEE---NIIFNTFRDYIKD 1070

Query: 1236 YSFTSKPKKVAGRKVVYTDDEILPL 1260
            YSF S+   +  RK+++  DEILPL
Sbjct: 1071 YSFDSEVSTMC-RKIIHQSDEILPL 1094

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 103/220 (46%), Gaps = 37/220 (16%)

Query: 85  YKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILNYLFDT--- 141
           YKP+I  L+  L DE+  L++    +VK  S + E  VIA FTT+ G S+LN L D    
Sbjct: 21  YKPSIYQLEQLLRDENQVLDLLADIEVKG-SFITEVTVIALFTTRPGISLLNCLTDNFGI 79

Query: 142 -----KRKPPTVQNKI--LRKTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIK 194
                   P ++  ++  L   W  +E +   F+ F+I N+N +IN    N+  +KL + 
Sbjct: 80  DEDNKDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKLQLD 139

Query: 195 FLLTFHPLSNIETPSIILDSNYNMLTDYLDATSNWLIL-------LIKMT-------ILN 240
           FL+        ET   I   + N+LT+ +D    +L         +IK++       I  
Sbjct: 140 FLI------KNETSDFI---SLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDC 190

Query: 241 VGPFFYNTIIRYNRIPQFNGHFQWY---TSLPNDKPLYIK 277
              FF  TI+ Y R+ +   HF++Y   +   N   +Y+K
Sbjct: 191 EDSFFVRTILSYKRLYETLLHFEFYDYSSMKTNGSDIYVK 230

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1192 (33%), Positives = 612/1192 (51%), Gaps = 188/1192 (15%)

Query: 104  EMRKIKKVKKFSIMLETLVIAYFTTKSGQSILNYLFDT------------------KRKP 145
            E R        SI  E LVI  FTTK G SIL   ++                   +  P
Sbjct: 34   EARGTNSYASLSIQ-EKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLP 92

Query: 146  PTVQNKILRKTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNI 205
              V  K+++K W  +       +++L+RN +  ++   F   E KLS+ FLL      + 
Sbjct: 93   DAVYKKLVKK-WTGSSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLL------DQ 145

Query: 206  ETPSIILDSNYNMLTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWY 265
            +T  +I+D  YN+L D+L  T   +  L+     ++      + + ++R+ Q +G + WY
Sbjct: 146  DTELLIIDDEYNLLLDFLLQTRASVEELLSQA--DLPSLIAKSALSHHRLFQLSGRYVWY 203

Query: 266  TSLPNDKPLYIKEXXXXXXXXXXXKILSSESFIEIITRSNHDFEDDKSFKMSKTSKPVVL 325
            T   +++    ++           K+ + +  I  I                   +P+  
Sbjct: 204  T-FSDERFAEAQDICYKYLSVLTDKLTAQQDLIPQI-------------------QPLFD 243

Query: 326  WAIEEILSRLSFKDS--SRYKKNNINGNGQNYPQMERAQNQSDINYLNRNDGADEYDDDY 383
                  L+ LS  DS  S   +++ N +  ++PQ + + ++                   
Sbjct: 244  SVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQKKLSAHE------------------- 284

Query: 384  LHRIDDLKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQ 443
                        ++YSFDL +DG++  P N+   T++RHQ L ++L     +SSP L+ Q
Sbjct: 285  ------------RIYSFDLKDDGTLESP-NVFGRTRRRHQALYQVLRLQQQNSSPCLKAQ 331

Query: 444  FKLMLGLVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTHVCFQMVK 503
            F  +  LVDP++QP PND HIIS+DLL  +FI +L+   EI Q  L FNW+ H+CF + K
Sbjct: 332  FFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLLHS--EIKQ--LPFNWRFHICFNLQK 387

Query: 504  IINNCMEKLNCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQ 563
            I+ + + +LNC+D Q+L  +      NN ++ +                   +WR  L +
Sbjct: 388  ILQSTLPRLNCHDFQQLNSV------NNSDDSI-------------------DWRRNLHK 422

Query: 564  WLPHGLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDI 623
            WLP GLNTQDLEL+YM+ ILA Y + KL  + P+Q+NPFL ++I+LWK LT +++LGL+I
Sbjct: 423  WLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEI 482

Query: 624  DRSEEAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRK 683
            DR EE  ET+ TP+LV+A IRG+SALRSVVAT+LN ++EY  HDF+HE +N FMSPHGRK
Sbjct: 483  DRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRK 542

Query: 684  LCNGALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALK 743
            LC+GALY D++  AA++ ALG++L ++ NLLS L+PGDRFDED+ YMF+YEYD+YN    
Sbjct: 543  LCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYN---- 598

Query: 744  ENHEDLGKTLKSNDDNSDIYVLNEVK-LDRYQRRCNCIFEDDKILXXXXXXXXXXXXXXX 802
                ++G      ++  D+     +K +  Y +RC+C F+DD++L               
Sbjct: 599  ----EVGTEDMDEEELEDVESRERIKEMRAYYKRCHCQFDDDELLPEEEEESGIPISHTR 654

Query: 803  XXXXXTPKN---VASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYS 859
                  P     +++   P+  RN       K T EFD++G+DWRDIPRG N Y++ +Y 
Sbjct: 655  ISKELPPDTNVKLSNTAKPVALRN------KKDTIEFDFNGRDWRDIPRGLNFYFNENYD 708

Query: 860  FIDDSSLDTMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKDQLHSN 919
            F           L + A+ ++L+ ++++      ++ + +EQ   +++      D     
Sbjct: 709  FEKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLRSAFAADD----- 763

Query: 920  IINPLVNSKEEKERSTVVA----TPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCN 975
                   S+    +ST+VA    T D I++ W    +F +ML  NE L WR+MDEMLMC+
Sbjct: 764  -------SQALSCQSTLVADGDLTTDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCS 816

Query: 976  GYRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPFANNNECKNELLHELMLGKKIVDNHT 1035
            GYRRVLIW+ITH+++  S+I+YI+ L+MG RG   AN          E   GK       
Sbjct: 817  GYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGEKLAN---------EETPFGK------- 860

Query: 1036 YPFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTXXXXXXXXXXXX 1095
             PFSRQG ++LS+IE KMLLQEFF+NAAI+F   L  + GD + E T             
Sbjct: 861  LPFSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLRESLGDEEEEETENL---------- 910

