Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G008903.499ON25425412241e-172
YGR135W (PRE9)3.499ON25824711251e-157
Smik_6.2313.499ON25824711241e-157
Suva_7.4233.499ON25824711161e-155
Skud_7.4463.499ON25825511131e-155
KAFR0C020203.499ON25825511001e-153
Kpol_480.103.499ON25924710961e-152
NCAS0E007603.499ON25924710921e-152
ZYRO0D09746g3.499ON25325410691e-148
SAKL0F02530g3.499ON25225310591e-147
TPHA0A057003.499ON25625010591e-147
CAGL0I10406g3.499ON25725110561e-146
TDEL0D056703.499ON25525410551e-146
KNAG0B007603.499ON25924710481e-145
Ecym_12303.499ON25125010321e-143
KLLA0E03917g3.499ON24925010201e-141
KLTH0G02376g3.499ON25125110161e-140
AFR318W3.499ON25125110161e-140
Kwal_47.188983.499ON25125110131e-140
TBLA0D029203.499ON2582529511e-130
Ecym_81518.871ON2501903873e-45
NDAI0C034005.64ON2631903883e-45
ADL354W8.871ON2501903864e-45
NCAS0D013405.64ON2611903866e-45
SAKL0H02068g5.64ON2611903822e-44
KLTH0E16324g8.871ON2501903813e-44
Kwal_56.247805.64ON2621903814e-44
KLTH0H00528g5.64ON2611903804e-44
Kpol_1062.25.64ON2601903804e-44
TPHA0H011905.64ON2601903805e-44
Ecym_51005.64ON2611903797e-44
KNAG0J001808.871ON2501903742e-43
AER296W5.64ON2601903753e-43
KLLA0B11836g7.120ON2541853743e-43
TDEL0G008805.64ON2601903744e-43
KLLA0A05093g5.64ON2621903744e-43
CAGL0I02442g5.64ON2601933744e-43
KAFR0B044405.64ON2601903735e-43
TBLA0C066205.64ON2621903735e-43
CAGL0H07007g8.871ON2501903719e-43
KLLA0D10373g8.871ON2501903701e-42
TBLA0J019807.120ON2541813692e-42
KAFR0L020808.871ON2501903673e-42
KLTH0F13574g7.120ON2541793674e-42
TPHA0I020707.120ON2561813665e-42
NCAS0F010307.120ON2531913665e-42
NDAI0E001608.871ON2501903665e-42
CAGL0F01199g7.120ON2541823649e-42
Kwal_YGOB_Anc_7.1207.120ON2541793641e-41
SAKL0F04224g7.120ON2521793622e-41
NDAI0H015207.120ON2521913622e-41
AAR012C7.120ON2511763622e-41
KNAG0K004505.64ON2671903623e-41
ZYRO0C11770g5.64ON2601903613e-41
KAFR0G030307.120ON2541793603e-41
Suva_15.1317.120ON2541783604e-41
Smik_13.438.871ON2501903604e-41
Ecym_12727.120ON2511763594e-41
ZYRO0G04136g7.120ON2541913595e-41
YOL038W (PRE6)7.120ON2541783596e-41
Skud_15.1197.120ON2541783596e-41
TPHA0C049308.871ON2501913587e-41
Suva_13.568.871ON2501903588e-41
Smik_15.1297.120ON2541783588e-41
Kpol_1023.1087.120ON2541783579e-41
YGR253C (PUP2)5.64ON2601903571e-40
Skud_7.5865.64ON2601903571e-40
Smik_16.545.64ON2601903571e-40
Suva_7.5495.64ON2601903571e-40
Skud_13.518.871ON2501903561e-40
Kpol_455.58.871ON2491913561e-40
NCAS0B001508.871ON2501903561e-40
YML092C (PRE8)8.871ON2501903562e-40
SAKL0D00440g8.871ON2501903534e-40
KNAG0L010207.120ON2661763511e-39
TDEL0B004008.871ON2501893491e-39
TDEL0H033007.120ON2561793474e-39
TBLA0C063408.871ON2561963474e-39
ZYRO0A00616g8.871ON2501883448e-39
ZYRO0C00792g7.20ON2901723121e-33
CAGL0H06105g7.20ON2901903112e-33
TBLA0E006907.20ON2781723075e-33
Kpol_538.407.20ON2741913041e-32
KLTH0D00902g7.20ON2771903041e-32
Smik_15.5467.20ON2881723042e-32
Skud_15.5307.20ON2881913024e-32
KAFR0C050007.20ON2811723005e-32
NCAS0I002507.20ON2921723006e-32
YOR362C (PRE10)7.20ON2881722981e-31
ADR401C7.20ON2791722943e-31
KLLA0A03487g7.20ON2751722944e-31
Suva_8.4197.20ON2921742937e-31
AGL089W4.110ON2461912881e-30
TDEL0H043107.20ON2741722892e-30
KNAG0E002307.20ON2791882892e-30
Ecym_50197.20ON2851722884e-30
SAKL0D14476g7.20ON2811902874e-30
TPHA0N002407.20ON2771722875e-30
Ecym_72334.110ON2461822838e-30
NDAI0A087707.20ON2921722842e-29
KLLA0A05027g4.110ON2461912784e-29
TBLA0C040804.110ON2531792742e-28
Kpol_1061.454.110ON2561772707e-28
KLTH0E07788g4.110ON2461822644e-27
Kwal_47.174934.110ON2461822645e-27
KNAG0E011805.1ON2331932601e-26
TPHA0F006704.110ON2571772621e-26
SAKL0H21956g4.110ON2481842611e-26
YGL011C (SCL1)4.110ON2521772612e-26
NCAS0A016404.110ON2531772602e-26
Kwal_27.97208.871ON1731162543e-26
Suva_7.2704.110ON2521772584e-26
ZYRO0G10164g4.110ON2531732584e-26
KLTH0B09504g5.1ON2331922574e-26
Smik_7.2794.110ON2521772576e-26
Skud_7.2764.110ON2521772551e-25
TDEL0F023604.110ON2531792542e-25
CAGL0A00407g4.110ON2541772532e-25
Ecym_56505.1ON2331922487e-25
CAGL0M14003g5.1ON2331922487e-25
KNAG0D035404.110ON2521772481e-24
KLLA0A10153g5.1ON2331932452e-24
Kwal_26.94835.1ON2331922443e-24
AGL336W5.1ON3061892466e-24
Kpol_1060.15.1ON2331922419e-24
NCAS0D023105.1ON2331922392e-23
ZYRO0C01144g5.1ON2331922382e-23
YMR314W (PRE5)5.1ON2341872382e-23
KAFR0I027205.1ON2351792373e-23
NDAI0I026405.1ON2331922364e-23
Skud_13.4885.1ON2341872365e-23
Smik_13.5315.1ON2341872365e-23
TBLA0C071905.1ON2331922347e-23
KAFR0F034304.110ON2521792341e-22
Suva_13.5075.1ON2341872322e-22
TPHA0A056705.1ON2331772303e-22
SAKL0H00946g5.1ON2331922286e-22
TDEL0G002405.1ON2381972077e-19
Kwal_26.68197.20ON1961131611e-12
NDAI0D035604.110ON172801512e-11
Smik_15.3375.507ON2611611312e-08
Suva_8.2085.507ON2611591294e-08
KAFR0C053005.507ON2611861286e-08
Skud_15.3215.507ON2611611286e-08
SAKL0G04290g5.507ON2612231278e-08
KNAG0B038005.507ON2611591271e-07
YOR157C (PUP1)5.507ON2611611261e-07
NDAI0C011705.507ON2631611251e-07
TDEL0A037105.507ON2611831224e-07
CAGL0L04312g5.507ON2611691224e-07
ZYRO0D12034g5.507ON2611751224e-07
Ecym_54585.507ON2582401207e-07
TPHA0E020505.507ON2611731172e-06
Kwal_47.187485.507ON2632151172e-06
TBLA0D017505.507ON2591901162e-06
KLLA0A02233g5.507ON2621591162e-06
Kpol_218.15.507ON2611591153e-06
NCAS0H024805.507ON2641841127e-06
KLTH0G03168g5.507ON2632151101e-05
KLLA0F12936g5.216ON2151651072e-05
AGL324W7.480ON2431581055e-05
Kpol_534.575.216ON2151641038e-05
Kpol_2002.1095.216ON2151641039e-05
NCAS0A148807.480ON2411781012e-04
KLLA0E05633g7.480ON2401591002e-04
TPHA0M017503.417ON2861691003e-04
AAR119W5.507ON2591741003e-04
KLTH0D03058g3.417ON287169994e-04
KNAG0F035907.480ON248176984e-04
NDAI0A048603.417ON287169994e-04
KAFR0B006507.480ON241174975e-04
NDAI0J006007.480ON241180976e-04
KLTH0E01826g7.480ON242179976e-04
TDEL0E041305.216ON219160967e-04
SAKL0F15092g7.480ON261183967e-04
TDEL0C055403.417ON287169968e-04
CAGL0F04477g7.480ON242155950.001
Ecym_71717.480ON242183950.001
TBLA0F017603.417ON287169950.001
CAGL0G01804g3.417ON286169940.001
TDEL0C034407.480ON241176940.002
Kpol_1018.1443.417ON288169940.002
Kwal_26.72733.417ON287168940.002
Smik_10.2785.216ON216164930.002
Kwal_55.198827.480ON242164930.002
Kpol_1028.927.480ON242164920.003
NCAS0A114403.417ON287169920.003
Kwal_33.151935.216ON193157910.003
TBLA0C062005.216ON216163910.003
Ecym_82765.216ON215161910.003
Skud_16.3883.417ON287169910.003
Smik_16.3433.417ON287169910.004
Skud_10.2225.216ON215164900.004
Suva_16.4293.417ON287169910.004
YJL001W (PRE3)5.216ON215164900.005
Suva_12.805.216ON215164890.005
KLLA0F08228g3.417ON285166900.005
YPR103W (PRE2)3.417ON287169900.005
KNAG0A075203.417ON287164900.006
AEL326C3.417ON285169890.006
TPHA0N007405.216ON216165880.007
ZYRO0C17688g3.417ON287169890.007
KAFR0D042103.417ON287169890.007
Ecym_26143.417ON285169890.008
ZYRO0B10142g5.216ON215164870.009
Suva_2.777.480ON241155870.010
TBLA0F026807.480ON241155870.010
TPHA0E004207.480ON241159860.016
NDAI0C024205.216ON216165850.018
TPHA0E029905.216ON216165850.019
SAKL0B09262g3.417ON287169850.021
ZYRO0G17842g7.480ON244147840.027
AAL172C5.216ON215161830.031
YBL041W (PRE7)7.480ON241155820.044
Smik_2.737.480ON241155820.048
SAKL0G12584g5.216ON215164810.053
Skud_2.617.480ON241155810.057
KAFR0C063505.216ON216162810.061
KLTH0B03102g5.216ON215161800.069
KNAG0H024505.216ON216162790.10
NCAS0A014805.216ON216163730.54
Kwal_55.210287.162ON195159720.66
CAGL0D03058g5.216ON215161711.1
KLTH0G00550g3.574ON265112682.9
AAR019W7.162ON195159673.3
Skud_5.1167.162ON198161663.8
TDEL0D049003.134ON18956664.6
ZYRO0G06600g5.702ON182061675.2
KLLA0B11660g7.162ON195161655.5
KLTH0F13750g7.162ON195159655.6
KLTH0C07348g3.269ON316127657.4
Ecym_12647.162ON195161648.5
YER012W (PRE1)7.162ON198161648.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00890
         (254 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON...   476   e-172
YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3...   437   e-157
Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W (...   437   e-157
Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W (...   434   e-155
Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W (...   433   e-155
KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.49...   428   e-153
Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON} ...   426   e-152
NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499     425   e-152
ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {O...   416   e-148
SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {O...   412   e-147
TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....   412   e-147
CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa] ...   411   e-146
TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3....   410   e-146
KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON...   408   e-145
Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON} ...   402   e-143
KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {O...   397   e-141
KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {O...   395   e-140
AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic h...   395   e-140
Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR13...   394   e-140
TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON...   370   e-130
Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa] ...   153   3e-45
NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON...   154   3e-45
ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON} S...   153   4e-45
NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64      153   6e-45
SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly ...   151   2e-44
KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 2...   151   3e-44
Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa] ...   151   4e-44
KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly si...   150   4e-44
Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906...   150   4e-44
TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON...   150   5e-44
Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON} ...   150   7e-44
KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871...   148   2e-43
AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic h...   149   3e-43
KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highl...   148   3e-43
TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64...   148   4e-43
KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly ...   148   4e-43
CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {O...   148   4e-43
KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64...   148   5e-43
TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {...   148   5e-43
CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {O...   147   9e-43
KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {O...   147   1e-42
TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.1...   146   2e-42
KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.8...   145   3e-42
KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893) ...   145   4e-42
TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.12...   145   5e-42
NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120     145   5e-42
NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON} ...   145   5e-42
CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {O...   144   9e-42
Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131...   144   1e-41
SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 a...   144   2e-41
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120     144   2e-41
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...   144   2e-41
KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}...   144   3e-41
ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {O...   143   3e-41
KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON...   143   3e-41
Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W...   143   4e-41
Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON} ...   143   4e-41
Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa] ...   142   4e-41
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...   142   5e-41
YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha ...   142   6e-41
Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W...   142   6e-41
TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8....   142   7e-41
Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON} ...   142   8e-41
Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W...   142   8e-41
Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON} (2523...   142   9e-41
YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}  P...   142   1e-40
Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}...   142   1e-40
Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C (R...   142   1e-40
Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}...   142   1e-40
Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON} ...   141   1e-40
Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432) ...   141   1e-40
NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON} ...   141   1e-40
YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}  PR...   141   2e-40
SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,...   140   4e-40
KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {O...   139   1e-39
TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871 ...   139   1e-39
TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON...   138   4e-39
TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {...   138   4e-39
ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}...   137   8e-39
ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly si...   124   1e-33
CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly ...   124   2e-33
TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON...   122   5e-33
Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON} ...   121   1e-32
KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {...   121   1e-32
Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {O...   121   2e-32
Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {O...   120   4e-32
KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20...   120   5e-32
NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON} ...   120   6e-32
YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}...   119   1e-31
ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 ...   117   3e-31
KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 a...   117   4e-31
Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}...   117   7e-31
AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic hom...   115   1e-30
TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON...   115   2e-30
KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20 Y...   115   2e-30
Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}...   115   4e-30
SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369) ...   115   4e-30
TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20 ...   115   5e-30
Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to...   113   8e-30
NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {...   114   2e-29
KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly ...   111   4e-29
TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON...   110   2e-28
Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {...   108   7e-28
KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly ...   106   4e-27
Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C...   106   5e-27
KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON...   104   1e-26
TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.11...   105   1e-26
SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highl...   105   1e-26
YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}  S...   105   2e-26
NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON...   104   2e-26
Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON} ...   102   3e-26
Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}...   103   4e-26
ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly ...   103   4e-26
KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {O...   103   4e-26
Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}...   103   6e-26
Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}...   102   1e-25
TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON...   102   2e-25
CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly si...   102   2e-25
Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON...   100   7e-25
CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} high...   100   7e-25
KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON...   100   1e-24
KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {O...    99   2e-24
Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {...    99   3e-24
AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homol...    99   6e-24
Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON} c...    97   9e-24
NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON...    97   2e-23
ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}...    96   2e-23
YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha ...    96   2e-23
KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1 ...    96   3e-23
NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1        96   4e-23
Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W...    96   5e-23
Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W...    96   5e-23
TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5....    95   7e-23
KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON...    95   1e-22
Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W...    94   2e-22
TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON}              93   3e-22
SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly ...    92   6e-22
TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON} ...    84   7e-19
Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C (P...    67   1e-12
NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON...    63   2e-11
Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {O...    55   2e-08
Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}...    54   4e-08
KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5....    54   6e-08
Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {O...    54   6e-08
SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly ...    54   8e-08
KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON...    54   1e-07
YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}  ...    53   1e-07
NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON...    53   1e-07
TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.50...    52   4e-07
CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {...    52   4e-07
ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highl...    52   4e-07
Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to...    51   7e-07
TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON...    50   2e-06
Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {O...    50   2e-06
TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON...    49   2e-06
KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {O...    49   2e-06
Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON} comp...    49   3e-06
NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507      48   7e-06
KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly ...    47   1e-05
KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590) ...    46   2e-05
AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic hom...    45   5e-05
Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON} (145742....    44   8e-05
Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON} (2589...    44   9e-05
NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {...    44   2e-04
KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {O...    43   2e-04
TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.4...    43   3e-04
AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic hom...    43   3e-04
KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {O...    43   4e-04
KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON...    42   4e-04
NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {...    43   4e-04
KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.48...    42   5e-04
NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.4...    42   6e-04
KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly ...    42   6e-04
TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 ...    42   7e-04
SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highl...    42   7e-04
TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.41...    42   8e-04
CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {O...    41   0.001
Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON} ...    41   0.001
TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON...    41   0.001
CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {O...    41   0.001
TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON...    41   0.002
Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa] ...    41   0.002
Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON...    41   0.002
Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 a...    40   0.002
Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W...    40   0.002
Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON} (21109...    40   0.003
NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3....    40   0.003
Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL00...    40   0.003
TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5....    40   0.003
Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp...    40   0.003
Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W...    40   0.003
Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W...    40   0.004
Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 a...    39   0.004
Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W...    40   0.004
YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {...    39   0.005
Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa...    39   0.005
KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {O...    39   0.005
YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5...    39   0.005
KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3....    39   0.006
AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON} Synt...    39   0.006
TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.2...    39   0.007
ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highl...    39   0.007
KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.41...    39   0.007
Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar ...    39   0.008
ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648...    38   0.009
Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W (R...    38   0.010
TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON...    38   0.010
TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480 ...    38   0.016
NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON...    37   0.018
TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON...    37   0.019
SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly ...    37   0.021
ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa] ...    37   0.027
AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 ...    37   0.031
YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6 ...    36   0.044
Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W (R...    36   0.048
SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137) ...    36   0.053
Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W (R...    36   0.057
KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [...    36   0.061
KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648...    35   0.069
KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 ...    35   0.10 
NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON...    33   0.54 
Kwal_55.21028 s55 (654604..655191) [588 bp, 195 aa] {ON} YER012W...    32   0.66 
CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {O...    32   1.1  
KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly si...    31   2.9  
AAR019W Chr1 (375421..376008) [588 bp, 195 aa] {ON} Syntenic hom...    30   3.3  
Skud_5.116 Chr5 (174986..175582) [597 bp, 198 aa] {ON} YER012W (...    30   3.8  
TDEL0D04900 Chr4 complement(887671..888240) [570 bp, 189 aa] {ON...    30   4.6  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    30   5.2  
KLLA0B11660g Chr2 complement(1024265..1024852) [588 bp, 195 aa] ...    30   5.5  
KLTH0F13750g Chr6 (1126220..1126807) [588 bp, 195 aa] {ON} highl...    30   5.6  
KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly ...    30   7.4  
Ecym_1264 Chr1 complement(543133..543720) [588 bp, 195 aa] {ON} ...    29   8.5  
YER012W Chr5 (177835..178431) [597 bp, 198 aa] {ON}  PRE1Beta 4 ...    29   8.5  

>NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON}
           Anc_3.499
          Length = 254

 Score =  476 bits (1224), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 236/254 (92%), Positives = 236/254 (92%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KDDMRLDEAIELA                  EFATIKKGKNDGEVYQKIYKPDEIKELLI
Sbjct: 181 KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKGKNDGEVYQKIYKPDEIKELLI 240

Query: 241 KTGVTKKKDDETEE 254
           KTGVTKKKDDETEE
Sbjct: 241 KTGVTKKKDDETEE 254

>YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3
           subunit of the 20S proteasome, the only nonessential 20S
           subunit; may be replaced by the alpha 4 subunit (Pre6p)
           under stress conditions to create a more active
           proteasomal isoform
          Length = 258

 Score =  437 bits (1125), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 213/247 (86%), Positives = 222/247 (89%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKI VAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KDDM++D+AIELA                  EFATI+KG NDGEVYQKI+KP EIK++L+
Sbjct: 181 KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV 240

Query: 241 KTGVTKK 247
           KTG+TKK
Sbjct: 241 KTGITKK 247

>Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  437 bits (1124), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 213/247 (86%), Positives = 223/247 (90%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKI+VAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KDDM++D+AI+LA                  EFATI+KG NDGEVYQKI+KP EIK+LL+
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240

Query: 241 KTGVTKK 247
           KTG+TKK
Sbjct: 241 KTGITKK 247

>Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  434 bits (1116), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 210/247 (85%), Positives = 222/247 (89%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKI VAVAGLTADAEILINTAR+HAQNYLK+YNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAG+DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KDDM++D+AI+LA                  EFATI+KG NDGEVYQKI+KP EIK+LL+
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLV 240

Query: 241 KTGVTKK 247
           KTG+TKK
Sbjct: 241 KTGITKK 247

>Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  433 bits (1113), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 212/255 (83%), Positives = 227/255 (89%), Gaps = 1/255 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKI VAVAGLTADAEILINTAR+HAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAG+DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           K+DM++D AI+LA                  EFATI+KG NDGEVYQKI+KP EIK+LL+
Sbjct: 181 KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKGPNDGEVYQKIFKPQEIKDLLV 240

Query: 241 KTGVTKK-KDDETEE 254
           KTG++KK +DDE ++
Sbjct: 241 KTGISKKDEDDEADQ 255

>KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.499
           YGR135W
          Length = 258

 Score =  428 bits (1100), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 210/255 (82%), Positives = 226/255 (88%), Gaps = 2/255 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS+EKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
Sbjct: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KD++ LD+A+ELA                  EFATIKKGK + ++YQKI+ PDEIK LL+
Sbjct: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240

Query: 241 KTGVTKK--KDDETE 253
           KTG++KK  +D++TE
Sbjct: 241 KTGISKKENEDEDTE 255

>Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON}
           complement(20212..20991) [780 nt, 260 aa]
          Length = 259

 Score =  426 bits (1096), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 208/247 (84%), Positives = 223/247 (90%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EK+Y+LNDKITVAVAGLTADAEILINTAR+HAQ YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KDD+++DEAIELA                  EFATIKKG+ND ++YQKI+KP+EIK+LL+
Sbjct: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEND-KIYQKIFKPEEIKQLLL 239

Query: 241 KTGVTKK 247
           KTG+TKK
Sbjct: 240 KTGITKK 246

>NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499
          Length = 259

 Score =  425 bits (1092), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 208/247 (84%), Positives = 220/247 (89%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DG+VLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKITVAVAGLTADAEILINTAR++AQ+YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KD+M+LD+AIELA                  E ATIKKG    EVYQKIYKP+E+KELL+
Sbjct: 181 KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKGTTTDEVYQKIYKPEELKELLL 240

Query: 241 KTGVTKK 247
           KTG+TKK
Sbjct: 241 KTGITKK 247

>ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 253

 Score =  416 bits (1069), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 205/254 (80%), Positives = 222/254 (87%), Gaps = 1/254 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLY+LNDKI VAVAGLT+DAEILINTARIHAQNYLKTYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KDD+++D AIELA                  EFATIK G+N G++YQK++KP+EI+ LL+
Sbjct: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGEN-GKLYQKVFKPEEIQTLLV 239

Query: 241 KTGVTKKKDDETEE 254
           K G+TK  +DE EE
Sbjct: 240 KNGITKAGEDEDEE 253

>SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 252

 Score =  412 bits (1059), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/253 (82%), Positives = 219/253 (86%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLND ITVAVAGLTADAEILINTAR++AQNYL+TYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KD + LD AIELA                  EFATIKKG N G++YQKIYKP EI+ LL 
Sbjct: 181 KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKGSN-GQLYQKIYKPQEIQTLLS 239

Query: 241 KTGVTKKKDDETE 253
           KTG+T KKDDE E
Sbjct: 240 KTGIT-KKDDEDE 251

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score =  412 bits (1059), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 202/250 (80%), Positives = 220/250 (88%), Gaps = 1/250 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLND ITVAVAGLTADAEILINTAR+ AQNYL+TYNEDIPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KDD++L+ AIELA                  EFATIKKG+N+ +VYQKIYKP+EIK+LL 
Sbjct: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN-KVYQKIYKPEEIKQLLS 239

Query: 241 KTGVTKKKDD 250
           K G+TKK +D
Sbjct: 240 KAGITKKSED 249

>CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa]
           {ON} highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135w proteasome subunit Y13
          Length = 257

 Score =  411 bits (1056), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 201/251 (80%), Positives = 218/251 (86%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  +GIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLND+ TVAVAGLTADAEILINTARIHAQNYLKTYNE+IPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQ+GGLRP+GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KD+M LD+A+ELA                  EFAT+KK     E  QKI+KP EIK+LLI
Sbjct: 181 KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKKGETEEFEQKIFKPAEIKQLLI 240

Query: 241 KTGVTKKKDDE 251
           KTG++KK D++
Sbjct: 241 KTGISKKSDED 251

>TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3.499
           YGR135W
          Length = 255

 Score =  410 bits (1055), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 202/254 (79%), Positives = 222/254 (87%), Gaps = 1/254 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLY+LNDKITVAVAGLTADAEILINTAR++AQNYL+TYNEDIPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KDD++L+ AIELA                  EFATI+K   DG++YQKI+KP+EI+ LL+
Sbjct: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAP-DGKLYQKIFKPEEIQSLLV 239

Query: 241 KTGVTKKKDDETEE 254
           K G+TKK  D+ ++
Sbjct: 240 KHGITKKHHDDEQD 253

>KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON}
           Anc_3.499 YGR135W
          Length = 259

 Score =  408 bits (1048), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 195/247 (78%), Positives = 215/247 (87%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IG++  DGIV+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLY+LNDKI VAVAGLTADAEILINTAR+H QNYLKTY EDIPVE+LV+R+SDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KD++ L+EA ELA                  EF+TIK+GK +G+V QKIYKP EIK+LL+
Sbjct: 181 KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240

Query: 241 KTGVTKK 247
           K+G+TKK
Sbjct: 241 KSGITKK 247

>Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON}
           similar to Ashbya gossypii AFR318W
          Length = 251

 Score =  402 bits (1032), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 198/250 (79%), Positives = 214/250 (85%), Gaps = 1/250 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLY+LND ITVAVAGLTADAEILINTAR+HAQNYLK YNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KD++  + AIELA                  EFATIK+  N G++ QKIYKP EIKELL 
Sbjct: 181 KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQDSN-GKLVQKIYKPSEIKELLQ 239

Query: 241 KTGVTKKKDD 250
           K+G+ K++++
Sbjct: 240 KSGIMKQEEN 249

>KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 249

 Score =  397 bits (1020), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 199/250 (79%), Positives = 210/250 (84%), Gaps = 1/250 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM   GIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLYKLND ITVAVAGLTADAEILINTAR+ AQ+YLKTYNE+IPVE+LVRRLSD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KDD+ LD AIELA                  EFATI K   +G++YQKIYKP EI  LL 
Sbjct: 181 KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISKDA-EGKIYQKIYKPTEIATLLE 239

Query: 241 KTGVTKKKDD 250
           KT + KK DD
Sbjct: 240 KTEIVKKDDD 249

>KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 251

 Score =  395 bits (1016), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 195/251 (77%), Positives = 214/251 (85%), Gaps = 1/251 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGT IG+M  DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +S EKLYKLND ITVAVAGLTADAEILINTAR+ AQNYLK+YNE+IPVEILVRRLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KDD+ ++EA ELA                  EF+TI K  N G++ QKI+KP EI+ LL 
Sbjct: 181 KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITKLDN-GKIAQKIFKPQEIETLLN 239

Query: 241 KTGVTKKKDDE 251
           KTGVTKK++D+
Sbjct: 240 KTGVTKKENDD 250

>AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR135W (PRE9)
          Length = 251

 Score =  395 bits (1016), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 195/251 (77%), Positives = 212/251 (84%), Gaps = 1/251 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           TS EKLY+LND ITVAVAGLTADAEIL+NTAR+HAQNYLK YNE+IPVE+LVRRLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KDD+  D+AI+LA                  EFATI++   DG+V QKIYK  EIK+LL 
Sbjct: 181 KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQRNA-DGKVVQKIYKLGEIKDLLE 239

Query: 241 KTGVTKKKDDE 251
           KTG+ K+++ E
Sbjct: 240 KTGINKQEEKE 250

>Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR135W
           (PRE9) - proteasome component Y13 [contig 189] FULL
          Length = 251

 Score =  394 bits (1013), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 194/251 (77%), Positives = 213/251 (84%), Gaps = 1/251 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IG+M  DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +S EKLYKLND ITVAVAGLTADAEILINTAR+ AQNYLKTYNE+IPVEILVRRLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDR+GYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKELLI 240
           KDD+ + EA ELA                  EFATI K +N G++ QKI+KP EI+ LL 
Sbjct: 181 KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITKLEN-GKIAQKIFKPREIETLLN 239

Query: 241 KTGVTKKKDDE 251
           +TG+ KK+++E
Sbjct: 240 ETGINKKENEE 250

>TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON}
           Anc_3.499 YGR135W
          Length = 258

 Score =  370 bits (951), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 204/252 (80%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
              EKLYKL+DKIT+AVAGLTADAEILIN AR  AQNYL TYNE+IPVEILV++LSDIKQ
Sbjct: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180

Query: 181 KDDMRLDEAIELAXXXXXXXXXXXXXXXXXXEFATIKKGK-NDGEVYQKIYKPDEIKELL 239
           KDDM L++A+EL                   E + IK  K ND ++ QKIY P EIK+LL
Sbjct: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL 240

Query: 240 IKTGVTKKKDDE 251
           IK G+ KK D++
Sbjct: 241 IKFGINKKNDED 252

>Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa]
           {ON} similar to Ashbya gossypii ADL354W 1-intron
          Length = 250

 Score =  153 bits (387), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 120/190 (63%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +G+V+A E+K  STL   DT ++
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANSTLTLTDT-LD 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHA-QNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+ K+   I    +G+  D  +LIN +R  A  +Y+KTY E  P +ILV +++ I Q  T
Sbjct: 63  KISKITPDIGAVYSGMGPDFRVLINKSRKTAYGSYMKTYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+   + LY  +PSG+Y  WKA ++G   +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDNHNEFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNNE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON}
           Anc_5.64
          Length = 263

 Score =  154 bits (388), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + ++   +  A++GLTADA  +I  AR+ A N+   Y+ED+ VE L + + D+   + + 
Sbjct: 67  IVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLYYDEDMKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYDD  GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLREA 196

>ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML092C
           (PRE8); 1-intron
          Length = 250

 Score =  153 bits (386), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 120/190 (63%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +G+V+A E+K  +TL  +DT ++
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANTTLTIKDT-LD 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHA-QNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+ ++   I    +G+  D  +LIN +R  A  +Y K Y E  P +ILV +++ I Q  T
Sbjct: 63  KVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64
          Length = 261

 Score =  153 bits (386), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + ++   I  A++GLTADA  +I  AR+ A N+   Y+EDI VE L + + D+   + + 
Sbjct: 67  IVEIEHHIGCAMSGLTADARSMIEHARVAAVNHNLYYDEDIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDNDEGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++VTS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR+ A  +   Y+EDI VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARVSAVTHNLYYDEDIGVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYDAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 250
           aa] {ON} similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  151 bits (381), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 119/190 (62%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +G+++A E+K TS+L   + S+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIRATNGVIIATEKKSTSSLALTE-SLS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I  A +G+  D  +LI+ +R +   +Y + YNE  P +ILV  ++ I Q  T
Sbjct: 63  KVAHITPDIGAAYSGMGPDFRVLIDKSRKVAHTHYKRIYNEYPPTKILVAEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa]
           {ON} YGR253C (PUP2) - 1:1 [contig 160] FULL
          Length = 262

