Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G006802.289ON25525512711e-179
NCAS0G03850singletonON2512569681e-133
NCAS0G037702.289ON2512569681e-133
YNL024C2.289ON2462558801e-120
KNAG0H019802.289ON2492568781e-119
Smik_14.3072.289ON2462558651e-117
Skud_14.3052.289ON2492558631e-117
Suva_14.3232.289ON2532558571e-116
CAGL0M06897g2.289ON2482568231e-111
SAKL0E07612g2.289ON2522607851e-105
KLTH0G10428g2.289ON2512537661e-102
Ecym_33282.289ON2542567651e-102
ADL212W2.289ON2512557551e-100
KAFR0H032902.289ON2452567461e-99
KLLA0E08295g2.289ON2662567431e-98
Kwal_27.115132.289ON2512547402e-98
Smik_2.4141.325ON4171591431e-09
Suva_4.5321.325ON4161021351e-08
YBR271W (EFM2)1.325ON4191251332e-08
Skud_2.4031.325ON4171191332e-08
TDEL0D019401.325ON4051281315e-08
NCAS0J021504.352ON3221861261e-07
KLLA0E21539g1.325ON400701262e-07
CAGL0I09438g1.325ON4061231253e-07
KAFR0C042501.325ON3911251243e-07
AER240W1.325ON3901181234e-07
NDAI0B047301.325ON4321191226e-07
KAFR0E042804.352ON3151871208e-07
ZYRO0G20548g1.325ON397731192e-06
Skud_10.3524.352ON3362111182e-06
KNAG0C018001.325ON421681182e-06
NDAI0J028604.352ON3471901182e-06
SAKL0D06798g1.325ON4211551182e-06
KLTH0H10560g1.325ON4171621173e-06
NCAS0B074101.325ON414661164e-06
TBLA0D052001.325ON3991191154e-06
Smik_10.4224.352ON3401931146e-06
Suva_12.2204.352ON3372071111e-05
Ecym_55131.325ON396991111e-05
Kwal_47.166354.352ON3221551093e-05
Kwal_14.25501.325ON4181241058e-05
SAKL0G18106g4.352ON3351811041e-04
KNAG0B067204.352ON2831741003e-04
Kpol_1066.171.325ON4351651003e-04
YJR129C4.352ON339189977e-04
KLTH0D17996g4.352ON317186977e-04
TPHA0L003404.352ON341207950.001
TDEL0D006404.352ON327148950.001
TPHA0I026501.325ON421118940.002
ZYRO0B14916g4.352ON298176880.008
Kpol_1028.814.352ON336154870.015
CAGL0M00572g4.352ON327202820.063
Ecym_11274.352ON320147790.13
KLLA0D16753g8.339ON322113780.21
TBLA0B061504.352ON31667770.27
AER161C4.352ON31664750.43
KLLA0B04444g4.352ON308165721.0
TBLA0E049604.383ON86376684.4
KLTH0E15730g3.136ON57450658.4
NCAS0A146407.430ON75074659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00680
         (255 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   494   e-179
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               377   e-133
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   377   e-133
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   343   e-120
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   342   e-119
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   337   e-117
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   337   e-117
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   334   e-116
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   321   e-111
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   306   e-105
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   299   e-102
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   299   e-102
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   295   e-100
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   291   1e-99
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   290   1e-98
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   289   2e-98
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    60   1e-09
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    57   1e-08
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    56   2e-08
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    56   2e-08
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    55   5e-08
NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {O...    53   1e-07
KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]...    53   2e-07
CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} simila...    53   3e-07
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    52   3e-07
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    52   4e-07
NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa] ...    52   6e-07
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    51   8e-07
ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]...    50   2e-06
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    50   2e-06
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    50   2e-06
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    50   2e-06
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    50   2e-06
KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {...    50   3e-06
NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa] ...    49   4e-06
TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa] ...    49   4e-06
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    49   6e-06
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    47   1e-05
Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar...    47   1e-05
Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}...    47   3e-05
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    45   8e-05
SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]...    45   1e-04
KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {...    43   3e-04
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    43   3e-04
YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON} ...    42   7e-04
KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} simil...    42   7e-04
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    41   0.001
TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.35...    41   0.001
TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {O...    41   0.002
ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa] ...    39   0.008
Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON} (1820...    38   0.015
CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar ...    36   0.063
Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to...    35   0.13 
KLLA0D16753g Chr4 (1418383..1419351) [969 bp, 322 aa] {ON} simil...    35   0.21 
TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4....    34   0.27 
AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON} Sy...    33   0.43 
KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar...    32   1.0  
TBLA0E04960 Chr5 (1268270..1270861) [2592 bp, 863 aa] {ON} Anc_4...    31   4.4  
KLTH0E15730g Chr5 complement(1396500..1398224) [1725 bp, 574 aa]...    30   8.4  
NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON} Anc_7...    30   9.4  