Query: 1096 XXXHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIXXXXXXXXX 1155
                G+S Y +GLM+L+C MV SLI+ + FDF   D  FEL+TLLM+WI I         
Sbjct: 911  ----GISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARDLFF 966

Query: 1156 XXXSDIXXXXXXXXXXXXXXXXXXXX-------RKSSESNGKWEGSRIGKMNDFNKRLLR 1208
               S +                           R + E++G  +      ++ +NK+L+ 
Sbjct: 967  ALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDSEETNSVSIYNKKLIS 1026

Query: 1209 LLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPL 1260
            LL P+   +     +T  T  R  +  +S T     V GR+V+  DD I+ +
Sbjct: 1027 LLPPVVGTE-----NTAVTALRSFISKHSLTMG-TAVFGRRVINHDDRIMSM 1072

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/1174 (32%), Positives = 590/1174 (50%), Gaps = 178/1174 (15%)

Query: 119  ETLVIAYFTTKSGQSILNYLFD--------------TKRKPPTVQN---KILRKTWEVNE 161
            E LV+  FTT+ G S L   ++               + KP  V +   K + K W  + 
Sbjct: 51   EKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQRVSDAAYKRMVKRWTSST 110

Query: 162  FLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNMLTD 221
                  +D  +RN N  ++   F  P +KLS+ FLL      + ET  +++D  YN+L D
Sbjct: 111  EHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLL------DPETEVLVIDDEYNLLLD 164

Query: 222  YLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYTSLPNDKPLYIKEXXX 281
            +  A     ++   +  +++          + R+ Q  G + WYT               
Sbjct: 165  F--ALQCRALVEQLLNQIDLPSLLAKCAYGHGRLFQLCGRYVWYT--------------- 207

Query: 282  XXXXXXXXKILSSESFIEI--ITRSNHDFEDDKSFKMSKTSKPVVLWAIEEILSRLSFKD 339
                       S+E F E   I         DK      T++  ++  I+ +   +S   
Sbjct: 208  ----------FSAEQFDEAQDICYKYLSVLTDK-----LTAQQDLIPQIQPLFEIISSSK 252

Query: 340  SSRYKKNNINGNGQNYPQMERAQNQSDINYLNRNDGADEYDDDYLHRIDDLKDGEEKVYS 399
            +S +    + G+G      E   N    ++  +   A E    +     DLKD       
Sbjct: 253  ASHW----VYGDGLFTENPESDSNSDSDHWPQKRLSAQERVYSF-----DLKD------- 296

Query: 400  FDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVDPLSQPPP 459
                 DG++    N+   T++RHQ L ++LN    +++PLL  QF  +  LVDP++QP P
Sbjct: 297  -----DGTLEA-SNVFNRTRRRHQALYQVLNLQKQNTAPLLSSQFFTLCALVDPVTQPTP 350

Query: 460  NDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTHVCFQMVKIINNCMEKLNCNDLQK 519
            ND HI+S+DLL  +F+ +LY       N L  +W+ HVCF + KI+   + +LNC+D Q+
Sbjct: 351  NDSHIVSIDLLSDMFLGLLYSEI----NELHIDWRFHVCFNLQKIVQATLPRLNCHDFQR 406

Query: 520  LYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLNTQDLELLYM 579
            L  +      NN ++ +                   +WR  L +WLP GLNTQDLEL+YM
Sbjct: 407  LNSV------NNSDDSI-------------------DWRRNLHKWLPQGLNTQDLELIYM 441

Query: 580  VMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHETYKTPLLV 639
            + ILA Y + KL  ++P Q+NPFL ++I+LWK LT +++LGL+IDR EE  ET+ TP+LV
Sbjct: 442  IDILAIYIIHKLYRDLPAQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLV 501

Query: 640  KATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCDIKLFAAS 699
            +A IRG+SALRSVVATILN ++EY  HDF+HE +N FMSPHGRKLC+GALY D++  AA+
Sbjct: 502  RAAIRGSSALRSVVATILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAA 561

Query: 700  LYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKTLKSNDDN 759
            + ALG++L ++ NLLS L+PGDRFDED+ YMF+YEYD+YN    E  ++       + + 
Sbjct: 562  MLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDELEDVESRER 621

Query: 760  SDIYVLNEVKLDRYQRRCNCIFEDDKILXXXXXXXXXXXXXXXXXXXXTPKN---VASFQ 816
                 + E++   Y +RC+C F+DD++L                     P N   +++  
Sbjct: 622  -----IKEMRA--YYKRCHCQFDDDELLPEDEEDGRPDASPYRVTRDAPPDNNVKLSNTS 674

Query: 817  DPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLDTMINLTSKA 876
             P+  R+       K + EFD++G+DWR IPRG N Y++ +Y F    S     +L   A
Sbjct: 675  KPMALRS------QKDSVEFDFNGRDWRGIPRGLNFYFNENYEFEKHLSSGQAHSLMCNA 728

Query: 877  STQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKDQLHSNIINPLVNSKEEKERSTV 936
            + +KL  ++        A+ + +EQ   +++  L             L  + E +  ST+
Sbjct: 729  AEKKLPLEEGTQLLRVIATCVAKEQELTVLRSALL------------LGETPESENHSTL 776

Query: 937  VA----TPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIWYITHMKLNH 992
            VA    T D +++ W +  +F ++L  NE L WR+MDEMLMC+GYRRVLIW+ITH+++++
Sbjct: 777  VADGDLTTDFVYEKWCENSMFEKILFHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSN 836

Query: 993  SLIQYIFELLMGLRGSPFANNNECKNELLHELMLGKKIVDNHTYPFSRQGPLILSDIETK 1052
            S+I+YI+ L++G RG   A++                  D    PFSRQG ++LSDIE K
Sbjct: 837  SMIEYIYTLVLGNRGEKAASDG-----------------DYAKVPFSRQGAIVLSDIEIK 879

Query: 1053 MLLQEFFSNAAIYFDNDLATNEGDGQLEHTTXXXXXXXXXXXXXXXHGVSMYSMGLMKLI 1112
            MLLQEFF+NAAI+F           QL  +                 G+S + +GLMKL+
Sbjct: 880  MLLQEFFTNAAIFFSK---------QLRESLGDGEDDEDQGDDEKGSGISPHVVGLMKLV 930