 Score =  151 bits (381), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 116/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IG+   +G+VL  E++VTS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + ++   +  A++GLTADA  +I  AR+ A  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSAVTHNLYYDEEISVESLTQSICDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDQEQGYQLYHAEPSGTFYRFNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  150 bits (380), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 116/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IG+   +G+VL  E++VTS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + ++   +  A++GLTADA  +I  AR+ +  +   Y+EDI +E L + + D+   + + 
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYDEDISIESLTQSICDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906)
           [783 nt, 261 aa]
          Length = 260

 Score =  150 bits (380), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 116/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTREGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + ++++ I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+   + + 
Sbjct: 67  IVEIDNHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVETLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDRDQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON}
           Anc_5.64 YGR253C
          Length = 260

 Score =  150 bits (380), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 115/190 (60%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+   + + 
Sbjct: 67  ILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++GA +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYNAKAIGAGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON}
           similar to Ashbya gossypii AER296W
          Length = 261

 Score =  150 bits (379), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++VTS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  ARI +  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEVDKHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEISVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WYSSLTLKEA 196

>KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  148 bits (374), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 118/190 (62%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +G+V+A E+K +S L   DT + 
Sbjct: 4   RYAFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKSSSPLALTDT-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R +   +Y + YNE  P ++LV  ++++ Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEVMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYDD  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDDHRGFSLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR253C (PUP2)
          Length = 260

 Score =  149 bits (375), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++VTS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  ARI +  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEIGVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WYSSLTLKEA 196

>KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P40303 Saccharomyces cerevisiae
           YOL038W PRE6 20S proteasome alpha-type subunit
          Length = 254

 Score =  148 bits (374), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 116/185 (62%), Gaps = 2/185 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +IFSP+G ++QVEYALE++      +G+   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGADCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K+++ + ++ AGL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY-KDD 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A S+G N++  +  L+ +Y K++
Sbjct: 124 GGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWCAQSIGRNSNTVREFLEKNYNKNE 183

Query: 184 MRLDE 188
              DE
Sbjct: 184 PPADE 188

>TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  148 bits (374), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 115/190 (60%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A  +   Y+ED+ VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDMSVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDKESGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 262

 Score =  148 bits (374), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IG++  +GIVL  E++VTS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEGIVLGVEKRVTSALLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  ++  AR++A  +   Y+E I VE L + + D+   + + 
Sbjct: 67  IVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYDEKITVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ +  GYD   G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253c PUP2
          Length = 260

 Score =  148 bits (374), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 119/193 (61%), Gaps = 7/193 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IG++  +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  +  A++GLTADA  ++  AR+ A  +   Y+EDI +E L + + D+   + + 
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEAIEL 192
           +   + L EA +L
Sbjct: 187 WHSSLTLKEAEQL 199

>KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  148 bits (373), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T +GI   +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAVGICTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  +  A++GLTADA  +I  AR+ A ++   Y+EDI +E L + + D+   + + 
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMIEHARVAAVSHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {ON}
           Anc_5.64 YGR253C
          Length = 262

 Score =  148 bits (373), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 114/190 (60%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSRLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + ++   I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+   + + 
Sbjct: 67  IVEIEKHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092c PRE8
          Length = 250

 Score =  147 bits (371), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 117/190 (61%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R +   NY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA S+G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNNE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type
           subunit,
          Length = 250

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 117/190 (61%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +GIV+A E+K +S+L   DT + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIVIATEKKSSSSLALPDT-VS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ AR +   NY + Y E  P +ILV  ++ I Q  T
Sbjct: 63  KVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYGEYPPTKILVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG Y  WKA ++G  +SAA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWKATAIGKGSSAAKTFLEKRWNEE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.120
           YOL038W
          Length = 254

 Score =  146 bits (369), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 114/181 (62%), Gaps = 5/181 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSI-- 63
           YD   +IFSP+G ++QVEYALE++      +GI   D +VL  ER+  STL  QDT I  
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCTVGIKGTDCVVLGCERR--STLKLQDTRITP 61

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
            K+ K+++ I ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YT
Sbjct: 62  SKISKIDNHIVLSFSGLNADSRILIEKARVEAQSHKLTVEDPVTVEYLTRYIAGVQQRYT 121

Query: 124 QHGGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFG+S + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  
Sbjct: 122 QSGGVRPFGISTLIAGFDPRDNTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYDR 181

Query: 183 D 183
           D
Sbjct: 182 D 182

>KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  145 bits (367), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 119/190 (62%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R +   +Y + YNE  P ++LV  +++I Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHQGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893)
           [765 bp, 254 aa] {ON} highly similar to uniprot|P40303
           Saccharomyces cerevisiae YOL038W PRE6 20S proteasome
           alpha-type subunit
          Length = 254

 Score =  145 bits (367), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 110/179 (61%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +IFSP+G ++QVEYALE++      +GI   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVIGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ AGL AD+ ILI  AR+ AQ++  T  + + V+ L R ++ ++Q YTQ 
Sbjct: 64  IAKIDSHVVLSFAGLNADSRILIEKARVEAQSHKLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGVYSAWSAQAIGRNSKTVREFLEKNYARD 182

>TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.120
           YOL038W
          Length = 256

 Score =  145 bits (366), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 114/181 (62%), Gaps = 5/181 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSI-- 63
           YD   +IFSP+G ++QVEYALE++      +GI   D +VL  ER+  STL  QDT I  
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVLGCERR--STLKLQDTRITP 61

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
            K+ K+++ I ++ +GL AD+ ILI  ARI AQ++  T  + + +E L R ++ ++Q YT
Sbjct: 62  SKISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLEDPVSIEYLTRYIAGVQQRYT 121

Query: 124 QHGGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  
Sbjct: 122 QSGGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYNK 181

Query: 183 D 183
           D
Sbjct: 182 D 182

>NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120
          Length = 253

 Score =  145 bits (366), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 115/191 (60%), Gaps = 4/191 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +IFSP+G ++QVEYALE++      +GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDNKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --MRLDEAIEL 192
               ++E + L
Sbjct: 184 PPKNVEECVRL 194

>NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  145 bits (366), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 117/190 (61%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL +++   T IGI   +GIV+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIVIATEKKSSSPLALTET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R +   NY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038w PRE6
          Length = 254

 Score =  144 bits (364), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 113/182 (62%), Gaps = 6/182 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSI-- 63
           YD   +IFSP+G ++QVEYALE++      +G+   D +VL  ER+  STL  QDT +  
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLGCERR--STLKLQDTRVIA 61

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
            K+  ++  + ++ AGL AD+ IL+N AR+ AQ++  T  + + VE + R ++ ++Q YT
Sbjct: 62  SKVLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPVTVEYMARYVAGVQQKYT 121

Query: 124 QHGGLRPFGVSFIYAGYDDR--YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Q GG+RPFGVS + AG+D R     +LY + PSG Y+ W A ++G N+   +  L+ +Y 
Sbjct: 122 QSGGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQAIGRNSKTVREFLEKNYN 181

Query: 182 DD 183
            +
Sbjct: 182 RE 183

>Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131)
           [765 bp, 254 aa] {ON} ANNOTATED BY YGOB -
          Length = 254

 Score =  144 bits (364), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 110/179 (61%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +IFSP+G ++QVEYALE++      +GI   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVVGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ AGL AD+ ILI  AR+ AQ++  T  + + V+ L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYVRD 182

>SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 aa]
           {ON} highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 252

 Score =  144 bits (362), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 110/179 (61%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +IFSP+G ++QVEYALE++      +GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  + ++ AGL AD+ ILI  AR+ AQ++  T  + + ++ L R ++ I+Q YTQ 
Sbjct: 64  ISQIDTHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSIDYLTRYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           GG+RPFGVS + AG+D   G  +LY + PSG Y+ W A ++G N+   +  L+ +Y  +
Sbjct: 124 GGVRPFGVSTLIAGFDPNDGVPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKE 182

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score =  144 bits (362), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 115/191 (60%), Gaps = 4/191 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +IFSP+G ++QVEYALE++      +GI   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  ARI AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARIEAQSHRLTLEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNREE 183

Query: 184 --MRLDEAIEL 192
               +DE + L
Sbjct: 184 PPENVDECVRL 194

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score =  144 bits (362), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 109/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +IFSP G ++QVEYALE++      +GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + ++++ + ++ AGL AD+ ILI  AR+ AQ++  T  + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQAIGRNSKTVREFLEKNY 179

>KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}
           Anc_5.64 YGR253C
          Length = 267

 Score =  144 bits (362), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 115/190 (60%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTSAITHDLYYDENIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDADDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + + +A
Sbjct: 187 WHSSLNMRDA 196

>ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253C PUP2 Alpha subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit zeta
          Length = 260

 Score =  143 bits (361), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 114/190 (60%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G++L  E++  S LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRANSPLLEAD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  ILEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDENISVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON}
           Anc_7.120 YOL038W
          Length = 254

 Score =  143 bits (360), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 110/179 (61%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +IFSP+G ++QVEYALE++      +G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGTNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K+++ I ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D
Sbjct: 124 GGVRPFGVSTLIAGLDPRDNTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNKD 182

>Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  143 bits (360), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 112/178 (62%), Gaps = 5/178 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSI-- 63
           YD   +IFSP+G ++QVEYALE++      +G+   + +VL  ER+  STL  QDT I  
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERR--STLKLQDTRITP 61

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
            K+ K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YT
Sbjct: 62  SKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYT 121

Query: 124 QHGGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           Q GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 122 QSGGVRPFGVSTLIAGFDSRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  143 bits (360), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 116/190 (61%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAISET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R +   NY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa]
           {ON} similar to Ashbya gossypii AAR012C  1-intron
          Length = 251

 Score =  142 bits (359), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 108/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +IFSP G ++QVEYALE++      +G+   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGVKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ AGL AD+ ILI  AR+ AQ++  T  + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISKIDRHVILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTRPRLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNY 179

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score =  142 bits (359), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 113/191 (59%), Gaps = 4/191 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +IFSP+G ++QVEYA E++      +GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLGCERRSTLKLQDSRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVSVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGV+ + AG+D D    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --MRLDEAIEL 192
                DE + L
Sbjct: 184 PPATADECVRL 194

>YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha 4
           subunit of the 20S proteasome; may replace alpha 3
           subunit (Pre9p) under stress conditions to create a more
           active proteasomal isoform; GFP-fusion protein relocates
           from cytosol to the mitochondrial surface upon oxidative
           stress
          Length = 254

 Score =  142 bits (359), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 112/178 (62%), Gaps = 5/178 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSI-- 63
           YD   +IFSP+G ++QVEYALE++      +G+   + +VL  ER+  STL  QDT I  
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERR--STLKLQDTRITP 61

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
            K+ K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YT
Sbjct: 62  SKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYT 121

Query: 124 QHGGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           Q GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 122 QSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  142 bits (359), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 112/178 (62%), Gaps = 5/178 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSI-- 63
           YD   +IFSP+G ++QVEYALE++      +G+   + +VL  ER+  STL  QDT I  
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERR--STLKLQDTRITP 61

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
            K+ K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YT
Sbjct: 62  SKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYT 121

Query: 124 QHGGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           Q GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 122 QSGGVRPFGVSTLIAGFDARDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  142 bits (358), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 118/191 (61%), Gaps = 4/191 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTL-LEQDTSI 63
           RY    T FSP G+L Q++YAL ++    T +GI   +G+++A E+K +S+L L +D  I
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKTSSSLALTED--I 61

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGY 122
            K+  L   I    +G+  D  +L++ +R +   NY + Y E    ++LV  ++ + Q  
Sbjct: 62  SKISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPSTKLLVSEIAKVMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA S+G  ++AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNN 181

Query: 183 DMRLDEAIELA 193
           ++ L++AI +A
Sbjct: 182 ELELEDAIHIA 192

>Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  142 bits (358), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 116/190 (61%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKTSSPLAMSET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R +   +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  142 bits (358), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 112/178 (62%), Gaps = 5/178 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSI-- 63
           YD   +IFSP+G ++QVEYALE++      +G+   + +VL  ER+  STL  QDT I  
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERR--STLKLQDTRITP 61

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
            K+ K++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YT
Sbjct: 62  SKVSKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYT 121

Query: 124 QHGGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           Q GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 122 QSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON}
           (252377..253141) [765 nt, 255 aa]
          Length = 254

 Score =  142 bits (357), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 113/178 (63%), Gaps = 5/178 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSI-- 63
           YD   +IFSP+G ++QVEYALE++      +GI   + +VL  ER+  STL  QDT I  
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGENCVVLGCERR--STLKLQDTRITP 61

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
            K+ K+++ + ++ +GL AD+ ILI  ARI AQ++  T  + I VE L R ++ ++Q YT
Sbjct: 62  SKISKIDNHVILSFSGLNADSRILIEKARIEAQSHKLTLEDPISVEYLTRYVAGVQQRYT 121

Query: 124 QHGGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           Q GG+RPFG+S + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 122 QSGGVRPFGISTLIAGFDPNDKTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNY 179

>YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}
           PUP2Alpha 5 subunit of the 20S proteasome involved in
           ubiquitin-dependent catabolism; human homolog is subunit
           zeta
          Length = 260

 Score =  142 bits (357), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 113/190 (59%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  142 bits (357), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 113/190 (59%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLSLKEA 196

>Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C
           (REAL)
          Length = 260

 Score =  142 bits (357), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 113/190 (59%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  142 bits (357), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 113/190 (59%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   + FSPEGRL+QVEY+LE+I    T IGI   +G+VL  E++ TS LLE D SIEK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDMRLDEA 189
           +   + L EA
Sbjct: 187 WHSSLTLKEA 196

>Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  141 bits (356), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 116/190 (61%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R +   +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432)
           [750 nt, 250 aa]
          Length = 249

 Score =  141 bits (356), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 117/191 (61%), Gaps = 4/191 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTL-LEQDTSI 63
           RY    T FSP G+L Q++YAL ++    T +GI   +G+++A E+K +S L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTEDVS- 62

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGY 122
            K+  L   I    +G+  D  +L++ +R +   NY + Y E  P ++LV  ++ I Q  
Sbjct: 63  -KISLLTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATAIGKGSIAAKTFLEKRWNN 181

Query: 183 DMRLDEAIELA 193
           ++ L++AI +A
Sbjct: 182 ELELEDAIHIA 192

>NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  141 bits (356), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 117/190 (61%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL +++   T +GI   +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSLGIKATNGVVIATEKKSSSPLALTET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R +   NY + Y    P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGVYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHKGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}
           PRE8Alpha 2 subunit of the 20S proteasome
          Length = 250

 Score =  141 bits (356), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 116/190 (61%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R +   +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,
           250 aa] {ON} highly similar to uniprot|P23639
           Saccharomyces cerevisiae YML092C PRE8 20S proteasome
           beta-type subunit
          Length = 250

 Score =  140 bits (353), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 116/190 (61%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +G+++A E+K +S L   + S+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTE-SLS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R +   +Y + Y E  P +ILV  ++   Q  T
Sbjct: 63  KVALITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKILVSEIAKTMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA ++G + +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKSATAAKTFLEKRWNEE 182

Query: 184 MRLDEAIELA 193
           + L++AI +A
Sbjct: 183 LELEDAIHIA 192

>KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {ON}
           Anc_7.120 YOL038W
          Length = 266

 Score =  139 bits (351), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 107/176 (60%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +IFSP+G ++QVEYALE++      +G+  P  +VL  ER+ T  L +  T+  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVRRGTCAVGVKGPRCVVLGCERRSTLKLQDPRTTPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  + ++ AGL+ADA +LI  AR  AQ++  T  + + VE + R ++ I+Q YTQ 
Sbjct: 64  VALVDTHVALSFAGLSADARVLIERARTEAQSHRLTLEDPVSVEYMARYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D      +LY + PSG Y+ W A ++G N    +  L+ +Y
Sbjct: 124 GGVRPFGVSTLVAGFDSGDDTPRLYHTEPSGIYSAWTAQTIGRNAKTVREFLEKNY 179

>TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  139 bits (349), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 115/189 (60%), Gaps = 2/189 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YA  ++    T IGI   +G+V+A+E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVVIASEKKSSSPLALTET-LS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R +   +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSVITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  +  +
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWKATAIGRGSTAAKTFLEKRWNAE 182