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  494 bits (1271), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 243/255 (95%), Positives = 243/255 (95%)

Query: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60
           MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE
Sbjct: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60

Query: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120
           FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ
Sbjct: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120

Query: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADC 180
           IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHS            VDLILAADC
Sbjct: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAADC 180

Query: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240
           VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE
Sbjct: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240

Query: 241 YYLKQRTHLFQLIRQ 255
           YYLKQRTHLFQLIRQ
Sbjct: 241 YYLKQRTHLFQLIRQ 255

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  377 bits (968), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 184/256 (71%), Positives = 213/256 (83%), Gaps = 7/256 (2%)

Query: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60
           MD IFG  F+ LVV RP+EHLGNSDLSFGG+L++PLKIHEDGGESGCGGKVWIAGELLC+
Sbjct: 1   MDGIFGD-FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCD 59

Query: 61  FILEKSNSDDLLNGWASNS-KQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDID 119
           FILEKS ++DLLN W  +  ++FR ++ELGSGTGLVGLC+GLLEKN FHK+I  +ITDID
Sbjct: 60  FILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDID 119

Query: 120 QIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAAD 179
           Q+VPLM++NI+LNG+  EV AE LWWGEPL ++FAPS               VDLILAAD
Sbjct: 120 QLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPS-----TVDNLPKTNVVDLILAAD 174

Query: 180 CVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239
           CVYLE AFPLLE+TLLDLTE ETPP ILM+YRKRRKADKHFF KIKKNFD++E+KDF KY
Sbjct: 175 CVYLEDAFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKY 234

Query: 240 EYYLKQRTHLFQLIRQ 255
           E YLK RTHLFQL R+
Sbjct: 235 EMYLKMRTHLFQLARR 250

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  377 bits (968), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 184/256 (71%), Positives = 213/256 (83%), Gaps = 7/256 (2%)

Query: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60
           MD IFG  F+ LVV RP+EHLGNSDLSFGG+L++PLKIHEDGGESGCGGKVWIAGELLC+
Sbjct: 1   MDGIFGD-FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCD 59

Query: 61  FILEKSNSDDLLNGWASNS-KQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDID 119
           FILEKS ++DLLN W  +  ++FR ++ELGSGTGLVGLC+GLLEKN FHK+I  +ITDID
Sbjct: 60  FILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDID 119

Query: 120 QIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAAD 179
           Q+VPLM++NI+LNG+  EV AE LWWGEPL ++FAPS               VDLILAAD
Sbjct: 120 QLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPS-----TVDNLPKTNVVDLILAAD 174

Query: 180 CVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239
           CVYLE AFPLLE+TLLDLTE ETPP ILM+YRKRRKADKHFF KIKKNFD++E+KDF KY
Sbjct: 175 CVYLEDAFPLLERTLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKY 234

Query: 240 EYYLKQRTHLFQLIRQ 255
           E YLK RTHLFQL R+
Sbjct: 235 EMYLKMRTHLFQLARR 250

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  343 bits (880), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 170/255 (66%), Positives = 203/255 (79%), Gaps = 9/255 (3%)

Query: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60
           M+ IFG GF DLVV RP EHLG +DLSFGG+L   LKI EDGGESGCGGKVWIAGELLCE
Sbjct: 1   MESIFG-GFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCE 59

Query: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120
           +ILEKS  D LL+   + +KQF+K++ELGSGTGLVGLC+GLLEKN FH     Y+TDID+
Sbjct: 60  YILEKS-VDHLLSKTVNGTKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDK 118

Query: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADC 180
           ++PL+K+NI+L+ ++ EV A ELWWGEPL   F+P E +            VDL+LAADC
Sbjct: 119 LIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANN-------VDLVLAADC 171