Query: 1113 CIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIXXXXXXXXXXXXSDIXXXXXXXXXXX 1172
            C MV SL++ + FDF   D  FELQTLLM+WI I            S +           
Sbjct: 931  CYMVKSLMQKEMFDFKDPDYIFELQTLLMSWICILPEARDLFFALRSLVDEQSQNIKLES 990

Query: 1173 XXXXXXXXXRKSSE------SNGKWEGSRIGKMNDFNKRLLRLLAPIHSGDTDLNSDTVT 1226
                        SE      ++ + E      ++ +NK+L+ LL P    +     ++  
Sbjct: 991  ESIASACEPDSQSEPQLPQGTHAELEPEATHAVSIYNKKLMSLLPPAAGTE-----NSAI 1045

Query: 1227 TPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPL 1260
            T  R  +  +S T+K   + GR+V+  DD I+P+
Sbjct: 1046 TALRSFISKHSLTTK-TALFGRRVISQDDTIMPM 1078

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/943 (37%), Positives = 515/943 (54%), Gaps = 133/943 (14%)

Query: 393  GEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVD 452
              E+V++FDLN DG++  P N+ L+ KKRH+IL ++L     +  PLL+ QF  +  LVD
Sbjct: 287  SREQVFTFDLNRDGTLEFP-NVFLHAKKRHEILYRVLGLPDAEG-PLLKAQFMTLAALVD 344

Query: 453  PLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTHVCFQMVKIINNCMEKL 512
            P++QPPP + HIIS+DL++Q+F+       E    + G +W+ HVC+ M KI+   M++L
Sbjct: 345  PITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGRDWRFHVCYNMQKIVLATMKRL 404

Query: 513  NCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLNTQ 572
            NC+D   L  +      NN +E +                   +W   L++W P GLNTQ
Sbjct: 405  NCHDGDVLNTV------NNSDESV-------------------HWNVNLDKWTPRGLNTQ 439

Query: 573  DLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHET 632
            DLELLYMV +L+ Y + +L   +P+Q+NPFLP  ++LWK LT +L+ GL+IDR EE  ET
Sbjct: 440  DLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRET 499

Query: 633  YKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCD 692
            + TP++V+A IRG +ALRSVVAT++N++    +HDFKHE +N FMSPHGRKLC+GALY D
Sbjct: 500  FNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYAD 559

Query: 693  IKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAA-----LKENHE 747
            ++  AA++ +LG+DL ++ +LLS L+PGDRFD+D+ YMF+YEYDDYNA        EN E
Sbjct: 560  VRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEE 619

Query: 748  DLGKTLKSNDDNSDIYVLNEVK-LDRYQRRCNCIFEDDKILXXXXXXXXXXXXXXXXXXX 806
            DL +         +I     +K +  Y +RC+C+F+DD++L                   
Sbjct: 620  DLERL-------EEIQQRERIKDMRGYYKRCHCVFDDDELLSDEEEGETASSNIDRPKYS 672

Query: 807  XTPKNVAS------FQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSF 860
                N+ S      F  P  ++   +A+RS+   +FD++GKDWRDIPRG N YY+  Y F
Sbjct: 673  HNSLNLPSSMLSTTFNGPNSQK---FAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVF 729

Query: 861  IDDSSLDTMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKDQLHSNI 920
            ++    D +  L  +A+T+K+  + +       A+ IK EQ   ++ D++ G+    S  
Sbjct: 730  VNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGS-- 787

Query: 921  INPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRV 980
                 +S    +R   + T D I++ W ++ +F +M+++N +L WR+MDEMLMC+GYRRV
Sbjct: 788  -----SSNSNSDRVNEL-TSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRV 841

Query: 981  LIWYITHMKLNHSLIQYIFELLMGLRGSPFAN---NNECKNELLHELMLGKKIVDNHT-- 1035
            LIW+ITH++++HSLI YIFEL+MG+RG+   +    ++ KN  L  L        + T  
Sbjct: 842  LIWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNLDILDSLSLGSSSVTIK 901

Query: 1036 YPFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDL-------------ATNEGDGQLEHT 1082
             PFSRQGP+ILS IE  MLL EFF NA IYF +++             + NEG   LE+ 
Sbjct: 902  IPFSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYG 961

Query: 1083 TXXXXXXXXXXXXXXXHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMN 1142
                             GVS + +GLMKL+C MV  L+E KKFDFT S+  FELQTLLMN
Sbjct: 962  LCEDGDKDTL-------GVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMN 1014

Query: 1143 WIGIXXXXXXXXXXXXSDIXXXXXXXXXXXXXXXXXXXXRKSSESNGKWEGSRIGK---- 1198
            WIGI            S I                    RK S  +   EG  I +    
Sbjct: 1015 WIGIIPEARNLFFKLKSSILEASSQNDSSKSDKQGTENIRKKSSQSLVTEGEGIEQKIVN 1074

Query: 1199 -----------------------------------------MNDFNKRLLRLLAPIHSGD 1217
                                                     ++ +NK L+ LL P+H   
Sbjct: 1075 IDREDHLENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELL-PLHVD- 1132

Query: 1218 TDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPL 1260
               N +T  T  R  +  +S T+K   V GR+V+Y D  I+ L
Sbjct: 1133 ---NENTAVTALRSFITKHSLTNK-TAVFGRRVIYQDHAIMGL 1171

 Score = 68.6 bits (166), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 97/205 (47%), Gaps = 40/205 (19%)

Query: 82  FKIYKPTIENLQDF---LEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILNYL 138
           F+ YKP I +L +F   + DEHF             +++ E +V+  F T+SG S+L+ L
Sbjct: 22  FRTYKPDIRSLVEFRLNVGDEHFD------------ALITEKVVVTLFMTRSGNSMLHML 69

Query: 139 FD--TKRKPPTVQNKILR------------KTWEVNEFLYFCFIDFLIRNKNNEINIDKF 184
           +D    R   T   + L+            K W     +   F+DF +RN+N  ++  ++
Sbjct: 70  YDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSRRDILSEFLDFCLRNENCALDYIEY 129

Query: 185 NEPENKLSIKFLLTFHPLSNIETPSIILDSNYNMLTDYL-DATSNWLILLIKMTILNVGP 243
                KL ++FLL   PL     P +I D  YN+L DY+  +   W +LL +     +  
Sbjct: 130 ASATRKLPLQFLLP-EPLR----PYLI-DDEYNLLLDYMIQSRPMWEMLLTQ----GIPK 179