Query: 184 MRLDEAIEL 192
           + L++AI +
Sbjct: 183 LELEDAIHI 191

>TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON}
           Anc_7.120 YOL038W
          Length = 256

 Score =  138 bits (347), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 108/179 (60%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +IFSP+G ++QVEYA E++      +GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  + ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           GG+RPFGV+ + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D
Sbjct: 124 GGVRPFGVATLIAGFDPQDDTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRD 182

>TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {ON}
           Anc_8.871 YML092C
          Length = 256

 Score =  138 bits (347), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 76/196 (38%), Positives = 113/196 (57%), Gaps = 8/196 (4%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YAL ++    T +GI   +G+VLA E+K  S+L   + S++
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYALTAVKQGVTALGIKATNGVVLATEKKSGSSLALAE-SLD 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQ-NYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+  L   I    AG+  D  +L++ AR  A  NY + Y E  P   LV  ++ I Q  T
Sbjct: 63  KISLLTPNIGTVYAGMGPDCRVLVDKARKAAHTNYKRVYGEYPPTRQLVADVAAIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDD------RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
           Q GG+RPFGVS + AG+D+        G+ LY  +PSG Y  WKA +VG    AA+T L+
Sbjct: 123 QSGGVRPFGVSLLVAGHDNANENDSNSGFALYQVDPSGAYFPWKATAVGRGAVAAKTFLE 182

Query: 178 MDYKDDMRLDEAIELA 193
             + D++ L++A+ +A
Sbjct: 183 KRWHDELELEDAVHIA 198

>ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  137 bits (344), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 114/188 (60%), Gaps = 2/188 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           RY    T FSP G+L Q++YA  ++    T IG+   +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVIATEKKSSSPLALTET-LN 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTAR-IHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           K+ ++   I    +G+  D  +L++ +R +   +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RP+G S + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNEE 182

Query: 184 MRLDEAIE 191
           + L++AI 
Sbjct: 183 LELEDAIH 190

>ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 290

 Score =  124 bits (312), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 100/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA++++ +  T IGI   DG+V A E+ V+S LL    ++ K
Sbjct: 8   YDLANSVFSPDGRNFQVEYAVKAVENGTTSIGIRCNDGVVFAVEKLVSSKLLVPKRNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  +    +GL  D   L+N  R  AQ++ KT+ E IP++ L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCVYSGLIPDGRHLVNRGREEAQSHKKTFGESIPLQALADRLGYYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G DD+ G  LY   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDDK-GPHLYMLEPSGTFWGYKGAATGKGRQTAKAELE 177

>CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362c PRE10
          Length = 290

 Score =  124 bits (311), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 104/190 (54%), Gaps = 4/190 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA +++ +  T IGI   DG+V A E+ +TS LL  + ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDGVVFAVEKIITSKLLVPNKNL-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I V  +GL  D   L+N AR  +QN+ K Y   IPV+    R+    Q +T  
Sbjct: 67  IQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYGSAIPVDAFAERVGQYVQAHTLF 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDD 183
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G     A+  L+  +D   +
Sbjct: 127 NSVRPFGVTAIFGGC-DKNGPHLYMLEPSGTYWGYNGAATGKGRQTAKAELEKLLDKTPE 185

Query: 184 MRLDEAIELA 193
           M   EA + A
Sbjct: 186 MSAKEAAKHA 195

>TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON}
           Anc_7.20 YOR362C
          Length = 278

 Score =  122 bits (307), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA++++ +  T +GI   DG+V A E+ ++S LL    ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCDDGVVFAVEKIISSKLLVPKRNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A N+ K Y + IPV  L  R+S   Q YT +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRYLVNRGREEASNFKKLYTKPIPVSALADRISQYVQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+S I  G D+  G  LY   PSG   G+K  + G    AA+  L+
Sbjct: 127 NSVRPFGISAIIGGIDED-GSHLYMVEPSGTCWGYKGAATGKGRQAAKAELE 177

>Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON}
           complement(86524..87348) [825 nt, 275 aa]
          Length = 274

 Score =  121 bits (304), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 108/191 (56%), Gaps = 5/191 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA++++ +  T +GI   DG+V A E+ ++S LL    ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCNDGVVFAVEKLISSKLLVPKKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  ++++ + Y++ IP+     R+    Q +T +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESKSFSQMYSKRIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---KD 182
             +RPFGVS I+ G DD  G  LY   PSG+Y G+K  + G+    A+T L+  +    D
Sbjct: 127 NSVRPFGVSAIFGGIDDE-GSHLYMIEPSGSYWGYKGAAAGSGRQIAKTELEKLFDKNPD 185

Query: 183 DMRLDEAIELA 193
            +   EAI+ A
Sbjct: 186 GLSAREAIKQA 196

>KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {ON}
           highly similar to uniprot|P21242 Saccharomyces
           cerevisiae YOR362C PRE10 20S proteasome alpha-type
           subunit
          Length = 277

 Score =  121 bits (304), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 105/190 (55%), Gaps = 4/190 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA+++  +  T +G+   DGIVLA E+ VTS LL    + +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDGIVLAVEKLVTSKLLVPGKN-KK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  +  A +GL  D   L+N  R  A ++ KTY   IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYATPIPLPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMR 185
             +RPFG++ I  G DD  G  LY   PSG Y G+K  + G    +A+  L+    +   
Sbjct: 127 NSVRPFGITAIVGGVDDD-GAHLYMLEPSGTYWGYKGAATGKGRQSAKAELEKVISNKPE 185

Query: 186 LD--EAIELA 193
           LD  EA++ A
Sbjct: 186 LDAREAVKEA 195

>Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  121 bits (304), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA++++ +  T IGI   DG+V A E+ +TS LL    ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K YN  IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYNTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  120 bits (302), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 104/191 (54%), Gaps = 5/191 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA++++ +  T IGI   DG+V A E+ +TS LL    ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y   IPV     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYKTPIPVPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+     + D
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDQHTD 185

Query: 183 DMRLDEAIELA 193
            +   EA++ A
Sbjct: 186 GLTAKEAVKQA 196

>KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20
           YOR362C
          Length = 281

 Score =  120 bits (300), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA++++ +  T IGI   DG+V A E+ +TS L+  + +I K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCNDGVVFAVEKLITSKLMVPNKNI-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + ++ K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRHLVNRGREESSSFKKLYGKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG++ I+ G D+  G  LY   PSG+Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGITAIFGGVDED-GSHLYMLEPSGSYWGYKGAATGKGRQTAKAELE 177

>NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  120 bits (300), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA++++ +  T IGI   DG+V A E+ VTS LL    ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCDDGVVFAVEKIVTSKLLVPKRNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D    +N  R  A N+ K Y+  IP+     R+    Q +T +
Sbjct: 67  IQGIDRHIGCVYSGLIPDGRHFVNRGREEASNFKKLYSNAIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  G  LY   PSG Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEN-GPHLYMLEPSGTYWGYKGAATGKGRQTAKAELE 177

>YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}
           PRE10Alpha 7 subunit of the 20S proteasome
          Length = 288

 Score =  119 bits (298), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA++++ +  T IGI   DG+V A E+ +TS LL    ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 bp,
           279 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YOR362C (PRE10); 1-intron
          Length = 279

 Score =  117 bits (294), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA++++ +  T IGI   DG+V A E+ +TS LL    + +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIRCKDGVVFAVEKLITSKLLVPHKN-KK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y + IP+     R+    Q +T +
Sbjct: 67  IQTVDKHIGCVYSGLMPDGRHLVNIGRQEAADFRKYYRQPIPLPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+  I+ G D++ G  LY   PSG Y G++  + G    AA+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDEK-GPHLYMLEPSGAYWGYRGAAAGKGRQAAKAELE 177

>KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 aa]
           {ON} similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 275

 Score =  117 bits (294), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA++++ +  T +GI   DG+VLA E+ +TS LL    + +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDGVVLAVEKLITSKLLVPGKN-KK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y+  IP+     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYSTPIPIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D   G  LY   PSG Y G+K+ + G    +A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDSD-GAHLYMLEPSGTYWGYKSAATGKGRQSAKAELE 177

>Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}
           YOR362C (REAL)
          Length = 292

 Score =  117 bits (293), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 98/174 (56%), Gaps = 6/174 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLL--EQDTSI 63
           YD   ++FSP+GR +QVEYA++++ +  T IGI   DG+V A E+ +TS LL  +++T I
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCDDGVVFAVEKLITSKLLVPQKNTKI 67

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYT 123
           +    ++  I    +GL  D   L+N  R  A ++ K Y   IP+     RL    Q +T
Sbjct: 68  Q---VVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHT 124

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            +  +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 125 LYNSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL011C (SCL1)
          Length = 246

 Score =  115 bits (288), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 96/191 (50%), Gaps = 4/191 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +      + I      VL  ++KV   LLE 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCTVLVNQKKVPDKLLEP 60

Query: 60  DTSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T +  L+ +   I +   G  ADA  +    R  A  +   Y  D+PV +L +R +++ 
Sbjct: 61  ST-VTYLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGYDMPVHVLAKRFANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YKDDM--RLDE 188
           +K     RLDE
Sbjct: 180 FKKLQKDRLDE 190

>TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON}
           Anc_7.20 YOR362C
          Length = 274

 Score =  115 bits (289), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QV+YA++++ +  T IGI   DG+V A E+ VTS LL    ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKDGVVFAVEKLVTSKLLVPKKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + ++ K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKLYQKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  G  LY   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEE-GPHLYMLEPSGAHWGYKGAATGKGRQTAKAELE 177

>KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20
           YOR362C
          Length = 279

 Score =  115 bits (289), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/188 (34%), Positives = 99/188 (52%), Gaps = 10/188 (5%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA +++ +  T +G++  DG+VLA E+ V S LL + +   K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAAKAVENGATSVGLLCEDGVVLAVEKLVASKLLVKASPQNK 67

Query: 66  LYKLNDKIT-------VAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDI 118
               N KI         A +GL  D   L+N AR  +Q + + Y  DIP   L  R+   
Sbjct: 68  GSGANTKIQTVGRHIGCACSGLVPDGRHLVNRAREESQQFKQLYKRDIPPVALADRMGQY 127

Query: 119 KQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            Q +T +  +RPFGV+ I+ G D       LY   PSG Y G++  + G    +A+  L+
Sbjct: 128 VQAHTLYNSVRPFGVAAIFGGVDPETAEPHLYMLEPSGVYWGYRGAATGKGRQSAKAELE 187

Query: 178 --MDYKDD 183
             +  +DD
Sbjct: 188 KLISSRDD 195

>Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}
           similar to Ashbya gossypii ADR401C
          Length = 285

 Score =  115 bits (288), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA++++ +  T IGI   DG+V A E+ + S LL    + EK
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSIGIKCKDGVVFAVEKLINSKLLVPSKN-EK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y + I +     R+    Q +T +
Sbjct: 67  IQTIDKHIGCVYSGLMPDGRHLVNIGRQEANSFRKLYRKPITIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+  I+ G DD  G  LY   PSG Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDDE-GAHLYMLEPSGAYWGYKGAATGKGRQSAKAELE 177

>SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369)
           [846 bp, 281 aa] {ON} similar to uniprot|P21242
           Saccharomyces cerevisiae YOR362C PRE10 20S proteasome
           alpha-type subunit
          Length = 281

 Score =  115 bits (287), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 104/190 (54%), Gaps = 4/190 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   +++SP+GR +QVEYA++++ +  T +GI   DG+V A E+ VTS LL    + +K
Sbjct: 8   YDLSNSVYSPDGRNFQVEYAVKAVENGATSVGIKFRDGVVFAVEKLVTSKLLVPGKN-KK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y++ IPV     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSQPIPVPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDD 183
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G    +A+  L+     K D
Sbjct: 127 NSVRPFGVTAIFGGV-DKDGAHLYMLEPSGTYWGYTGAATGKGRQSAKAELEKLATSKPD 185

Query: 184 MRLDEAIELA 193
           +   EA++ A
Sbjct: 186 LSPREAVKEA 195

>TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20
           YOR362C
          Length = 277

 Score =  115 bits (287), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR++QVEYA +++ +  T IGI   DG+V A E+ ++S LL    ++ K
Sbjct: 8   YDLSNSVFSPDGRIFQVEYANKAVENGATSIGIKCTDGVVFAVEKIISSKLLVPKKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + N+ K Y + I +     R+    Q YT +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESANFKKVYGQPIGIPAFADRIGQYIQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G D   G  LY   P+G + G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSAIFGGIDSE-GPHLYMVEPNGAFWGYKGAATGKGRQSAKAELE 177

>Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to
           Ashbya gossypii AGL089W
          Length = 246

 Score =  113 bits (283), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 95/182 (52%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +      + I   + +VL  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIKGKNCVVLVNQKKVPDKLLDP 60

Query: 60  DTSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T +  ++ ++  I +   G   DA  +    +  A  +   Y  DIPV +L +RL+++ 
Sbjct: 61  AT-VSYMFPISKHIGMCATGPIGDARNVAVRCKSMAAEFRYEYGYDIPVHVLAKRLANLA 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEKGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  114 bits (284), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEK 65
           YD   ++FSP+GR +QVEYA +++ +  T IGI   DG+V A E+ +TS LL    ++ K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAGKAVENGATSIGIKCKDGVVFAVEKIITSKLLVPKKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y+  IP+     RL    Q +T +
Sbjct: 67  IQGVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYDLPIPISAFAERLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D++ G  LY   PSG   G+   + G     A+  L+
Sbjct: 127 NSVRPFGVTSIFGGIDEK-GPHLYMLEPSGTCWGYNGAATGKGRQTAKAELE 177

>KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  111 bits (278), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 97/191 (50%), Gaps = 4/191 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +      I I      V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTASVVISQKKVPDKLLDP 60

Query: 60  DTSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T +  ++ +   I     G   DA  +    +  A  +   Y  DIP  +L +R++++ 
Sbjct: 61  KT-VSYIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGYDIPCSVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP G+   +  YD+  G  ++  +P+G YTG+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKATATGPKQQELNSALEKH 179

Query: 180 YK--DDMRLDE 188
           +K   D ++DE
Sbjct: 180 FKKLKDDKIDE 190

>TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  110 bits (274), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 93/179 (51%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRLYQVEYA ++ +      I I      V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNKCAVIVNQKKVPDKLLDPST-VS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA+     A+     Y   Y  D+P ++L +R+++I Q YTQ
Sbjct: 71  YIFPISKTIGLVANGPIPDAKNAATKAKTETAEYRYKYGYDMPCDVLAKRMANIAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
              +RP GV   +  YD+  G  +Y ++P+G Y G+KA + G       T L+  +K +
Sbjct: 131 RAYMRPLGVILTFISYDEELGPSIYKTDPAGYYVGYKATATGPKQQEINTGLENWFKKN 189

>Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {ON}
           complement(125355..126125) [771 nt, 257 aa]
          Length = 256

 Score =  108 bits (270), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 94/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRLYQVEYA ++ +      I I   +  V+  ++KV   LL+ +T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNNCSVIINQKKVPDKLLDAET-VS 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            +++++  I +   G   DA       +  A  +   Y  D+PV++L +R++++ Q YTQ
Sbjct: 72  YIFQISRTIGMVANGPIPDARNAAIRCKAEAAEFRYKYGYDMPVDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y S+PSG Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSLDEEKGPSIYKSDPSGYYVGYKATATGPKQQEISTSLENFFK 188

>KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  106 bits (264), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 92/182 (50%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +      + I   D  V+  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCCVVINQKKVPDKLLDP 60

Query: 60  DTSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T +  L+ ++  I +   G   DA      A+     Y   Y  D+P ++L +R++++ 
Sbjct: 61  ST-MSYLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C
           (SCL1) - Proteasome subunit YC7alpha/Y8 (protease yscE
           subunit 7) [contig 207] FULL
          Length = 246

 Score =  106 bits (264), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 95/182 (52%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +      I I   D  V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSIAIRGTDCCVIISQKKVPDKLLDP 60