Query: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240
           VYLE+AFPLLEKTLLDLT    PP ILMAY+KRRKADKHFF KIK+NFD++EI DF K+E
Sbjct: 172 VYLEEAFPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFE 231

Query: 241 YYLKQRTHLFQLIRQ 255
           +YLK+RTHLFQLIR+
Sbjct: 232 HYLKERTHLFQLIRK 246

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  342 bits (878), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 170/256 (66%), Positives = 196/256 (76%), Gaps = 8/256 (3%)

Query: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60
           M++IFGS F DLVVARP+EH G+ D+SFGGRL   L+IHEDGGESGCGGKVW+AGELLC+
Sbjct: 1   MNEIFGS-FGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCD 59

Query: 61  FILEKSNSDDLLNGW-ASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDID 119
           +I+EKS+ DDLL  W  S  ++FR I+ELGSGTGLVGLC+ LLEK  FHK I   ITDID
Sbjct: 60  YIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDID 119

Query: 120 QIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAAD 179
           Q+VPLM++NI+LN +  E+ AEELWWGEPL   FAP                VDLILAAD
Sbjct: 120 QLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTS------VDLILAAD 173

Query: 180 CVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239
           CVYLEKAFPLLEKTLLDLT    PP ILMAYRKRR ADK FF+KI K+F + EI DF  Y
Sbjct: 174 CVYLEKAFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTY 233

Query: 240 EYYLKQRTHLFQLIRQ 255
           + YLKQRTHLF+LIR 
Sbjct: 234 DQYLKQRTHLFELIRN 249

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  337 bits (865), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 169/255 (66%), Positives = 200/255 (78%), Gaps = 9/255 (3%)

Query: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60
           MD IFG GF DLVV RP EHLG +DLSF G+L   LKI EDGGESGCGGKVWIAGELLCE
Sbjct: 1   MDSIFG-GFGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCE 59

Query: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120
           +ILEKS  D LL+      K+F+K++ELGSGTGLVGLC+GLLEKN +H     Y+TDID+
Sbjct: 60  YILEKS-VDHLLSKTVDGKKRFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDK 118

Query: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADC 180
           +VPL+K+NI+L+ ++ EV A EL WGEPL   F+P E              VDL+LAADC
Sbjct: 119 LVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNN-------VDLVLAADC 171

Query: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240
           VYLEKAFPLLEKTLLDLT+  +PP ILMAY+KRRKADKHFF KIK+NFD++EI +F K++
Sbjct: 172 VYLEKAFPLLEKTLLDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFD 231

Query: 241 YYLKQRTHLFQLIRQ 255
           YYLKQRTHLFQLIR+
Sbjct: 232 YYLKQRTHLFQLIRK 246

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  337 bits (863), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 168/255 (65%), Positives = 200/255 (78%), Gaps = 9/255 (3%)

Query: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60
           MD IFG GF+DLVV R  EHLG +DLSFGG+L   LKI EDGGESGCGGKVWIAGELLCE
Sbjct: 1   MDTIFG-GFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCE 59

Query: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120
           +ILEKS    LL+      +QF+K++ELGSGTGLVGLC+GLLEKN FH     Y+TDID+
Sbjct: 60  YILEKS-LHHLLSEATHGRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDK 118

Query: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADC 180
           +VPL+++NI+L+ ++ EV A ELWWGEPL   F+P E              VDL+LAADC
Sbjct: 119 LVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNN-------VDLVLAADC 171

Query: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240
           VYLEKAFPLLE+TLLDLT   +PP ILMAY+KRRKADKHFF KIK+NFD++EI DF K++
Sbjct: 172 VYLEKAFPLLERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFD 231

Query: 241 YYLKQRTHLFQLIRQ 255
           +YLKQRTHLFQLIR+
Sbjct: 232 HYLKQRTHLFQLIRK 246

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  334 bits (857), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 168/255 (65%), Positives = 200/255 (78%), Gaps = 9/255 (3%)

Query: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60
           MD IFG GF+DLVV R  EH G +DLSFGG+L   LKI EDGGESGCGGKVWIAGELLCE
Sbjct: 1   MDGIFG-GFEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCE 59