Query: 244 FFYNTIIRYNRIPQFNGHFQWYTSL 268
           F    +  YNR  +FNG++ WY ++
Sbjct: 180 FLPELVDEYNRSYEFNGYYVWYGNV 204

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/774 (42%), Positives = 466/774 (60%), Gaps = 68/774 (8%)

Query: 393  GEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVD 452
             +E+VY+F+LN DGS+  P N+ L+T++RH+ L ++L   + +  PLL  QF  +  LVD
Sbjct: 286  AKEQVYTFELNRDGSLEFP-NVFLHTRRRHETLYRILGLPNREC-PLLRAQFMTLCALVD 343

Query: 453  PLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTHVCFQMVKIINNCMEKL 512
            P++QPPP +KHIIS+DL+YQ+F+  +    E      G +W+ HVC  + KII   M++L
Sbjct: 344  PITQPPPTEKHIISIDLIYQMFLGSISSLLESSLR--GQDWRFHVCHNLQKIILATMKRL 401

Query: 513  NCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLNTQ 572
            NC+D + L  +      NN +E +                   +W   + +W P GLNTQ
Sbjct: 402  NCHDSEVLNSI------NNSDETV-------------------HWNVNIGKWTPRGLNTQ 436

Query: 573  DLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHET 632
            DLELLYMV +L  YT+ +L  ++P+Q+NPFLP   +LWK LT +L+LGL+IDR EE  ET
Sbjct: 437  DLELLYMVDMLGIYTIYQLYSDLPVQMNPFLPLSFHLWKNLTNVLLLGLEIDRFEEDRET 496

Query: 633  YKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCD 692
            + TP++V+ATIRG++ALRSVVAT++N++    +HDFKHE +N FMSPHGRKLC GALY D
Sbjct: 497  FSTPIIVRATIRGSAALRSVVATMINSHFSIKEHDFKHEPINLFMSPHGRKLCQGALYAD 556

Query: 693  IKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAA-----LKENHE 747
            ++  AA++ ALG++L ++ +LLS L+PGDRFD+D+ YMF+YEYDDYNA        EN E
Sbjct: 557  VRSHAAAMLALGIELNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEE 616

Query: 748  DLGKTLKSNDDNSDIYVLNEVK-LDRYQRRCNCIFEDDKILXXXXXXXXXXXX--XXXXX 804
            DL +         +I     +K +  Y +RC+C+F+DD++L                   
Sbjct: 617  DLERL-------EEIQQRERIKDMRGYYKRCHCVFDDDELLSDEEGTDTGEHTDNHITET 669

Query: 805  XXXTPKNVASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDS 864
                P N+ +     G + +  AVRS+   EFD++GKDWRDIPRG N YY   Y F++  
Sbjct: 670  VQSAPLNLVTGVSTSGPQKV--AVRSRDYVEFDFNGKDWRDIPRGMNFYYVEDYVFVNKL 727

Query: 865  SLDTMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKD-LLKGKDQLHSNIINP 923
              D +  L  +A+++KL  + S       A+ IK EQ   ++ D + K KD+      +P
Sbjct: 728  HADVLHYLMKEATSKKLESNQSSFILRSVATCIKLEQEKTMVHDAIFKSKDK------SP 781

Query: 924  LVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIW 983
            L  S  E        T D I++ W +  +F +M+++N +L WR+MDEMLMC+GYRRVLIW
Sbjct: 782  LSASGSEGSNGL---TSDFIYEKWCEDALFEKMMYYNNDLVWRMMDEMLMCSGYRRVLIW 838

Query: 984  YITHMKLNHSLIQYIFELLMGLRGSPFANNNECKN------ELLHELMLGKKIVDNHTYP 1037
            +ITH++L+HS+I YIFEL+MG+RG+    + E +       +LL    LG   +   + P
Sbjct: 839  FITHLELSHSVIHYIFELVMGMRGNVAYKDLEEEYIINRNLDLLDSFSLGSSCIPA-SIP 897

Query: 1038 FSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLE-----HTTXXXXXXXXX 1092
            FSRQGP++LS IE  MLLQEFF NAAIYF N L        L+       T         
Sbjct: 898  FSRQGPIVLSTIEVNMLLQEFFINAAIYFSNYLRDTASYEHLDVEQPEEQTEIEEGEAED 957

Query: 1093 XXXXXXHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGI 1146
                     S + +GLMKL+C MV  LIE KK DFT S+  FELQTLLMNWIG+
Sbjct: 958  EIADERLTASSHVLGLMKLLCFMVDMLIEKKKLDFTDSEYLFELQTLLMNWIGL 1011

 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 98/217 (45%), Gaps = 45/217 (20%)

Query: 65  MLTPMSELIPTIFTNHKFKIYKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIML-ETLVI 123
           +++P++ +I T         YKP+I++L          LE+   +    F +M+ E +V+
Sbjct: 14  VVSPLASVIHT---------YKPSIQSL----------LELNVQEGDPHFELMIVEKVVV 54

Query: 124 AYFTTKSGQSILNYLFDT--------------KRKPPTVQNKILRKTWEVNEFLYFCFID 169
             F T+ G SIL+ L+D               K +    Q K   K W         F+D
Sbjct: 55  TLFMTRGGNSILHLLYDLSCGRIKLSEYRQSLKVRSNVHQWKTCYKEWGSRRDTLSRFLD 114

Query: 170 FLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNMLTDYL-DATSN 228
           F +RN++  ++  ++     KL ++FLL           + +LD  YN+L DY+ ++   
Sbjct: 115 FCLRNEDCALDYTEYGRVMRKLPLQFLLP------AGLHAYVLDEGYNLLLDYIINSRLM 168

Query: 229 WLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWY 265
           W  LLI+     +       I  YNR+ +FNG++ WY
Sbjct: 169 WEELLIQ----GIPRLLPELIEDYNRVFEFNGYYTWY 201

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 1182 RKSSESNGKWEGSRIGKMNDFNKRLLRLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSK 1241
            + +S +N    G     ++  N+ L++LL P HS D     +   T  R  +  +  T+K
Sbjct: 1085 QPTSAANSAPNGMSESNISYCNQMLIKLLPP-HSAD----ENAAVTALRSFIAKHPLTTK 1139

Query: 1242 PKKVAGRKVVYTDDEILPL 1260
               + GR+V+Y D+ I+ L
Sbjct: 1140 -TAIFGRRVIYQDNAIMGL 1157

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  514 bits (1325), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 329/863 (38%), Positives = 459/863 (53%), Gaps = 109/863 (12%)