Query: 60  DTSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            T +  L++++  + +   G   DA      A+  A  Y   Y  D+P ++L +R++++ 
Sbjct: 61  ST-MSYLFQISRHVGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON}
           Anc_5.1 YMR314W
          Length = 233

 Score =  104 bits (260), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 100/193 (51%), Gaps = 6/193 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+       L A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYACLVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLK-TYNEDIPVEILVRRLSDIK 119
           +  +K+ K +D + +++AGL  DA +L N  R H  NY K  YN ++ +E +   LSD  
Sbjct: 58  SYQKKIIKCDDHVGLSLAGLAPDARVLSNFVRQHC-NYSKLVYNRELSMEKIGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q  TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  ++T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLVGY-DKSGPHLIEFQPSGNILELYGAAIGARSQGSRTYLERV 175

Query: 180 YKDDMRLDEAIEL 192
             D + +++A EL
Sbjct: 176 MDDFLPVEDATEL 188

>TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.110
           YGL011C
          Length = 257

 Score =  105 bits (262), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 91/177 (51%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRL+QVEYA ++ +      + +   D  V+  ++KV   LL+ DT + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKACNQTNINSVAVRGNDCTVIINQKKVPDKLLDADT-VS 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA       +  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGPIPDARNAALRCKAEAAEFRYKYGYDMPADVLAKRMANLAQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y S+PSG Y G+K  + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFISVDEEKGPSIYKSDPSGYYIGYKVTATGPKQQEIATSLENFFK 188

>SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 248

 Score =  105 bits (261), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 98/184 (53%), Gaps = 2/184 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +      + I   + +V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGTNCVVVVSQKKVPDKLLDS 60

Query: 60  DTSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
           +T +  ++K++  + +   G   DA      A+  A  +   Y  D+P ++L +R++++ 
Sbjct: 61  NT-VSYIFKVSPHVGMVANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRIANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G + G+KA + G       T L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEENGPSVYKCDPAGYFVGYKATATGPKQQELDTSLEKF 179

Query: 180 YKDD 183
           +K +
Sbjct: 180 FKKN 183

>YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}
           SCL1Alpha 1 subunit of the 20S proteasome involved in
           the degradation of ubiquitinated substrates; 20S
           proteasome is the core complex of the 26S proteasome;
           essential for growth; detected in the mitochondria
          Length = 252

 Score =  105 bits (261), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRLYQVEYA ++ +      + +   D  V+ +++KV   LL+  T++ 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON}
           Anc_4.110
          Length = 253

 Score =  104 bits (260), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 93/177 (52%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-GIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRLYQVEYA ++ +      + +   +  V+  ++KV   LL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNVNSVAVRGTNCTVVINQKKVPDKLLDPST-VS 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  + +   G   DA      A++ A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRHVGMVANGPIPDARNAAMRAKMEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPRQQEITTSLENYFK 188

>Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON}
           YML092C (PRE8) - proteasome component Y7 [contig 336]
           FULL
          Length = 173

 Score =  102 bits (254), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 75/116 (64%), Gaps = 3/116 (2%)

Query: 80  LTADAEILINTAR--IHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIY 137
           +  D  +LI+ +R   H Q Y + YNE  P +ILV  ++ I Q  TQ GG+RPFGVS + 
Sbjct: 1   MGPDFRVLIDKSRKVAHTQ-YKRIYNEYPPTKILVAEVAKIMQEATQSGGVRPFGVSLLV 59

Query: 138 AGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           AGYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D++ L++AI +A
Sbjct: 60  AGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDELELEDAIHIA 115

>Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  103 bits (258), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRLYQVEYA ++ +      + I   +  V+ +++KV   LL+ +T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGKNCTVVISQKKVPDKLLDPNT-VS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 253

 Score =  103 bits (258), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 92/173 (53%), Gaps = 2/173 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRLYQVEYA ++ +      + I   +  V+ +++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTSINSLAIRGKNCSVIISQKKVPDKLLDPST-VS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++K++  I + + G   DA      A+     +   +  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFKISKTIGMVINGPIPDARNAALRAKAETAEFRYKFGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
              +RP GV   Y   D+  G  +Y S+P+G + G+KA + G       T L+
Sbjct: 131 RAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYFVGYKATATGPKQQEITTRLE 183

>KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  103 bits (257), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 96/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+      VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAVLVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  D  +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERTL 176

Query: 181 KDDMRLDEAIEL 192
           +D + LD+A +L
Sbjct: 177 QDYLELDDADDL 188

>Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  103 bits (257), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRLYQVEYA ++ +      + +   +  V+ +++KV   LL+  T++ 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  102 bits (255), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 94/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRLYQVEYA ++ +      + +   +  V+ +++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPAT-VS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  102 bits (254), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 94/179 (52%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRL+QVEYA ++ +      + +   +  V+  ++KV   LLE  T + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGRNSTVVINQKKVPDKLLEAST-VS 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  D+P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGAIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
              +RP GV   +   D+  G  +Y ++P+G + G+KA + G       T L+  +K++
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYFVGYKATATGPKQQEISTRLENSFKNN 190

>CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011c SCL1
          Length = 254

 Score =  102 bits (253), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 92/177 (51%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRLYQVEYA ++ +      + +   +  V+  ++KV   LL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNLNSLAVRGKNCSVIINQKKVPDKLLDPST-VS 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++K++  I +   G   DA      A+  A  +   Y  D+P ++L +R++++ Q YTQ
Sbjct: 72  YIFKISKTIGMVANGPIPDARNAAARAKGEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       T L+  YK
Sbjct: 132 RAYMRPLGVILTFISVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTTSLENYYK 188

>Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON}
           similar to Ashbya gossypii AGL336W
          Length = 233

 Score =  100 bits (248), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 98/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+     +VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSEKYVVLVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         YN ++ +      LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRNLSLVKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDMRLDEAIEL 192
           ++ ++++ A EL
Sbjct: 177 EEYLKIETADEL 188

>CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314w PRE5
          Length = 233

 Score =  100 bits (248), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 94/192 (48%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+   D  VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKDYAVLVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         YN  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRKLSVEKAGHMLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDNS-GPHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDMRLDEAIEL 192
            D + + +A EL
Sbjct: 177 DDYLAITDATEL 188

>KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  100 bits (248), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 91/177 (51%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-GIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRL+QVEYA ++ +      + I      V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNVNSMAIRGETCSVIVNQKKVPDKLLDPST-VS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  D+P ++L +R++++ Q YTQ
Sbjct: 71  YIFPISKTIGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y S+P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFK 187

>KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score = 99.0 bits (245), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 95/193 (49%), Gaps = 6/193 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPD-GIVLAAERKVTSTLLEQ 59
           M    YD  T  FSP GRL+QVEYALE+I      +G+      +V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAVVVALKRNAD----EL 56

Query: 60  DTSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIK 119
            +  +K+ K +D + V++AGL  DA +L N  R         YN  + +E     LSD  
Sbjct: 57  SSYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLALERAGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q  TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLIGYDNT-GAHLLEFQPSGNTLELYGTAIGARSQGAKTYLERV 175

Query: 180 YKDDMRLDEAIEL 192
             D   +++A EL
Sbjct: 176 LDDFREIEDADEL 188

>Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {ON}
           YMR314W (PRE5) - alpha-type of subunit of 20S proteasome
           [contig 73] FULL
          Length = 233

 Score = 98.6 bits (244), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 94/192 (48%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+      VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKHAVLVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  D  +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERTL 176

Query: 181 KDDMRLDEAIEL 192
            + + +++  EL
Sbjct: 177 NEYLEIEDEDEL 188

>AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR314W (PRE5)
          Length = 306

 Score = 99.4 bits (246), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 96/189 (50%), Gaps = 4/189 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+     +VL A ++    L    
Sbjct: 74  MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSNKYVVLVALKRNADEL---S 130

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K +D + +++AGL  DA +L N  R         Y  D+ V    + LSD  Q
Sbjct: 131 SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSQLVYARDLSVVKAGQLLSDKAQ 190

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 191 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 249

Query: 181 KDDMRLDEA 189
           ++ + +++A
Sbjct: 250 EEYLEIEDA 258

>Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON}
           complement(1850..2551) [702 nt, 234 aa]
          Length = 233

 Score = 97.4 bits (241), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 95/192 (49%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+      VLAA ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNKYAVLAALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N  + VE     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCHYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLLIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLEKVM 176

Query: 181 KDDMRLDEAIEL 192
            + + L++  EL
Sbjct: 177 DNFVDLEDPEEL 188

>NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON}
           Anc_5.1
          Length = 233

 Score = 96.7 bits (239), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 93/192 (48%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+      VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYAVLVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +A+AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SFQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSDMVFNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGY-DKSGPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDMRLDEAIEL 192
              + +++A EL
Sbjct: 177 DKFVEIEDAEEL 188

>ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score = 96.3 bits (238), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 94/192 (48%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+      V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKLGSVTVGLRSNKHAVVVALKRNADDL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         YN  + VE +   L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNFLRQQCNYSQLVYNRKLSVERVGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLVVGYDNS-GPHLLEFQPSGNVLELYGTAIGARSQGAKTYLEKTL 176

Query: 181 KDDMRLDEAIEL 192
           +  + +++  EL
Sbjct: 177 EQFLEVEDPNEL 188

>YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha 6
           subunit of the 20S proteasome
          Length = 234

 Score = 96.3 bits (238), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 91/187 (48%), Gaps = 4/187 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+      VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN T     ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDMRLD 187
              +++D
Sbjct: 177 DTFIKID 183

>KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1
           YMR314W
          Length = 235

 Score = 95.9 bits (237), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 92/179 (51%), Gaps = 8/179 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPD-GIVLAAERKVTSTLLEQ 59
           M    YD  T  FSP GRL+Q+EYA+E+I      +G+   +   V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQLEYAIEAIKQGSVTVGLRSKNYACVVALKRNAD----EL 56

Query: 60  DTSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLK-TYNEDIPVEILVRRLSDI 118
            +  +K+ K +D + +++AGL  DA +L N  R    NY K  +N D+ VE     LSD 
Sbjct: 57  SSYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQC-NYSKLVFNRDLSVEKAGFLLSDK 115

Query: 119 KQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            Q  TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  ++T L+
Sbjct: 116 AQKNTQSYGGRPYGVGLLVVGY-DKTGPHLLEFQPSGNVMELYGTAIGARSQGSKTYLE 173

>NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1
          Length = 233

 Score = 95.5 bits (236), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 92/192 (47%), Gaps = 10/192 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+      VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKKHAVLVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +A+AGL  DA +L N  R         YN  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSSLIYNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGHDNS-GPHLLEFQPSGNTVELYGSAIGARSQGAKTYLE--- 173

Query: 181 KDDMRLDEAIEL 192
                LD+ IE+
Sbjct: 174 ---RVLDQFIEI 182

>Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score = 95.5 bits (236), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 90/187 (48%), Gaps = 4/187 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+      VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTSIGARSQGAKTYLERTL 176

Query: 181 KDDMRLD 187
              +++D
Sbjct: 177 DTFIKID 183

>Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score = 95.5 bits (236), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 90/187 (48%), Gaps = 4/187 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+      VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K +D + +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDMRLD 187
              +++D
Sbjct: 177 DTFIKID 183

>TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5.1
           YMR314W
          Length = 233

 Score = 94.7 bits (234), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 92/192 (47%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  +  FSP GRL+QVEYALE+I      +G+      VL A ++    L    
Sbjct: 1   MFRNNYDGDSVTFSPTGRLFQVEYALEAIKQGSVTVGLRSHKYAVLVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K +  + +++AGL  DA +L N  R         ++  + VE     LSD  Q
Sbjct: 58  SYQKKIIKCDTHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFDRKLSVEKAGSLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLVIGYDNS-GSHLLEFQPSGNVLELYGSSIGARSQGAKTYLERVL 176

Query: 181 KDDMRLDEAIEL 192
            D + +D   EL
Sbjct: 177 DDFLEIDNVEEL 188

>KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score = 94.7 bits (234), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 93/179 (51%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TGIGIMVPDGIVLAAERKVTSTLLEQDTSIE 64
           YD   TIFSPEGRL+QVEYA ++ +      + +   +  V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGKNCAVVINQKKVPDKLLDPAT-LS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQ 124
            ++ ++  + +   G   DA      A+  A  +   Y  D+P + L +R++++ Q YTQ
Sbjct: 71  YIFPISRHVGMLANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDALAKRMANLAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
              +RP GV   +  +D+  G  +Y ++P+G + G+KA + G       T L+  +K +
Sbjct: 131 RAYMRPLGVILTFISFDEELGPSIYKTDPAGYFVGYKATATGPKQQEITTSLENYFKKN 189

>Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score = 94.0 bits (232), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 90/187 (48%), Gaps = 4/187 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+      VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N  + +E     L D  Q
Sbjct: 58  SFQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAIERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDMRLD 187
              +++D
Sbjct: 177 DTFIKID 183

>TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON} 
          Length = 233

 Score = 93.2 bits (230), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 88/177 (49%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+   +  V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKNYAVITALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         +N  + VE     LSD  Q
Sbjct: 58  SYQKKIIRCDEHLGLSLAGLAPDARVLSNYLRQQCNYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 QNTQSYGGRPYGVGLLIIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLE 173

>SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314W PRE5 20S proteasome alpha-type subunit
          Length = 233

 Score = 92.4 bits (228), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 94/192 (48%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+      V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSKKHAVVVALKRNADEL---S 57

Query: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120
           +   K+ K ++ + +++AGL  DA +L N  R         +N  + +E     L D  Q
Sbjct: 58  SYQNKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLSLEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGHDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDMRLDEAIEL 192
           ++ + +++A EL
Sbjct: 177 EEYLEIEDADEL 188

>TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON}
           Anc_5.1 YMR314W
          Length = 238

 Score = 84.3 bits (207), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 91/197 (46%), Gaps = 9/197 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEY-----ALESISHAGTGIGIMVPDGIVLAAERKVTST 55
           M    YD  T  FSP GRL+QV+Y     ALE+I      +G+      VL A ++    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLHSKKYAVLVALKRNADE 60

Query: 56  LLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRL 115
           L    +   K+ K ++ + +++AGL  DA +L N  R         +N  + VE     L
Sbjct: 61  L---SSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNLVFNRKLSVEKAGHLL 117

Query: 116 SDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTL 175
            D  Q  TQ  G RP+GV  +  G+ D+ G  L    PSGN       ++GA +  A+T 
Sbjct: 118 CDKAQKNTQSYGGRPYGVGLLIIGH-DKSGAHLLEFQPSGNTLELYGSAIGARSQGAKTY 176

Query: 176 LQMDYKDDMRLDEAIEL 192
           L+      + +++  EL
Sbjct: 177 LERTLDTFLEIEDPNEL 193

>Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C
           (PRE10) - proteasome component YC1 (protease yscE
           subunit 1) [contig 44] FULL
          Length = 196

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 59/113 (52%), Gaps = 3/113 (2%)

Query: 83  DAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
           D   L+N AR  A ++ KTY   I +  L  RL    Q +T +  +RPFG++ I  G D+
Sbjct: 3   DGRHLVNRAREEAASFKKTYGTPITLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDE 62

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDDMRLDEAIELA 193
             G  LY   PSG+Y G+K  + G    +A+  L+  +  K D+   EA++ A
Sbjct: 63  N-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKILSSKPDISAKEAVKEA 114

>NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON}
           Anc_4.110
          Length = 172

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 45/80 (56%)

Query: 102 YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWK 161
           Y  D+P ++L +R++++ Q YTQ   +RP GV   +   D+  G  +Y S+P+G Y G+K
Sbjct: 28  YGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYK 87

Query: 162 AISVGANTSAAQTLLQMDYK 181
           A + G       T L+  +K
Sbjct: 88  ATATGPKQQEITTNLENYFK 107

>Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 82/161 (50%), Gaps = 8/161 (4%)

Query: 34  TGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+   DG+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 31  TIVGVKYNDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
             G+      +S+G+ + AA  +L+  +K D+  DEA++LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAVKLA 184

>Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 81/159 (50%), Gaps = 8/159 (5%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           +G+   +G+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I +
Sbjct: 33  VGVKYKNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLIGS 90