Query: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120
           +ILEKS+ D LL+      + F K++ELGSGTGLVGLC+GLLEKN FH +   Y+TDID+
Sbjct: 60  YILEKSD-DHLLSETVHEKRPFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDR 118

Query: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADC 180
           +VPLM++NI+L+ ++ EV A ELWWGEPL   F+P E              VDL+LAADC
Sbjct: 119 LVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNN-------VDLVLAADC 171

Query: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240
           VYLEKAFPLLEKTLLDLT   +PP ILMAY+KRRKADK FF KIK+NFD++EIKDF K++
Sbjct: 172 VYLEKAFPLLEKTLLDLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFD 231

Query: 241 YYLKQRTHLFQLIRQ 255
           YYLKQ+THLFQL+R+
Sbjct: 232 YYLKQKTHLFQLVRK 246

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  321 bits (823), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/256 (62%), Positives = 196/256 (76%), Gaps = 9/256 (3%)

Query: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60
           M+DI G  F DL+ +RP+EH+G SDL+F G L   LKI+EDGGESGCGGKVWIAGELLCE
Sbjct: 1   MEDILG--FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCE 58

Query: 61  FILEKSNSDDLLNGWASN-SKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDID 119
           FILEKS   +LL  W ++ S  F  ++ELGSGTGLVGLC+GL+ K    + +  YITDID
Sbjct: 59  FILEKSRDGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDID 118

Query: 120 QIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAAD 179
           Q+VPLM++N++LN I+ +V A+EL WGE L   FAP +              +DL+LAAD
Sbjct: 119 QLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSS------LDLVLAAD 172

Query: 180 CVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239
           CVYLEKAFPLLEKTLLDLTE + PP ILMAYRKRRKADKHFFQKI+KNF+++ I DF+ Y
Sbjct: 173 CVYLEKAFPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNY 232

Query: 240 EYYLKQRTHLFQLIRQ 255
           + YLKQRTHLFQL+R+
Sbjct: 233 DQYLKQRTHLFQLVRK 248

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  306 bits (785), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 166/260 (63%), Positives = 207/260 (79%), Gaps = 15/260 (5%)

Query: 1   MDDI--FGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELL 58
           M+D+  F + F+DLV +RP EHLG+SDLSFGG+L  PLKIHEDGGESGCGGKVWIAGELL
Sbjct: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60

Query: 59  CEFILEKSNSDDLLNGWASNSK---QFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYI 115
           CEF+LEKS+   L + W S+++     +KIVELGSGTGLVGLC+GLL K N  KD+D Y+
Sbjct: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYV 120

Query: 116 TDIDQIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLI 175
           TDIDQ+V LM +NI+LN +E+ V  +ELWWGEPL+  FAP+  +            VDLI
Sbjct: 121 TDIDQLVTLMDRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSNQRQ---------VDLI 170

Query: 176 LAADCVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKD 235
           LAADCVYLEKAFPLLE TLLDLT  + PP ILM+Y+KRRKADKHFF++IKKNFD++EI +
Sbjct: 171 LAADCVYLEKAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINE 230

Query: 236 FEKYEYYLKQRTHLFQLIRQ 255
           F ++++YLKQ+THLFQL+R+
Sbjct: 231 FTRFDHYLKQKTHLFQLVRK 250

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  299 bits (766), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 151/253 (59%), Positives = 187/253 (73%), Gaps = 14/253 (5%)

Query: 5   FGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCEFILE 64
           F + F DLV +RPLEH G+SDL+FGGR+   LKIHEDGGESGCGGK+WIAGELLCE++LE
Sbjct: 7   FTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLE 66

Query: 65  KSNSDDLLN---GWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQI 121
            S+ + +L+         K F  I+ELGSGTGLVGLC G L + N   +   +ITDIDQ+
Sbjct: 67  NSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARAN-GGNAKVHITDIDQL 125

Query: 122 VPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADCV 181
           V LM+ N++LNG+ + VSAE+LWWGEPL+  F P   S             DL+LAADCV
Sbjct: 126 VRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNK----------TDLVLAADCV 175

Query: 182 YLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYEY 241
           YLE AFPLLEKTLLDLT+GETPP +LM+YRKRRKAD+ FF+ I+KNF +V I  F++ + 
Sbjct: 176 YLETAFPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDD 235