Query: 413  NLMLNTKKRHQILNKLLNSNSF-----DSSPLLELQFKLMLGLVDPLSQPPPNDKHIISL 467
            +LM  T++R  IL K+L  +       +S  L+ L F  +  LVDPL+QP PND+H+ISL
Sbjct: 280  DLMKLTERRQNILYKVLIFSKLKQIEPESFQLMSLLFNRICALVDPLTQPIPNDEHVISL 339

Query: 468  DLLYQLFIAILYPNFEIF-QNNLGFNWKTHVCFQMVKIINNCMEKLNCNDLQKLYDLTGF 526
            DLLY++F+A++ P+ ++  +    ++W+  +   + KI+      LNC D++KL      
Sbjct: 340  DLLYKIFLAMMLPHVQVLIERESSYDWRYEISNNLQKILFYAFLNLNCYDMEKL------ 393

Query: 527  QGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLNTQDLELLYMVMILASY 586
               N  +E                     +W+  L  WLPHGLN Q+LELLYM+ I   Y
Sbjct: 394  ---NKVDE-------------------TKHWKEQLHLWLPHGLNPQNLELLYMICIFCVY 431

Query: 587  TLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHETYKTPLLVKATIRGA 646
             + KL  + P+  NPFLPTL++ WKKLT +++ GL +DR EE +E++ TP++V+ATIRGA
Sbjct: 432  AIFKLYEDKPLHFNPFLPTLLSTWKKLTYVMLYGLQVDRFEEENESFNTPIMVRATIRGA 491

Query: 647  SALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCDIKLFAASLYALGMD 706
            SALRSVVA+ILNN M+   HDF+HE LNTFMSPHGRKLC GALY D+K + AS+ A GM+
Sbjct: 492  SALRSVVASILNNQMDGKKHDFQHEPLNTFMSPHGRKLCTGALYADLKSYTASMLACGME 551

Query: 707  LIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKTLKSNDDNSDIYVLN 766
              +I  LLSYL+PGD FDED+ YMFEYEYDDYN   ++  ++ G+   S ++        
Sbjct: 552  FKDITELLSYLQPGDCFDEDVKYMFEYEYDDYNEPEEDESDEDGERNNSEEN-------- 603

Query: 767  EVKLDRYQRRCNCIFEDDKILXXXXXXXXXXXXXXXXXXXXTPKNVASFQDPLGKRNLDY 826
             +K +  +RRC C+F DD +L                       N     D + K     
Sbjct: 604  -IKFNFNRRRCRCVFSDDDVLEHGDFNDANSEYSNSEENSNDVDNFVLPNDGIDK----- 657

Query: 827  AVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLDTMI-NLTSKASTQKLNHDD 885
                K   EFD+ GKDWR +PR  N++YS  Y FI++  L+ +I +L S+AS   L+   
Sbjct: 658  ---PKNGVEFDFDGKDWRAVPRHLNMFYSFDYIFIEN-PLEVLIRSLISEASASALSKKK 713

Query: 886  SIXXXXXXASSIKEEQNDMIM--KDLLKGKDQLHSNIINPLVNSKEEKERSTVVATPDDI 943
            S       AS IK  Q+  I+  K    G D           +SK +   ST      D+
Sbjct: 714  SHLLLRNIASVIKINQDSRILGSKRSPNGTD-----------SSKSQNGLST-----GDL 757

Query: 944  FDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIWYITHMKLNHSLIQYIFELLM 1003
                   D F  +L FN EL   LMDE+LM  GYRRVL+W++TH+ L+H++I YIFELLM
Sbjct: 758  IKLITAGDTFENILKFNRELGCFLMDELLMILGYRRVLLWFLTHLTLSHTIIYYIFELLM 817

Query: 1004 GLRGSPFANNNECKNELLHELMLGKKIVDNHTYPFSRQGPLILSDIETKMLLQEFFSNAA 1063
              RG       E ++EL              +Y FSRQG L LSD+E +MLLQEFF+NA 
Sbjct: 818  HHRGQVSDTERE-QSEL--------------SYTFSRQGELRLSDLEREMLLQEFFTNAT 862

Query: 1064 IYFDND---LATNEGDGQLEHTTXXXXXXXXXXXXXXXHGVSMYSMGLMKLICIMVSSLI 1120
            ++F +     A++ GD    +T                   S+Y++GLM++ CIM+ SL 
Sbjct: 863  MFFSSKSVLFASDTGDNNEINTDVDGEEGL----------YSLYAVGLMRVTCIMIISLF 912

Query: 1121 ENKKFDFTKSDCNFELQTLLMNWIGIXXXXXXXXXXXXSDIXXXXXXXXXXXXXXXXXXX 1180
            +N  FD + S+  FELQTLLM WI I              +                   
Sbjct: 913  DNADFDLSSSESIFELQTLLMGWINIIPEAKLLFFKLKESVKSFNGIDNPELKSIEESST 972

Query: 1181 XRKSSESNGKWEGSRIGKMNDFNKRLLRLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTS 1240
              K +  +   E  R      FNK+LL+      SGD   + D +   F+  L+NYSF S
Sbjct: 973  TTKKTTIDENSEQYR------FNKKLLKTFPKSFSGD---DGDILLKTFKDFLRNYSFDS 1023

Query: 1241 KPKKVAGRKVVYTDDEILPLPKV 1263
            +P  + GRKV+Y  DEIL L  +
Sbjct: 1024 EPPYI-GRKVIYESDEILQLTDI 1045

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 52/105 (49%), Gaps = 12/105 (11%)

Query: 85  YKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIML-ETLVIAYFTTKSGQSILNYL---FD 140
           Y+P++ NL++ L +    L+M  +  V + +++  E +++    +KSG S+L Y     D
Sbjct: 12  YRPSVYNLKNLLRNNELVLDM--LADVNERNVLASEVVMMTLLCSKSGSSMLEYYMSNID 69

Query: 141 TKRKPPTVQNKILRKT------WEVNEFLYFCFIDFLIRNKNNEI 179
           T     T +N I +K       WE N+ L   F+  L+ N+   I
Sbjct: 70  TIDDYKTSENSIYKKNTALALRWENNDVLLIKFLTILLSNRKTLI 114