Query: 96  QNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPS 154
              L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +  
Sbjct: 91  NIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHAH 145

Query: 155 GNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G+      +S+G+ + AA  +L+  +K D+  DEAI+LA
Sbjct: 146 GSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 89/186 (47%), Gaps = 22/186 (11%)

Query: 20  YQVEYALESISH-----AGTG---IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLND 71
           YQ    L S SH       TG   +G+    G+V+AA+ + T   +  D +  KL++++ 
Sbjct: 9   YQRNSFLSSKSHKQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITVAVAGLTADAE----ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGG 127
           +I  A AG  AD E    ++ +   +H+   L T  E      +V  L  +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNIELHS---LSTRRE----PRVVTTLQMLKQHLFRYQG 121

Query: 128 LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLD 187
               G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ D+  D
Sbjct: 122 --HIGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESKWRADISKD 178

Query: 188 EAIELA 193
           EAIELA
Sbjct: 179 EAIELA 184

>Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 82/161 (50%), Gaps = 8/161 (4%)

Query: 34  TGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+   +G+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 31  TIVGVKYNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
             G+      +S+G+ + AA  +L+  +K D+  DEAI+LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 101/223 (45%), Gaps = 17/223 (7%)

Query: 20  YQVEYALESISHA-----GTG---IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLND 71
           YQ    L + SHA      TG   +G+    G+V+AA+ + T   +  D + EKL++++ 
Sbjct: 9   YQRNQFLAAKSHAQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCEKLHRISP 68

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  I +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TQLIGSNIELHSLYTNREPR--VVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAI 190
            G   I AG D   G  L++ +  G+       S+G+ + AA  +L+ ++K ++  +EAI
Sbjct: 123 VGAYLIVAGVDPT-GAHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWKQNLSREEAI 181

Query: 191 ELAXXXXXXXXXXXXXXXXXXEFATIKKGKNDGEVYQKIYKPD 233
           ELA                  +   ++ GK D E+ +    P+
Sbjct: 182 ELASNAIEAGIWNDLGSGSNVDICVMEVGK-DAELLRNYLTPN 223

>KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 83/159 (52%), Gaps = 8/159 (5%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           +G+   +G+V+AA+ + T   +  D +  KL++++ +I  A AG  AD E +  T  I +
Sbjct: 34  VGVKFHNGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAV--TQLIGS 91

Query: 96  QNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPS 154
              L + Y +  P   +V  L  +KQ   ++ G    G   I AG D   G  L++    
Sbjct: 92  NVELHSLYAKRQPR--VVTALQMLKQHLFKYQG--HIGAYLIVAGTDPT-GAHLFSVQAH 146

Query: 155 GNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G+      +S+G+ + AA  +L+ ++K+D+  +EAI+LA
Sbjct: 147 GSTDVGFYLSLGSGSLAAMAVLESNWKEDLSKEEAIKLA 185

>YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}
           PUP1Beta 2 subunit of the 20S proteasome; endopeptidase
           with trypsin-like activity that cleaves after basic
           residues; synthesized as a proprotein before being
           proteolytically processed for assembly into 20S
           particle; human homolog is subunit Z
          Length = 261

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 82/161 (50%), Gaps = 8/161 (4%)

Query: 34  TGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+   +G+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 31  TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
             G+      +S+G+ + AA  +L+  +K D+  +EAI+LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLA 184

>NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON}
           Anc_5.507 YOR157C
          Length = 263

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 82/161 (50%), Gaps = 8/161 (4%)

Query: 34  TGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARI 93
           T +G+   DG+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  I
Sbjct: 32  TIVGLKYRDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 89

Query: 94  HAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 90  GSNIELHSLYTSRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
             G+      +S+G+ + AA  +L+  ++ ++  +EAIELA
Sbjct: 145 AHGSTDVGYYLSLGSGSLAAMAVLESQWRPELSKEEAIELA 185

>TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 88/183 (48%), Gaps = 16/183 (8%)

Query: 20  YQVEYALESISHA-----GTG---IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLND 71
           YQ    L S SHA      TG   +G+   +G+V+AA+ + T   +  D +  KL++++ 
Sbjct: 9   YQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  I +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TQLISSNLELHSLYASREPR--VVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAI 190
            G   I AG D   G  L++ +  G+       S+G+ + AA  +L+  +K D+  +EAI
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKQDLTKEEAI 181

Query: 191 ELA 193
            LA
Sbjct: 182 NLA 184

>CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P25043 Saccharomyces
           cerevisiae YOR157c PUP1
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 84/169 (49%), Gaps = 8/169 (4%)

Query: 26  LESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAE 85
           +++ S   T +G+    G+V+AA+ + T   +  D +  KL++++ +I  A AG  AD E
Sbjct: 23  VKATSTGTTIVGVKFAGGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTE 82

Query: 86  ILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
            +  T  I +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   
Sbjct: 83  AV--TQLIGSNIELHSLYTNRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT- 135

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  L++ +  G+       S+G+ + AA  +L+  +K DM  +EAI+LA
Sbjct: 136 GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKPDMTKEEAIQLA 184

>ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 85/175 (48%), Gaps = 15/175 (8%)

Query: 24  YALESISHAGTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTA 82
           +A+   +  GT I G+    G+V+AA+ + T   +  D +  KL+++  +I  A AG  A
Sbjct: 20  HAVPKATSTGTTIVGVKYDKGVVIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAA 79

Query: 83  DAE----ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYA 138
           D E    ++ +   +H+Q     Y    P   +V  L  +KQ   ++ G    G   I A
Sbjct: 80  DTEAVTQLIGSNLELHSQ-----YANREPR--VVSALQMLKQHLFRYQG--HIGAYLIVA 130

Query: 139 GYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G D   G  L++    G+      +S+G+ + AA   L+ ++K ++  DEA++LA
Sbjct: 131 GVDPT-GAHLFSVQAHGSTDVGHYLSLGSGSLAAMATLESNWKQNLTKDEAVKLA 184

>Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to
           Ashbya gossypii AAR119W
          Length = 258

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 107/240 (44%), Gaps = 25/240 (10%)

Query: 27  ESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAE- 85
           ++ S   T +G+   +G+V+AA+ + T   +  + + EKL+K++ +I  A AG  AD + 
Sbjct: 24  QATSTGTTIVGVKFENGVVIAADTRSTQGPIVANKNCEKLHKISSRIWCAGAGTAADTDA 83

Query: 86  ---ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
              ++ +   +H+   L T  E      +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTGLIGSNLELHS---LFTGRE----PRVVSALQKLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELAXXXXXXXXX 202
             G  L++ +  G+       S+G+ + AA  +L+ ++K+ +  +EAI+LA         
Sbjct: 135 T-GAHLFSVHAHGSTDVGYYQSLGSGSLAAMAVLEANWKEHLTKEEAIKLAADAIEAGIW 193

Query: 203 XXXXXXXXXEFATIKKGK-----------NDGEVYQKIYKPDEIKELLIKTGVTKKKDDE 251
                    +   ++ GK           N  E  QK YK D     ++K  + +  D+E
Sbjct: 194 NDLGSGSNVDVCVMEVGKDAELLRNYITPNVREAKQKSYKFDRGTTAVLKESILEVYDEE 253

>TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 84/173 (48%), Gaps = 9/173 (5%)

Query: 23  EYALESISHAGTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLT 81
            YA    +  GT I G+    G+V+AA+ + T   +  D +  KL+++  +I  A AG  
Sbjct: 19  SYAQPKATSTGTTIVGVKFKGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTA 78

Query: 82  ADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGY 140
           AD E +  T  I +   L + Y E  P   +V  L  +KQ   ++ G    G   I AG 
Sbjct: 79  ADTEAV--TQLIGSNIELHSLYTERAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGV 132

Query: 141 DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           D   G  L++ +  G+       ++G+ + AA  +L+  +K D+  ++AI+LA
Sbjct: 133 DPT-GAHLFSIHAHGSTDVGYYHTLGSGSLAAMAVLESQWKQDLSKEDAIKLA 184

>Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {ON}
           YOR157C (PUP1) - putative proteasome subunit [contig
           190] FULL
          Length = 263

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 98/215 (45%), Gaps = 16/215 (7%)

Query: 27  ESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAE- 85
           ++ S   T +G+    G+V+AA+ + T   +  + +  KL++++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYNGGVVIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
              ++ +   +H+      Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELHS-----LYASRAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELAXXXXXXXXX 202
             G  L++ +  G+       S+G+ + AA  +L+  +K+D+  +EA++LA         
Sbjct: 135 T-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKEDINREEAMQLASDAIEAGIW 193

Query: 203 XXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKE 237
                    +   ++ GK D E Y + YK   ++E
Sbjct: 194 NDLGSGSNVDLCVMEVGK-DAE-YLRNYKTPNVRE 226

>TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON}
           Anc_5.507 YOR157C
          Length = 259

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 89/190 (46%), Gaps = 30/190 (15%)

Query: 20  YQVEYALESISH-----AGTG---IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLND 71
           YQ    L S SH       TG   +G+   +G+++AA+ + T   +  D +  KL+++  
Sbjct: 9   YQRNAFLASQSHNTPKATSTGTTIVGVKFNNGVIIAADTRSTQGPIVADKNCAKLHRMAP 68

Query: 72  KITVAVAGLTADAE----ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGG 127
           +I  A AG  AD E    ++ +   +H+   L T+ E      +V  L  +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAVTQLVGSNLELHS---LYTHRE----PRVVSALQMLKQHLFKYQG 121

Query: 128 LRPFGVSFIYAGYDDR----YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
               G   I AG D      +  Q + S   G Y      S+G+ + AA  +L+ ++K D
Sbjct: 122 --HIGAYLIVAGVDPTGPHLFAVQAHGSTDVGFYH-----SLGSGSLAAMAVLETNWKQD 174

Query: 184 MRLDEAIELA 193
           +  +EA++LA
Sbjct: 175 LTKEEAMKLA 184

>KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {ON}
           highly similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 262

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 79/159 (49%), Gaps = 8/159 (5%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           +G+    G+++AA+ + T   +  D + EKL+++  +I  A AG  AD E +  T  I +
Sbjct: 34  VGVKFNGGVIIAADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAV--TQLISS 91

Query: 96  QNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPS 154
              L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +  
Sbjct: 92  NIELHSLYTGREPR--VVSSLQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHAH 146

Query: 155 GNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G+       S+G+ + AA  +L+ ++  D+  +EAI+LA
Sbjct: 147 GSTDVGYYQSLGSGSLAAMAVLEANWNQDLSKEEAIKLA 185

>Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON}
           complement(238..1023) [786 nt, 262 aa]
          Length = 261

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 80/159 (50%), Gaps = 8/159 (5%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           +G+    G+V+AA+ + T   +  D +  KL+++  +I  A AG  AD E +  T  I +
Sbjct: 33  VGVKFDGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAV--TQLIGS 90

Query: 96  QNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPS 154
              L + Y+   P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +  
Sbjct: 91  NIELHSLYSNREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHAH 145

Query: 155 GNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G+       S+G+ + AA  +L+ ++K D+  +EAI+LA
Sbjct: 146 GSTDVGYYHSLGSGSLAAMAVLESNWKQDLTKEEAIKLA 184

>NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507
          Length = 264

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 90/184 (48%), Gaps = 17/184 (9%)

Query: 20  YQVEYALESISHA------GTG---IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLN 70
           YQ   AL + SH+       TG   +G+   +G+++AA+ + T   +  + +  KL++++
Sbjct: 9   YQRNAALAAKSHSQQPKATSTGTTIVGVKYANGVIIAADTRSTQGPIVANKNCAKLHRIS 68

Query: 71  DKITVAVAGLTADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLR 129
            +I  A AG  AD E +  T  I +   L + Y    P   +V  L  +KQ   ++ G  
Sbjct: 69  PRIWCAGAGTAADTEAV--TQLIGSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG-- 122

Query: 130 PFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEA 189
             G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ +M  + A
Sbjct: 123 HIGAYLIVAGTDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWEPEMSKEAA 181

Query: 190 IELA 193
           +ELA
Sbjct: 182 VELA 185

>KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 263

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 99/215 (46%), Gaps = 16/215 (7%)

Query: 27  ESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAE- 85
           ++ S   T +G+    G+++AA+ + T   +  + +  KL++++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYDGGVLIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
              ++ +   +H+      Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELHSM-----YASREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGADP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELAXXXXXXXXX 202
             G  L++ +  G+       S+G+ + AA  +L+ +++ D++ +EA++LA         
Sbjct: 135 T-GTHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWRPDLKKEEAMQLASDAIEAGIW 193

Query: 203 XXXXXXXXXEFATIKKGKNDGEVYQKIYKPDEIKE 237
                    +   ++ GK D E Y + Y+   ++E
Sbjct: 194 NDLGSGSNVDLCIMETGK-DAE-YLRNYRTPNVRE 226

>KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590)
           [648 bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 72/165 (43%), Gaps = 15/165 (9%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL K++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E    +   I      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGEPTTKVAASIFKTLCYENKDHLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSA-AQTLLQMDYKDDMRLDEAIEL 192
           Y S P G     ++ S+  + SA        +YK+DM  +E IE 
Sbjct: 130 Y-SIPLGGSVHKQSYSIAGSGSAFIYGYCDKNYKEDMTKEETIEF 173

>AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL041W (PRE7)
          Length = 243

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 70/158 (44%), Gaps = 6/158 (3%)

Query: 32  AGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           AGT +GI   D  VLA + + T+          K++   D I ++  G  AD + L+   
Sbjct: 31  AGTILGIAGEDFAVLAGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVKRF 90

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           +   + Y   +N+ + ++   R +  +  G      + P+ V  I AG D+     +Y+ 
Sbjct: 91  KNSMKWYRFDHNKKMTIKSAARSIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYSY 146

Query: 152 NPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDMRLD 187
           +P G+Y   +  + GA  S     L  Q+++K+    D
Sbjct: 147 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 184

>Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON}
           (145742..146389) [648 nt, 216 aa]
          Length = 215

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 69/164 (42%), Gaps = 13/164 (7%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E   ++   I      + K   T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           Y+    G+         G+ ++        ++K+DM  +E IE 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSAFIYGYCDKNFKEDMTKEETIEF 173

>Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON}
           (258951..259598) [648 nt, 216 aa]
          Length = 215

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 69/164 (42%), Gaps = 13/164 (7%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E   ++   I      + K   T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           Y+    G+         G+ ++        ++K+DM  +E IE 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSTFIYGYCDKNFKEDMTKEETIEF 173

>NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 76/178 (42%), Gaps = 16/178 (8%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLND 71
           +S E R   +E+     S + GT +GI   D  VLA + + T+          K++   D
Sbjct: 8   YSSEVRNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHG 126
            I ++  G  AD E L+   +    N LK Y+ D     + +    R +  +  G     
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLAMSSAARNIQHLLYGKR--- 120

Query: 127 GLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
              P+ V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 121 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 240

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 69/159 (43%), Gaps = 6/159 (3%)

Query: 31  HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K+++  D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKR 86

Query: 91  ARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYT 150
            +     Y   +N+ + ++   R +  +  G      + P+ V  I AG D+     +Y+
Sbjct: 87  FKNSQMWYHFNHNKKLTIKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYS 142

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDMRLD 187
            +P G+Y   +  + G+  S     L  Q++ K+    D
Sbjct: 143 FDPVGSYEREQCRAGGSAASLIMPFLDNQVNLKNQYEPD 181

>TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.417
           YPR103W
          Length = 286

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 73/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAE--- 85
           I+H  T +      GI++A + + T+       ++ K+ ++N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVNKVIRINPFLLGTMAGGAADCQYWE 130

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 131 TWLGSQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ +DEA+ L 
Sbjct: 183 GPTVYYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNYKWDLTVDEALYLG 231

>AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR157C (PUP1)
          Length = 259

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 81/174 (46%), Gaps = 16/174 (9%)

Query: 20  YQVEYALESISH-----AGTG---IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLND 71
           YQ    L S SH       TG   +G+    G+V+AA+ + T   +  + + EKL+++  
Sbjct: 9   YQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAADTRSTQGPIVANKNCEKLHRIAP 68