Query: 242 YLKQRTHLFQLIR 254
           +LKQRTHLFQLIR
Sbjct: 236 FLKQRTHLFQLIR 248

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  299 bits (765), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 150/256 (58%), Positives = 185/256 (72%), Gaps = 13/256 (5%)

Query: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60
           M D+F S F++LV   P+EHLG SDLSF GRL  PLKI+EDGGESGCGGKVWIAGELLC+
Sbjct: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60

Query: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120
           F+LEKS    LL+ +  N KQF K++ELGSGTGLVGLCIG+    +   D+D YITDID 
Sbjct: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDT 120

Query: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADC 180
           + PLM +N+++N +E  V   EL+WG+ L   F   +              VDLILAADC
Sbjct: 121 LCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKDSP------------VDLILAADC 168

Query: 181 VYLEKAFPLLEKTLLDLTEG-ETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239
           VYLEKAFPLLE  LL+LT   E  P +LM+YRKRRKADK FF KIKK+F I E+ DF++Y
Sbjct: 169 VYLEKAFPLLEMKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRY 228

Query: 240 EYYLKQRTHLFQLIRQ 255
           + Y+KQRTH+FQL+R+
Sbjct: 229 DEYIKQRTHIFQLVRR 244

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  295 bits (755), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/255 (60%), Positives = 188/255 (73%), Gaps = 14/255 (5%)

Query: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60
           M + F + F+DLV  RP+EHLG SDLS+ G+L  PLKIHEDGGESGCGGKVWIAG LLCE
Sbjct: 1   MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCE 60

Query: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120
           FILEKS    +L+ +    +QF+ I+ELGSGTGLVGLC+GL  K N   D + YITDI+ 
Sbjct: 61  FILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG 120

Query: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADC 180
           + PLM++N++LNG++  V    L+WGEPL   F                  +DL+LAADC
Sbjct: 121 LCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFT--------------RQPIDLVLAADC 166

Query: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240
           VYLEKAFPLLEKTLLDLT GE+ P +LM+Y+KRRKADK FF KIKK FDI+EIKDF+ YE
Sbjct: 167 VYLEKAFPLLEKTLLDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYE 226

Query: 241 YYLKQRTHLFQLIRQ 255
            Y +QRT+LFQL+R+
Sbjct: 227 DYRRQRTYLFQLVRK 241

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  291 bits (746), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 189/256 (73%), Gaps = 12/256 (4%)

Query: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60
           M+++FG  +  L+  RP+EHLG++DLSF G+L   +KI+EDGG SGCGGKVWIAGELLCE
Sbjct: 1   MNEVFGE-YVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCE 59

Query: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120
           +++EKS+S++LL   +      + I+ELGSGTGLVG+C+GL+EK  FHKDI   ITDI  
Sbjct: 60  YLIEKSDSENLLCDGS-----IKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114

Query: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEH-SXXXXXXXXXXXXVDLILAAD 179
           +VPLM++NI LN I +   A+EL WG+ L     PSE+ +            VDL++AAD
Sbjct: 115 LVPLMERNILLNKIADATVAKELMWGQQL-----PSEYMTTSVDGNCDNVSNVDLVVAAD 169

Query: 180 CVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239
           CVY EKAFPLLEK LLDLT  + PP ILMAYRKRRKADK FF +I+KNFD++EI DF  +
Sbjct: 170 CVYAEKAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSH 229

Query: 240 EYYLKQRTHLFQLIRQ 255
           E Y+KQRTHLF+L R+
Sbjct: 230 EKYMKQRTHLFELKRK 245

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  290 bits (743), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 156/256 (60%), Positives = 195/256 (76%), Gaps = 16/256 (6%)

Query: 1   MDDI-FGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLC 59
           M D+ F S F++LV ARP+EHLG  D+SF G+L +PL I+EDGGESGCGGKVWIAGELLC
Sbjct: 25  MGDVPFSSCFEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLC 84

Query: 60  EFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDID 119
           E+ILEKS+ + LL+    +      ++ELGSGTGLVGLC+GL+++ N + D + YI+DID
Sbjct: 85  EYILEKSDKEHLLSHLFPDG-NCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDID 143

Query: 120 QIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAAD 179
           Q++ LM+ NIQ+NG++++V AE LWWG PL   F                  VDL+LAAD
Sbjct: 144 QLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKKP--------------VDLVLAAD 189