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  498 bits (1281), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 296/764 (38%), Positives = 425/764 (55%), Gaps = 88/764 (11%)

Query: 394  EEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDS-SPLLELQFKLMLGLVD 452
            EE + SFD+N +G   +P N+M ++  RH IL + L  +  ++ +P LE+QFK + GLVD
Sbjct: 356  EEVILSFDINENGLQEVP-NIMKDSMLRHSILFEFLGLSQRNTLAPYLEMQFKTLAGLVD 414

Query: 453  PLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTHVCFQMVKIINNCMEKL 512
            PL+QP PND HIIS+DLL+ L+  +++P          ++WK    F ++KI+   ++KL
Sbjct: 415  PLTQPTPNDTHIISIDLLHGLYTGLVHPALIKSGKARNYDWKYLCGFNLIKIVWKSLKKL 474

Query: 513  NCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLNTQ 572
            +C+    L ++  F+  N                         +WR TLE W+P  LNTQ
Sbjct: 475  HCSSYDTLNNIGNFEEGN-------------------------DWRQTLEYWIPKNLNTQ 509

Query: 573  DLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHET 632
            DLELLYM+ IL+ Y + KL  + PIQ NPFL  L ++WK +T I+ LGL +DR EE +++
Sbjct: 510  DLELLYMIDILSVYAIYKLYEDQPIQNNPFLFELFSVWKYITKIIFLGLQVDRIEEQNDS 569

Query: 633  YKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCD 692
             +TPL+++AT+RGASA R+ + TILN  +E N+HDFKHE +NTFMSPHGRKLC+G+LY D
Sbjct: 570  EETPLMIRATVRGASAFRAALTTILNRQIENNEHDFKHEPINTFMSPHGRKLCSGSLYAD 629

Query: 693  IKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKT 752
            +++        G++L +I NLL+ L+PGDRFDED+ YMF+YEY+DYN  L  + ED+ + 
Sbjct: 630  MRVSTKIFVENGVELDDITNLLTDLQPGDRFDEDVEYMFDYEYEDYN--LVSDSEDMDEK 687

Query: 753  LKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILXXXXXXXXXXXXXXXXXXXXTPKNV 812
              +  D         V+     RRCNC+FEDDKI+                       N 
Sbjct: 688  ADNESDG--------VRPAPIFRRCNCVFEDDKIMDESTIDHQSLITDMELE-----NNA 734

Query: 813  ASFQDPLGKRNL-----DYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLD 867
             S +D   K  +      + VR ++ F+F+Y GKDWRDIPRG N+YY+  + F+ + S  
Sbjct: 735  ISTKDENDKIKIISQPEPFTVRMRSFFDFNYGGKDWRDIPRGENLYYNGEFVFVQECSSS 794

Query: 868  TMINLTSKASTQKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKDQLHSNIINPLVNS 927
               +  SKA    L+  +S       AS I+EEQ+ M+   +  G  QL      PL N 
Sbjct: 795  EFASYFSKAVNSVLDISESNRLIQLVASCIREEQDRMV---IYHGMSQL------PLANG 845

Query: 928  KEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIWYITH 987
               K + TV    D+I+D     + F +ML+ + EL+  LMDE+LM  GYRRVLIW++TH
Sbjct: 846  DVNKSKLTV----DEIYDQISSSNNFAKMLYQDTELACGLMDELLMIVGYRRVLIWFLTH 901

Query: 988  MKLNHSLIQYIFELLMGLR-----GSPFANNNECKNELLHELMLGKKIVDNHTYPFSRQG 1042
            + +   LI YIFEL+MG R     G    +NN+  +        GK         FSR G
Sbjct: 902  INITFPLIHYIFELVMGYRVGFSDGDANGDNNKKSS-------TGK-------CGFSRLG 947

Query: 1043 PLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTXXXXXXXXXXXXXXXHGVS 1102
             + LS IE +MLLQEFF NA +        + G                         +S
Sbjct: 948  TVALSSIEKQMLLQEFFLNATVSLSAKSFESNG---------TEIDNYDDNADEDNEYIS 998

Query: 1103 MYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGI 1146
             Y++G++ LIC MV +L+   + D +KS+   ELQTLL+NWI +
Sbjct: 999  SYAVGIVTLICNMVKTLVRAGQMDVSKSEYTVELQTLLVNWISL 1042

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 82/166 (49%), Gaps = 24/166 (14%)

Query: 119 ETLVIAYFTTKSGQSILNYLFDTK---------------RKPPTVQNKILRKTWEVNEFL 163
           E L IA FTTK G  IL++  +T                  P     K+L K WE +E+L
Sbjct: 118 ELLTIALFTTKPGNKILHFFKNTGLDSAIEHNDSDDTLFHSPAYEHLKMLWK-WE-DEYL 175

Query: 164 YFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNMLTDYL 223
           +   + F+++N+N +I++  + +   K  + FLLT  P +NI+    +L   +N+L +YL
Sbjct: 176 H-NLLQFILKNRNVDIDLGNYCKTSYKRPLTFLLTC-PNNNIKH-RFLLSEEFNILEEYL 232

Query: 224 DATS----NWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWY 265
            A      + + + I+ TI     FF  T+  Y+R+ ++N  +  Y
Sbjct: 233 YAAQSNIKSKIAIAIQSTIGKHMNFFTMTLHLYDRVTEYNQSYLRY 278

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON}
           Anc_3.497 YGR134W
          Length = 1307

 Score =  362 bits (928), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 287/798 (35%), Positives = 402/798 (50%), Gaps = 188/798 (23%)

Query: 85  YKPTI---ENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILN----- 136
           YKP I   E L D+ + +  +L+          S++ E+L++A FTT  G S+LN     
Sbjct: 18  YKPNIQLLETLIDYAKPDSEYLD----------SLLFESLILALFTTNCGLSVLNIISTL 67

Query: 137 --YLFDTKRK----PPTV-------QNK-----------------------ILRKT---- 156
             +  D ++K    P T         NK                       IL+K     
Sbjct: 68  KSFTNDKQKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHP 127

Query: 157 -----WEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLL------------TF 199
                W  ++     F  F+++N N  +N + F +P  KL ++FLL            T 
Sbjct: 128 KLLEKWRNDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATS 187