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKT-YNEDIPVEILVRRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  I +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TWLIGSNLELHSLYTGREPR--VVSALQKLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDM 184
            G   I AG D   G  L++ +  G+    +  S+G+ + AA  +L+  +++ M
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSVHAHGSTDVGQYQSLGSGSLAAMAVLEAQWREGM 175

>KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 73/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ ++EA+ L 
Sbjct: 184 GPTIYYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWDLSVEEALYLG 232

>KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON}
           Anc_7.480 YBL041W
          Length = 248

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 76/176 (43%), Gaps = 16/176 (9%)

Query: 15  PEGRLYQVEYALESIS-HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKI 73
           P      +E+     S + GT +GI   D  VLA + + T+       S  K++ + D I
Sbjct: 19  PSAMSQPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRSESKVFDVGDGI 78

Query: 74  TVAVAGLTADAEILINTARIHAQNYLKTY--NED---IPVEILVRRLSDIKQGYTQHGGL 128
            ++  G  AD+  L+   R    N LK Y  NE+   + +    R +  +  G       
Sbjct: 79  VISANGFAADSTALVKRFR----NSLKWYHFNENEKRLSLSAAARNIQHLLYGKR----F 130

Query: 129 RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
            P+ V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 131 FPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 186

>NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {ON}
           Anc_3.417
          Length = 287

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 74/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK  N  I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKEKNR-ISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ ++EA+ L 
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLG 232

>KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 73/174 (41%), Gaps = 15/174 (8%)

Query: 20  YQVEYALESISH--------AGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLND 71
           Y  E A + I H         GT +GI   D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAQQPIEHRFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+  + ++   R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSIKWYHFDHNDKKLSIKSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 77/180 (42%), Gaps = 16/180 (8%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLND 71
           +S E     +E+A    + + GT +GI   D  +LA + + T+          K++   D
Sbjct: 8   YSSEVNSTPIEHAFNPYTDNGGTILGIAGEDFAILAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHG 126
            I ++  G  AD E L+   +    N LK Y+ D     + ++   R +  +  G     
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR--- 120

Query: 127 GLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDM 184
              P+ V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  
Sbjct: 121 -FFPYYVHTIIAGLDENGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQF 179

>KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 242

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 77/179 (43%), Gaps = 8/179 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLND 71
           +S E +   +E+     S + GT +GI   D  VLA + + T+          K++   D
Sbjct: 9   YSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 68

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGG-LRP 130
            I ++  G  AD   L+       QN LK Y+ D   + L  R +     +  +G    P
Sbjct: 69  NILISANGFAADGNALVK----RFQNSLKWYHFDHNDKKLSMRSAARNIQHLLYGKRFFP 124

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDMRLD 187
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+    D
Sbjct: 125 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 183

>TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 bp,
           219 aa] {ON} Anc_5.216 YJL001W
          Length = 219

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 65/160 (40%), Gaps = 12/160 (7%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           + +   DG++L A+ + T+     +   +KL ++++KI    +G  AD + + +  + H 
Sbjct: 27  MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHEKIWCCRSGSAADTQAIADIVQYHL 86

Query: 96  QNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
             Y   Y E        +      + K   T            I AGYD++   ++Y+  
Sbjct: 87  DLYTAQYGEPSTKTAAAVFKELCYENKDNLT---------AGIIVAGYDEKNKGEVYSIP 137

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
             G+    K    G+ ++        ++KDDM  DE +  
Sbjct: 138 LGGSMHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVNF 177

>SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 261

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 76/183 (41%), Gaps = 16/183 (8%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLND 71
           +S E +   +E+     S + GT +GI   D  VLA + + T+          K++   D
Sbjct: 28  YSNETKNVPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 87

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKTYN-----EDIPVEILVRRLSDIKQGYTQHG 126
            I ++  G  AD E L+       QN LK Y+       + +    R +  +  G     
Sbjct: 88  NILISANGFAADGEALVK----RFQNSLKWYHFNHNDRKLSLSSAARNIQHLLYGKR--- 140

Query: 127 GLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDM 184
              P+ V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  
Sbjct: 141 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY 199

Query: 185 RLD 187
             D
Sbjct: 200 EPD 202

>TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 74/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAE--- 85
           I+H  T +      GIV+A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGAQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK ++ ++EA+EL 
Sbjct: 184 GPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDANYKWELGVEEALELG 232

>CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041w PRE7
          Length = 242

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 67/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKR 87

Query: 91  ARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG DD     +Y
Sbjct: 88  FKNSIKWYHFDHNDKKLSISSAARNIQHLLYGKR----FFPYYVHTIIAGLDDEGKGAVY 143

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 144 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON}
           similar to Ashbya gossypii AGL324W
          Length = 242

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 77/183 (42%), Gaps = 30/183 (16%)

Query: 32  AGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
            GT +GI   D  V+A + + T+       +  K++   D I ++  G  AD + L+   
Sbjct: 29  GGTILGIAGEDFAVIAGDTRHTTGYSINSRNEPKVFDCGDNILISANGFAADGDALVKKF 88

Query: 92  RIHAQNYLKTY-----NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY 146
           +    N LK Y     N+ + ++   R +  +  G      + P+ V  I AG D+    
Sbjct: 89  K----NNLKWYHFDHNNKKMTLKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEDGKG 140

Query: 147 QLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------MRLDEA 189
            +Y+ +P G+Y   +  + GA  S     L  Q+++K+                + LDE 
Sbjct: 141 AVYSFDPVGSYEREQCRAGGAAASIIMPFLDNQVNFKNQYEPDSKGTKPKSIRFLSLDEV 200

Query: 190 IEL 192
           IEL
Sbjct: 201 IEL 203

>TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON}
           Anc_3.417 YPR103W
          Length = 287

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 74/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ ++EA+ L 
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLG 232

>CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103w PRE2
          Length = 286

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 73/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIVVAVDSRATAGQWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 130

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   E I V    + L ++   Y   G      +  +  GY  + 
Sbjct: 131 TWLGSQCRLHE---LKE-KERISVAAASKILGNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ ++EA+ L 
Sbjct: 183 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLSVEEALYLG 231

>TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 71/176 (40%), Gaps = 15/176 (8%)

Query: 20  YQVEYALESISH--------AGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLND 71
           Y  E A   I H         GT +GI   D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAHTPIQHQFNPYTDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRHESKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+  + +    R +  +  G        P
Sbjct: 68  NIVMSANGFAADGEALVKRFKNSVKWYHFDHNDKKLSLSSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDM 184
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQF 179

>Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa]
           {ON} complement(382038..382904) [867 nt, 289 aa]
          Length = 288

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 74/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK  +  I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKEKSR-ISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ +DEA+ L 
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVDEALYLG 232

>Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON}
           YPR103W (PRE2) - proteasome subunit [contig 47] FULL
          Length = 287

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 73/168 (43%), Gaps = 12/168 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           ++H  T +      GIV+A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  LAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           G  +Y  +  G         VG+  + A  +L  +YK D+ ++EA+ L
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYKWDLTVEEALYL 231

>Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 aa]
           {ON} YJL001W (REAL)
          Length = 216

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 68/164 (41%), Gaps = 13/164 (7%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + +    +      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           YT    G+         G+ ++        +++D+M  +E +  
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRDNMSKEETVNF 173

>Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W
           (PRE7) - proteasome subunit [contig 159] FULL
          Length = 242

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 69/164 (42%), Gaps = 15/164 (9%)

Query: 31  HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD   L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGFAADGTALVK- 86

Query: 91  ARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYG 145
                QN LK Y+ D     + ++   R +  +  G        P+ V  I AG D+   
Sbjct: 87  ---RFQNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGK 139

Query: 146 YQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDMRLD 187
             +Y+ +P G+Y   +  + GA  S     L  Q+++K+    D
Sbjct: 140 GAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 183

>Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON}
           (211095..211823) [729 nt, 243 aa]
          Length = 242

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 69/164 (42%), Gaps = 15/164 (9%)

Query: 31  HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIVISANGFAADGEALVKR 87

Query: 91  ARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYG 145
            +    N +K Y+ D     + +    R +  +  G        P+ V  I AG D+   
Sbjct: 88  FK----NSIKWYHFDNNDKTLSLSSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGK 139

Query: 146 YQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDMRLD 187
             +Y+ +P G+Y   +  + GA  S     L  Q+++K+    D
Sbjct: 140 GAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 183

>NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 74/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ +++A+ L 
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDTNYKWDLTVEDALYLG 232

>Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL001W
           (PRE3) - Subunit of 20S proteasome [contig 94] FULL
          Length = 193

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 68/157 (43%), Gaps = 6/157 (3%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           + +   DG++L A+ + T+     +   +KL +++DK+    +G  AD + + +      
Sbjct: 1   MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKVWCCRSGSAADTQAVADI----V 56

Query: 96  QNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSG 155
           Q+YL+ Y             S  K    ++      G+  I AG+DD+   ++Y+    G
Sbjct: 57  QHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLTAGI--IVAGFDDKNKGEVYSIPLGG 114

Query: 156 NYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           +    K    G+ ++        ++K+DM  DE I  
Sbjct: 115 SVHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETISF 151

>TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 68/163 (41%), Gaps = 10/163 (6%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T      +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTMGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPF-GVSFIYAGYDDRYGYQLYT 150
           + H + Y   Y   IP     R  + + Q        + F     I AG+DD+       
Sbjct: 79  QYHLEVYTSQYG--IPS---TRTAASVFQSLCYEN--KDFLSAGIIVAGFDDKSEKGEVY 131

Query: 151 SNPSGNYTGWKAISVGANTSA-AQTLLQMDYKDDMRLDEAIEL 192
           S P G     +  ++  + SA        +YK DM  DE +E 
Sbjct: 132 SIPLGGSIHKQPYAIAGSGSAFIYGYCDKNYKPDMTKDETVEF 174

>Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp,
           215 aa] {ON} similar to Ashbya gossypii AAL172C 1-intron
          Length = 215

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 67/161 (41%), Gaps = 7/161 (4%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTYKDGVILGADSRTTTGTYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + H   Y   Y E   V       S I   Y     L       I AGYDD+   ++YT 
Sbjct: 79  QHHLDLYAAQYGEP-SVNTAASLFSTI--CYENKDFLTA---GIIVAGYDDKNKGEVYTI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
              G+         G+ ++        ++K++M  +E I  
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKNFKENMSKEETIRF 173

>Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 74/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ +++A+ L 
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLG 232

>Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 74/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ +++A+ L 
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSIEDALYLG 232

>Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 69/164 (42%), Gaps = 13/164 (7%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + +    +      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGPPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           YT    G+         G+ ++        +++++M  +E ++ 
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDF 173

>Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 74/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ +++A+ L 
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLG 232

>YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {ON}
            PRE3Beta 1 subunit of the 20S proteasome, responsible
           for cleavage after acidic residues in peptides
          Length = 215

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 69/164 (42%), Gaps = 13/164 (7%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + +    +      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           YT    G+         G+ ++        +++++M  +E ++ 
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDF 173

>Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 69/164 (42%), Gaps = 13/164 (7%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTY---NEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + +    I      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAAAIFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           YT    G+         G+ ++        +++++M  +E ++ 
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDF 173

>KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 285

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 73/166 (43%), Gaps = 12/166 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 69  IAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 128

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 129 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKE 180

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAI 190
           G  +Y  +  G         VG+  + A  +L  +Y+ D+ ++EA+
Sbjct: 181 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYRWDLSVEEAL 226

>YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5
           subunit of the 20S proteasome, responsible for the
           chymotryptic activity of the proteasome
          Length = 287

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 74/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ +++A+ L 
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLG 232

>KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 69/164 (42%), Gaps = 4/164 (2%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + Y     + I V    + L+++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLYELKEKQRITVAAASKILANLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           Y  +  G         VG+  + A  +L  +YK D+ +++A+ L
Sbjct: 188 YYVDSDGTRLKGDVFCVGSGQTFAYGVLDTNYKWDLSVEDALYL 231

>AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR103W
           (PRE2)
          Length = 285

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 73/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAE--- 85
           I+H  T +      GIV+A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 130 TWLGAQCRLHE---LKE-KERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKE 181

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +Y+ D+ +++A+ L 
Sbjct: 182 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLSVEDALYLG 230

>TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 67/165 (40%), Gaps = 14/165 (8%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL ++ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           +   + Y   + E    +   I      D K   +            I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           +Y+    G+    K    G+ ++        ++KDDM  DE +  
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSAFIYGYCDKNFKDDMTKDETVNF 174

>ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 73/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAE--- 85
           I+H  T +      GI++A + + ++       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRASAGSWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + L ++   Y  +G      +  +  GY  + 
Sbjct: 132 TWLGAQCRLHE---LKE-KERISVAAASKILCNLVYEYKGYG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ ++EA+ L 
Sbjct: 184 GPTVYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEEALYLG 232

>KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 74/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAE--- 85
           I+H  T +      GI++A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   + I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKE-KDRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ ++EA+ L 
Sbjct: 184 GPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLG 232

>Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AEL326C
          Length = 285

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 72/169 (42%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAE--- 85
           I+H  T +      GIV+A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 86  -ILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + L ++   Y   G      +  +  GY  + 
Sbjct: 130 TWLGAQCRLHE---LKE-KERISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKE 181

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ ++EA+ L 
Sbjct: 182 GPTIYYVDSDGMRLKGDLFCVGSGQTFAYGVLDTNYKWDLTVEEALYLG 230

>ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 67/164 (40%), Gaps = 13/164 (7%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T      +   +KL +++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVSFKDGVILGADSRTTMGPYVANRVTDKLTRVHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNED---IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + +   Y   Y E        I  +   + K   T            I AGYD++   ++
Sbjct: 79  QYYLDLYTAQYGEPSTRTAAAIFQQLCYENKDALT---------AGIIVAGYDEKNQGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           Y+    G+    K    G+ ++        +YKD M  DE ++ 
Sbjct: 130 YSIPIGGSLHKQKYAIAGSGSTFIYGYCDKNYKDGMTKDETVDF 173

>Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 67/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   DKI ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDKIVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNED-IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 68/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRFEPKVFDCGDNIVISANGFAADGEALVQR 86

Query: 91  ARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGG-LRPFGVSFIYAGYDDRYGYQLY 149
            +    N +K Y+ D   + L  + +     +  +G    P+ V  I AG D+     +Y
Sbjct: 87  FK----NSIKWYHFDHNDKKLTMKSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 67/159 (42%), Gaps = 15/159 (9%)

Query: 31  HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDDIIISANGFAADGEALVKR 86

Query: 91  ARIHAQNYLKTYNED-----IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYG 145
            +    N +K Y+ D     + +    R +  +  G        P+ V  I AG D+   
Sbjct: 87  FK----NSIKWYHFDNNDKKLALSSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGK 138

Query: 146 YQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
             +Y+ +P G+Y      + GA  S     L  Q+++K+
Sbjct: 139 GAVYSFDPVGSYEREFCRAGGAAASLIMPFLDNQVNFKN 177

>NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 66/165 (40%), Gaps = 14/165 (8%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL K++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNY---LKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           + H   Y     T +      +      + K   T            I AG+DD     +
Sbjct: 79  QYHLDIYSTQFGTPSTKTAASVFKTLCYENKDNLT---------AGIIVAGFDDATNKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           +Y+    G+    K    G+ ++        ++KDDM  DE +  
Sbjct: 130 VYSVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVHF 174

>TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 68/165 (41%), Gaps = 14/165 (8%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL ++ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           +   + Y   + E    +   I      D K   +            I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           +Y+    G+    K    G+ ++        +YK++M  DE ++ 
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSTFIYGYCDKNYKENMTKDETVDF 174

>SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 72/169 (42%), Gaps = 12/169 (7%)

Query: 29  ISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       +++K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   + I V    + L ++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KQRISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK D+ +++A+ L 
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYKWDLTIEDALYLG 232

>ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa]
           {ON} highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 244

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 60/147 (40%), Gaps = 5/147 (3%)