Query: 200 HPLSNIETPSIILDSNYNMLTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFN 259
             L +I   ++++D NYN+L DYL  ++  LI L+     N+ P  +N II       +N
Sbjct: 188 QKLFSIYNNTLLMDKNYNLLLDYLHVSTPLLISLLHT---NLDPLLFNNII-----SSYN 239

Query: 260 GHFQWYTSLPNDKPLYIKEXXXXXXXXXXXKILSSESFIEIITRSNHDFEDDKSFKMSKT 319
             F+    L ND      +            I +    I+II      F+  K+F ++  
Sbjct: 240 KSFE----LTNDNKCLWYDFIDSKDTTNFGTITNC---IDIINNFLEIFDMHKNFTLNA- 291

Query: 320 SKPVVLWAIEEILSRLSFKDSSRYKKNNINGNGQNYPQMERAQNQSDINYLNRNDGADEY 379
                     EI + L    SS   K+N++                     N N+GAD  
Sbjct: 292 ----------EISNSLFNISSSSTTKSNMH---------------------NENEGAD-- 318

Query: 380 DDDYLHRIDDLKDGEEKVYSFDL--NNDGSITMPENLMLNTKKRHQILNKLLNSNSFD-- 435
               L+ + D     E   SF+L  NN     +  +LM +  KRH IL K+LN    D  
Sbjct: 319 ----LNLLMDENSMGEHTLSFNLFENNINHGILHPDLMAHISKRHDILAKILNVGDNDKY 374

Query: 436 -SSPLLELQFKLMLGLVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNL-GFNW 493
            +SPLL LQFKL+  LVDPL+QP PN K+IIS+DLL+QLF+  L P  + + +   G NW
Sbjct: 375 YNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAEDGTNW 434

Query: 494 KTHVCFQMVKIINNCMEKLNCNDLQKLYDLTGFQGENNKEELLXXXXXXXXXXXXTDRFV 553
           K  VCF M KIIN+ M+KLNC D   L  +      NN +E +                 
Sbjct: 435 KFLVCFNMEKIINSVMKKLNCVDFNTLNSI------NNSDESV----------------- 471

Query: 554 DGNWRSTLEQWLPHGLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKL 613
             +WR+ L +WLP G NTQDLELLYMV ILA+YT+ KLN ++PIQLNPFL ++++ WK L
Sbjct: 472 --HWRTQLHKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNL 529

Query: 614 TLILVLGLDIDRSEEAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEAL 673
           +  ++LGL+IDR EE +ET+ TPL+V+AT+R ++ALRS++ATILN ++    HDFKHE+L
Sbjct: 530 SCTILLGLEIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESL 589

Query: 674 NTFMSPHGRKLCNGALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEY 733
           NTFMSP+GRKLCNGALY D +  A+++ AL  DL  +  L+S L+PGDRFDED+ YMFE+
Sbjct: 590 NTFMSPYGRKLCNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEF 649

Query: 734 EYDDYNA---------------------ALKENHEDLGKTLKSNDDNSDIYVLN--EVKL 770
           E  DYN                       LKE H   G  +  N++N +  + N  E KL
Sbjct: 650 E--DYNTLPNVLGGEDDETSTDTLKNREMLKEIHN--GNFIPDNEENDEREIRNYLEQKL 705

Query: 771 DRY--QRRCNCIFEDDKI 786
                 RRCNCIF DD+I
Sbjct: 706 REMNCHRRCNCIFSDDEI 723

 Score =  248 bits (632), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 169/474 (35%), Positives = 238/474 (50%), Gaps = 53/474 (11%)

Query: 830  SKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLDTMINLTSKASTQKLNHDDSIXX 889
            ++  F+FDY+GKDWRD PRG N+YY+ +Y FI+  +LD +  LT KA+  KL+ DDS   
Sbjct: 819  NQNIFDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLL 878

Query: 890  XXXXASSIKEEQNDMIMKDLLKGKD------QLHSNIINP-------LVNSKEEKERSTV 936
                ASS+K EQ+ +I  D    K+      Q    + N         + +  EKE  T 
Sbjct: 879  LRLVASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITE 938

Query: 937  VATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIWYITHMKLNHSLIQ 996
            + TPDDI++ W ++  F  M+  N E+++RLMDEMLMC GYRRVLIW+ITH++L+HS+I 
Sbjct: 939  I-TPDDIYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIH 997

Query: 997  YIFELLMGLRGSPFANN-NECK--------------------NELLHELMLGKKIVDNHT 1035
            YIFEL+MG RG+   N   E K                    N LL++     KI D   
Sbjct: 998  YIFELVMGFRGTSEENGATEDKHTNTKGNVNELENKNENELVNMLLNDY---SKIFD-LQ 1053

Query: 1036 YPFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTXXXXXXXXXXXX 1095
             PFSRQG + LS+IE KML+QEF +NAAI+F+     N                      
Sbjct: 1054 LPFSRQGNIELSEIERKMLIQEFLTNAAIHFN---ERNNLKHNPNSNDNSNSNEDNINKD 1110

Query: 1096 XXXHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGIXXXXXXXXX 1155
                 +S+YS+GLM+LIC M+ + ++N K      D  FELQTLLMNWI I         
Sbjct: 1111 EDEDEISLYSIGLMRLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFF 1170

Query: 1156 XXXSDIXXXXXXXXXXXX-------XXXXXXXXRKSSESNGKW-EGSRIGKMNDFNKRLL 1207
                 I                           + S ++N K  E S++   + FNK+L+
Sbjct: 1171 QIKDIISNNQIDNNNFNNNLILDLDQDNNTIENQTSKDNNDKMDESSKVDSNSSFNKKLI 1230

Query: 1208 RLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLP 1261
             L   +    T+   +T     +  LK + F  +   + GRKV+Y D +IL +P
Sbjct: 1231 ELFPKM--SHTNKEENTAIDTLKNYLKKFRF-HQEVPIIGRKVIYEDGKILKIP 1281

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  342 bits (877), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 264/882 (29%), Positives = 410/882 (46%), Gaps = 115/882 (13%)

Query: 320  SKPVVLWAIEEILSRLSFKDSSRY-----KKNNI---NGNGQNY-PQMERAQNQSDINYL 370
            +KP+    IE +L +L   D S++     K N +   NG+ Q + P    +  +S    L
Sbjct: 140  AKPL----IESVLKKL---DGSQFLQCLMKYNRLYEFNGSYQWFTPPQSTSHAESPTTIL 192