Query: 31  HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I +   G  AD E L+  
Sbjct: 30  NGGTVLGIAGEDFAVLAGDTRHTTDYSINSRYESKVFDCGDNIVITANGYAADGEALVKR 89

Query: 91  ARIHAQNYLKTYNE-DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 90  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVQTIIAGLDEEGKGAVY 145

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL 176
           + +P G+Y   +  + GA  S     L
Sbjct: 146 SFDPVGSYEREQCRAGGAAASLIMPFL 172

>AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 aa]
           {ON} syntenic homolog of Saccharomyces cerevisiae
           YJL001W (PRE3); 1-intron
          Length = 215

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 66/161 (40%), Gaps = 7/161 (4%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL +++D+I    +G  AD + + +  
Sbjct: 19  GTSIMAVKFRDGVILGADSRTTTGTYIANRVTDKLTRVHDRIWCCRSGSAADTQAVADMV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + + + Y   Y E           S I      H          I AGYDD+   ++Y+ 
Sbjct: 79  QHYLELYTMQYGEP-SASTAASLFSTICYENKDH-----LTAGIIVAGYDDKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
              G+         G+ ++         +++DM  +E I+ 
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKHFREDMSKEETIDF 173

>YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6
           subunit of the 20S proteasome
          Length = 241

 Score = 36.2 bits (82), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 66/155 (42%), Gaps = 7/155 (4%)

Query: 31  HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNED-IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 36.2 bits (82), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 66/155 (42%), Gaps = 7/155 (4%)

Query: 31  HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNED-IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137)
           [648 bp, 215 aa] {ON} similar to uniprot|P38624
           Saccharomyces cerevisiae YJL001W PRE3 20S proteasome
           beta-type subunit, responsible for cleavage after acidic
           residues in peptides
          Length = 215

 Score = 35.8 bits (81), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 67/164 (40%), Gaps = 13/164 (7%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNE---DIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E        +      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYDSQYGEPSTKTAASVFKTLCYENKDNLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           Y+    G+         G+ ++        ++K+ M  +E I+ 
Sbjct: 130 YSIPLGGSIHKQNYAIAGSGSTFIYGYCDKNFKEGMTKEETIDF 173

>Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 35.8 bits (81), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 66/155 (42%), Gaps = 7/155 (4%)

Query: 31  HAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D + ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNLVMSANGFAADGDALVKR 86

Query: 91  ARIHAQNYLKTYNED-IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [651
           bp, 216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 35.8 bits (81), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 67/162 (41%), Gaps = 8/162 (4%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYT 150
           + H + Y   Y     ++        I   Y     L       I AG+DD+    ++Y+
Sbjct: 79  QYHLELYESQYGAP-SIKTAASVFKSI--CYENKDNLSA---GIIVAGFDDKNEKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
               G+    K    G+ ++         +K+DM  DE +  
Sbjct: 133 IPLGGSIHKQKYAIAGSGSTFIYGYCDKKFKEDMTKDETVNF 174

>KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 35.4 bits (80), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 70/161 (43%), Gaps = 7/161 (4%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL ++++K+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFRDGVILGADSRTTTGAYIANRVTDKLTRVHEKVWCCRSGSAADTQAVADI- 77

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
               Q+YL+ Y             S  K    ++      G+  I AGYD++   ++Y+ 
Sbjct: 78  ---VQHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLTAGI--IVAGYDEKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
              G+    K    G+ ++        +YK++M  DE +  
Sbjct: 133 PLGGSVHKQKYAIAGSGSTFIYGYCDKNYKENMSKDETVSF 173

>KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 bp,
           216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 69/162 (42%), Gaps = 8/162 (4%)

Query: 33  GTGIGIMVPDG-IVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +  DG ++L A+ + T+     +   +KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFDGGVILGADSRTTTGAYIANRVTDKLTRIDDKIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYT 150
           + H + Y   Y     +E        +   Y     L       I AGYDD+    ++Y+
Sbjct: 79  QYHLELYTSQYGTP-SIETAAAVFKTLT--YENKDALSA---GIIVAGYDDKKKKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
               G+    K    G+ ++        +Y+++M  +E +E 
Sbjct: 133 IPLGGSVHKQKYAIAGSGSAFIYGYCDKNYRENMNKEETVEF 174

>NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 32.7 bits (73), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 69/163 (42%), Gaps = 10/163 (6%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL +++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRIHDKVWCCRSGSAADTQAVADI- 77

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD--RYGYQLY 149
               Q YL  Y             S  K    ++      G+  I AG+DD  + G ++Y
Sbjct: 78  ---VQYYLDLYTTQYGTPSTKTAASVFKTLCYENKDNLTAGI--IVAGFDDDTKKG-EVY 131

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           +    G+    K    G+ ++        ++K+DM  DE I  
Sbjct: 132 SVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETIHF 174

>Kwal_55.21028 s55 (654604..655191) [588 bp, 195 aa] {ON} YER012W
           (PRE1) - 22.6 kDa proteasome subunit [contig 135] FULL
          Length = 195

 Score = 32.3 bits (72), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 70/159 (44%), Gaps = 5/159 (3%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           +GI V D ++LA  + VT  +    ++ +K  +L++   +A  G   D        + + 
Sbjct: 5   LGIRVQDTVILATSKAVTRGISILKSTDDKTRQLSEHTLMAYTGEAGDTVQFAEYVQANM 64

Query: 96  QNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLR-PFGVSFIYAGYD-DRYGYQLYTSNP 153
           Q Y    N ++  + +    S ++Q   +    R P+ V+ +  GYD  +   +LY  + 
Sbjct: 65  QLYTIRENYELSPQAVS---SFVRQELAKSIRSRKPYQVNVLIGGYDIHKEKPELYQIDY 121

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
            G        + G +     +LL   Y+ DM LDE ++L
Sbjct: 122 LGTKVELPYAAHGYSGFYTFSLLDRHYRPDMTLDEGLKL 160

>CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P38624 Saccharomyces
           cerevisiae YJL001w PRE3
          Length = 215

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 69/161 (42%), Gaps = 7/161 (4%)

Query: 33  GTGI-GIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT I  +   DG++L A+ + T+     +   +KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDNIWCCRSGSAADTQAVADIV 78

Query: 92  RIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + +   Y   + E  P       +   K    Q+      G+  I AGYD++   ++Y+ 
Sbjct: 79  QYYLDMYEGQFGE--PDTYTAANM--FKTLCYQNKDALTAGI--IVAGYDEKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
              G+         G+ ++        +++++M  DE I+ 
Sbjct: 133 PLGGSIHKQPYAIAGSGSTFIYGYCDKNFRENMSKDETIDF 173

>KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly
           similar to uniprot|P30657 Saccharomyces cerevisiae
           YFR050C PRE4 20S proteasome beta-type subunit
          Length = 265

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 51/112 (45%), Gaps = 7/112 (6%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINT--ARI 93
           I +   DG+++AA+R  +   L + + +E+L+ +     V ++G  +D + L N      
Sbjct: 45  ISMKYKDGVIIAADRLGSYGSLLRFSDVERLFPVGRNTVVGISGDISDMQHLENLLDEMQ 104

Query: 94  HAQNYLKTYNED---IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
              NY   Y ED   +    +   L+++   Y +   + P   + I AG +D
Sbjct: 105 TENNYDNEYAEDEEALKPSYVFEYLANVM--YNRRSKMNPLWNALIVAGLED 154

>AAR019W Chr1 (375421..376008) [588 bp, 195 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER012W (PRE1)
          Length = 195

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 68/159 (42%), Gaps = 5/159 (3%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           +GI V D ++LA  + VT  +       +K  +L+    ++ +G   DA       + + 
Sbjct: 5   LGIRVQDSVILATSKAVTRGISVLKADDDKTRQLSPHSLMSFSGEPGDAVQFSEYIQANM 64

Query: 96  QNYLKTYNEDIPVEILVRRL-SDIKQGYTQHGGLRPFGVSFIYAGYDDRY-GYQLYTSNP 153
           Q Y+   N ++  +     + S++ +        +PF V+ +  GYD R    +LY  + 
Sbjct: 65  QLYMIRENYELSPQAQASYVRSELAKSLRSR---KPFQVNVLIGGYDTRAEKPELYQIDY 121

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
            G        + G +     +LL   Y+ DM  +E ++L
Sbjct: 122 LGTKVELPYAAHGYSGFYTFSLLDHHYRPDMTTEEGLKL 160

>Skud_5.116 Chr5 (174986..175582) [597 bp, 198 aa] {ON} YER012W
           (REAL)
          Length = 198

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 69/161 (42%), Gaps = 9/161 (5%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTAR-IH 94
           +GI V D ++LA+ + VT  +     S +K  +L+    ++ AG   D    +  A  I 
Sbjct: 5   LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDT---VQFAEYIQ 61

Query: 95  AQNYLKTYNEDIPVEILVRRLSDI--KQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYTS 151
           A   L +  ED   E+  + +S    K+        RP+ V+ +  GYD R    +LY  
Sbjct: 62  ANIQLYSIRED--YELSPQAVSSFVRKELAKSIRSRRPYQVNVLIGGYDKRRNKPELYQI 119

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           +  G        + G +     +LL   Y+ DM  +E + L
Sbjct: 120 DYLGTKVELPYGAHGYSGFYTFSLLDRHYRPDMTTEEGLNL 160

>TDEL0D04900 Chr4 complement(887671..888240) [570 bp, 189 aa] {ON}
          Anc_3.134 YGR078C
          Length = 189

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 18 RLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKI 73
          RL + ++  ES S   + + I +PD   L    K+  TL  +D  +E  Y+LND +
Sbjct: 44 RLSKYKFMQESKSSNISQLKIRIPD---LENSLKICRTLKSKDEPVETSYQLNDTL 96

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa]
           {ON} some similarities with uniprot|Q02455 Saccharomyces
           cerevisiae YKR095W MLP1 Myosin-like protein associated
           with the nuclear envelope, connects the nuclear pore
           complex with the nuclear interior; involved in the Tel1p
           pathway that controls telomere length; involved in the
           retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 62  SIEKLYKLNDKITV---AVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDI 118
           ++ +L   N K+ V    VA L  + E+L ++ R   +NYLK   E   + I+V +L  +
Sbjct: 747 TVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRIMVSQLQTL 806

Query: 119 K 119
           +
Sbjct: 807 Q 807

>KLLA0B11660g Chr2 complement(1024265..1024852) [588 bp, 195 aa]
           {ON} highly similar to uniprot|P22141 Saccharomyces
           cerevisiae YER012W PRE1 20S proteasome beta-type subunit
           localizes to the nucleus throughout the cell cycle
          Length = 195

 Score = 29.6 bits (65), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 69/161 (42%), Gaps = 9/161 (5%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           +GI V D ++LA+ + VT  +     S +K  +L     ++ +G   D        + + 
Sbjct: 5   LGIRVKDSVILASSKAVTRGISILKDSDDKTRQLLPHTLMSFSGEAGDTVQFAEYIQANM 64

Query: 96  QNYLKTYNEDI---PVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY-GYQLYTS 151
           Q YL   N ++        VR  +++ +        +PF V+ +  GYD +    +LY  
Sbjct: 65  QLYLIRENYELSPHAASSFVR--TELAKSLRSR---KPFQVNVLIGGYDTKNEKAELYQI 119

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           +  G        + G       +LL   Y++D+ +DEA+ L
Sbjct: 120 DYLGTKVELPYAAHGYAGFYTFSLLDRHYREDLTVDEALGL 160

>KLTH0F13750g Chr6 (1126220..1126807) [588 bp, 195 aa] {ON} highly
           similar to uniprot|P22141 Saccharomyces cerevisiae
           YER012W PRE1 20S proteasome beta-type subunit localizes
           to the nucleus throughout the cell cycle
          Length = 195

 Score = 29.6 bits (65), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 71/159 (44%), Gaps = 5/159 (3%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           +GI V + ++LA  + VT  +       +K  +L++ + +A +G   DA       + + 
Sbjct: 5   LGIRVQNTVILATSKAVTRGISVLKADDDKTRQLSEHVLMAYSGEAGDAVQFSEYIQANI 64

Query: 96  QNYLKTYNEDIPVEILVRRLSDIKQGYTQH-GGLRPFGVSFIYAGYD-DRYGYQLYTSNP 153
           Q Y    N ++  + +    S ++Q   +     RP+ V+ +  GYD  +   +LY  + 
Sbjct: 65  QLYSIRENYELSPKAVS---SFVRQELAKSIRSRRPYQVNVLIGGYDAHQKKPELYQIDY 121

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
            G        + G +     +LL   Y+ DM ++E ++L
Sbjct: 122 LGTKVELPYAAHGYSGFYTFSLLDHHYRPDMTVEEGLKL 160

>KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly
           similar to uniprot|P38236 YBR057C Saccharomyces
           cerevisiae MUM2 Cytoplasmic protein essential for
           meiotic DNA replication and sporulation
          Length = 316

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 61/127 (48%), Gaps = 15/127 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERK----VTSTLLEQDTS 62
           DSR +  S +GR  ++  +LESI H  + + I   D  +    R+    VT+  L    S
Sbjct: 188 DSRVSSASQKGRTVEMPVSLESIFHKMSSV-IAAKDKELEETSRRLESIVTAIALNPSNS 246

Query: 63  IEKLYK-----LNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSD 117
           + KL +     L  K+ V +  LT + +   + A++    Y ++  + I +E++ R   +
Sbjct: 247 VTKLGRYDEEALAHKMVVRLETLTKENQ---DMAKMLG--YGRSKEQHIELELIKRENQE 301

Query: 118 IKQGYTQ 124
           +K+  +Q
Sbjct: 302 LKRKLSQ 308

>Ecym_1264 Chr1 complement(543133..543720) [588 bp, 195 aa] {ON}
           similar to Ashbya gossypii AAR019W
          Length = 195

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 70/161 (43%), Gaps = 9/161 (5%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTARIHA 95
           +GI V D ++LA+ + VT  +     + +K  +L+    ++  G + D        + + 
Sbjct: 5   LGIRVQDSVILASSKAVTRGISVLKATDDKTRQLSPHSLISFTGESGDTVQFSEYIQANM 64

Query: 96  QNYLKTYNEDIPVEI---LVRRLSDIKQGYTQHGGLRPFGVSFIYAGYD-DRYGYQLYTS 151
           Q Y+   N ++  +     VR  +++ +        +PF V+ +  GYD  +   +LY  
Sbjct: 65  QLYMIRENYELSPQAQSSFVR--NELAKSLRSR---KPFQVNVLIGGYDVKKEKPELYQI 119

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           +  G        + G +     +LL   Y+ DM  +E ++L
Sbjct: 120 DYLGTKVELPYAAHGYSGFYTFSLLDHHYRPDMSTEEGLKL 160

>YER012W Chr5 (177835..178431) [597 bp, 198 aa] {ON}  PRE1Beta 4
           subunit of the 20S proteasome; localizes to the nucleus
           throughout the cell cycle
          Length = 198

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 72/161 (44%), Gaps = 9/161 (5%)

Query: 36  IGIMVPDGIVLAAERKVTSTLLEQDTSIEKLYKLNDKITVAVAGLTADAEILINTAR-IH 94
           +GI V D ++LA+ + VT  +     S +K  +L+    ++ AG   D    +  A  I 
Sbjct: 5   LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDT---VQFAEYIQ 61

Query: 95  AQNYLKTYNEDIPVEILVRRLSD-IKQGYTQH-GGLRPFGVSFIYAGYDDRYGY-QLYTS 151
           A   L +  ED   E+  + +S  ++Q   +     RP+ V+ +  GYD +    +LY  
Sbjct: 62  ANIQLYSIRED--YELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQI 119

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMRLDEAIEL 192
           +  G        + G +     +LL   Y+ DM  +E ++L
Sbjct: 120 DYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDL 160

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.134    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,116,248
Number of extensions: 988442
Number of successful extensions: 2478
Number of sequences better than 10.0: 247
Number of HSP's gapped: 2249
Number of HSP's successfully gapped: 247
Length of query: 254
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 147
Effective length of database: 41,212,137
Effective search space: 6058184139
Effective search space used: 6058184139
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)