Query: 371  NRNDG----ADEYDDDYLHRIDDLKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILN 426
             RN         + +D +  +  LK G+ ++ S  L + G  +   N  L+ +  H  LN
Sbjct: 193  ERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNS--LESYGKNSGHNNPPLSKQDDHNPLN 250

Query: 427  KLLNSNSF----------DSSPLLELQFKLMLGLVDPLSQPPPNDKHIISLDLLYQLFIA 476
                S+ F          +  PLL  QF  +    DP++QPPPND HIISLDLL+ L++ 
Sbjct: 251  LNGKSDRFNLFFKLGLHKEPHPLLAEQFNSLCLFADPMTQPPPNDSHIISLDLLHDLYLG 310

Query: 477  ILYPNFEIFQNNLGFNWKTHVCFQMVKIINNCMEKLNCNDLQKLYDLTGFQGENNKEELL 536
             L         N    WK H+   +  I    ++ L   D + L +L   Q  +      
Sbjct: 311  SLTAYIVKLIPNYQKVWKIHLSANLETITLAILQMLQIWDYRSLDNLKDIQARSPDA--- 367

Query: 537  XXXXXXXXXXXXTDRFVDGNWRSTLEQWLPHGLNTQDLELLYMVMILASYTLQKLNHEIP 596
                                +   +  W+P+ L+  ++E+LYM+  L+ Y++ K++ + P
Sbjct: 368  --------------------YPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDKP 407

Query: 597  IQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHETYKTPLLVKATIRGASALRSVVATI 656
             +LNPFLP ++  W+ L+  LVLGL IDR EE    Y TP++V A IRGASALRS++ATI
Sbjct: 408  PRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIATI 467

Query: 657  LNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCDIKLFAASLYALGMDLIEIRNLLSY 716
            LN +++   HDFKH+    FMSPHGRKLCNGALY     + A+L   GMD  EI  LL+ 
Sbjct: 468  LNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELLTD 527

Query: 717  LEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKTLKSNDDNSDIYVLNEVKLDR-YQR 775
            ++ GDR DED+ YMF+YEY DYN A      D GK + ++  N ++   N  ++ R   +
Sbjct: 528  IQKGDRIDEDVRYMFDYEYFDYNDADTSKLTD-GKLMFTSTKN-ELEQKNRFRMLRGLYK 585

Query: 776  RCNCIFEDDKILXXXXXXXXXXXXXXXXXX-----------XXTPK------NVASFQDP 818
            RC C F D+                                  TP+      N  +F   
Sbjct: 586  RCLCKFSDEDDNDDDDDDDDDDDYNGEKSVVGLDENGQINEAETPQTFSESSNAVAFTSL 645

Query: 819  LGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLDTMINLTSKAST 878
            +  R+      S  T  +D +G DWRDIPRG N+YY   Y F+      ++  L  +   
Sbjct: 646  MTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLPD 705

Query: 879  QKLNHDDSIXXXXXXASSIKEEQNDMIMKDLLKGKDQLHSNIINPLVNSKEEKERSTVVA 938
            + +    +       A+ +K EQ  +++K                +  +  E +   +  
Sbjct: 706  RNVTFSQACTVLRSIATCVKLEQEQILLK---------------LITATSAEVDLKVLPF 750

Query: 939  TPDDIFDYWFDKD-VFVEMLHF---NEELSWRLMDEMLMCNGYRRVLIWYITHMKLNHSL 994
            + D++    F+ D   ++   F   N+ L W++ DE++M +G+RR+LI+++TH     S 
Sbjct: 751  STDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTHRSYTFSS 810

Query: 995  IQYIFELLMGLRGSPFANNN--ECKNELLHELML--GKKIVDNHTYPFSRQGPLILSDIE 1050
            I Y++ELL GLRG+P  + +    KN+ L  L      +        FSRQG + LS IE
Sbjct: 811  IHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQGVIELSAIE 870

Query: 1051 TKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTXXXXXXXXXXXXXXXHGVSMYSM---- 1106
             KMLLQEFF   +    + L     D   E  +               +G   +S     
Sbjct: 871  KKMLLQEFFVGVS----SGLLGEYNDAGFEAFS----IKNPSKVYVDDYGEEFFSATSRK 922

Query: 1107 ----GLMKLICIMVSSLIENKKFDFT-KSDCNFELQTLLMNW 1143
                G +K++C ++  ++ +K+F+F    D  +EL+  LM W
Sbjct: 923  AEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQW 964

 Score = 69.7 bits (169), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 89/164 (54%), Gaps = 19/164 (11%)

Query: 115 SIMLETLVIAYFTTKSGQSILNYLFDTKRKPPTVQNK------------ILRKTWEVNEF 162
           S++LE LVIA FTT  GQ+++  L +  ++   V                L  TW  ++ 
Sbjct: 21  SVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRMNDPYWVALFGTWATDKH 80

Query: 163 LYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNMLTDY 222
           +   F+ +++RN+ + I+++++++   K++++FLLT     + +  + + D++ N+L DY
Sbjct: 81  ILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQ---DPKFTAPLWDTS-NILLDY 136

Query: 223 LDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYT 266
           L      +  ++K      G  F   +++YNR+ +FNG +QW+T
Sbjct: 137 LHNAKPLIESVLKKL---DGSQFLQCLMKYNRLYEFNGSYQWFT 177

>NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204
          Length = 523

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 50/106 (47%), Gaps = 6/106 (5%)

Query: 31  TAPDTNLEPVREPEVKFKTSADDDSNFYSEEDEIMLTPMSELIPTIFTNHKFKIYKPTIE 90
           + PDT +E  +EP +    S D DS+ Y E +E+ + P SE +   +  ++  +  P+  
Sbjct: 49  SKPDTEVETEKEPTI----SKDQDSS-YIENEELSIIPQSE-VDEFYKENEVSVKDPSDL 102

Query: 91  NLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILN 136
           NL+  L   H   + R   ++ KF        +++    SG+ ++ 
Sbjct: 103 NLRPLLSFNHVSFDERIQDEIAKFPKPTPIQAVSWPYLLSGKDVIG 148

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 141,335,069
Number of extensions: 6862600
Number of successful extensions: 24607
Number of sequences better than 10.0: 76
Number of HSP's gapped: 25254
Number of HSP's successfully gapped: 119
Length of query: 1279
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1158
Effective length of database: 39,606,813
Effective search space: 45864689454
Effective search space used: 45864689454
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)