Query: 180 CVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239
           CVYLE AFPLLEKTLL+LT+GE  P ILMAY+KRRKADKHFFQKIKKNF IVEI+DF  +
Sbjct: 190 CVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINF 249

Query: 240 EYYLKQRTHLFQLIRQ 255
           + YLKQRTHLFQL+R+
Sbjct: 250 DKYLKQRTHLFQLMRE 265

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  289 bits (740), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 187/254 (73%), Gaps = 16/254 (6%)

Query: 5   FGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCEFILE 64
           F + F DLV +RP+EHLG+SDLSFGG+++  LKIHEDGGE+GCGGK+W+AGELLC+++LE
Sbjct: 7   FTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLE 66

Query: 65  KSNSDDLLNGWASN---SKQFRKIVELGSGTGLVGLCIGLLEKNNFHKD-IDAYITDIDQ 120
            S++  +L+           F  I+ELGSGTGLVGLC G + +   H D    YITDID+
Sbjct: 67  NSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQ--LHGDRTKVYITDIDR 124

Query: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADC 180
           +V LM+ N+ LN +   VS E L WGEPL++ F P   +            VDL+LAADC
Sbjct: 125 LVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADK----------VDLVLAADC 174

Query: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240
           VYLE AFPLLEKTLLDLTEG+TPP +LM+YRKRRKADK+FF+ I+KNF IV I +F +Y+
Sbjct: 175 VYLETAFPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYD 234

Query: 241 YYLKQRTHLFQLIR 254
           YYLK++THLFQL+R
Sbjct: 235 YYLKKQTHLFQLVR 248

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 80/159 (50%), Gaps = 17/159 (10%)

Query: 6   GSGFDDLVVARPLEHLGNSDLSFGGR--------------LKNPLKIHEDG-GESGCGGK 50
            SGFD+  + + L+ L +      GR              L+N + ++E        G K
Sbjct: 162 NSGFDNETIQKLLKELSSRISENCGRTAQPSTIRYFELRNLRNAIPLYEPSLTADNLGWK 221

Query: 51  VWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKD 110
            W +  +L + ++++ ++ D+ +  A+   +  K++ELGSGTGLVGL      K  +  D
Sbjct: 222 TWGSSLILSQLVVDRLHTADM-DFVANRGTKRIKVLELGSGTGLVGLSWASKWKELYGID 280

Query: 111 -IDAYITDIDQIVPLMKQNIQLNGIENEVSAEELWWGEP 148
             + ++TD+  IV  +K+N+ LN +++ V AE L W  P
Sbjct: 281 NTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAEILDWTNP 319

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 59/102 (57%), Gaps = 2/102 (1%)

Query: 48  GGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNF 107
           G K W +  +L + +++  ++  +       +K+  K++ELGSGTGLVGL      K  +
Sbjct: 218 GWKTWGSSLILSQLLVDYLHTTGMPPAANCGTKRI-KVLELGSGTGLVGLSWAAKWKELY 276

Query: 108 H-KDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEELWWGEP 148
              +I+ Y+TD+ +IV  +K+N+ LN +E+ V AE L W  P
Sbjct: 277 GIHNIEIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDWTNP 318

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 67/125 (53%), Gaps = 12/125 (9%)

Query: 32  LKNPLKIHEDG-GESGCGGKVWIAGELLCEFI------LEKSNSDDLLNGWASNSKQFRK 84
           L   + +HE        G K W +  +L + +      L  +N + L N   S+ KQ  K
Sbjct: 201 LSTSIPLHEPSLTADNLGWKTWGSSLILSQLVVDHLDYLHTTNVNMLAN---SDIKQI-K 256

Query: 85  IVELGSGTGLVGLCIGLLEKNNF-HKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEEL 143
           ++ELG+GTGLVGL   L  K  +  ++I+ ++TD+ +IV  +K+N+ LN + + V AE L
Sbjct: 257 VLELGAGTGLVGLSWALKWKELYGTENIEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEIL 316

Query: 144 WWGEP 148
            W  P
Sbjct: 317 DWTNP 321

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 66/119 (55%), Gaps = 3/119 (2%)

Query: 32  LKNPLKIHEDG-GESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGS 90
           L N + ++E        G K W +  +L + +++  ++  +    + N K+  K++ELGS
Sbjct: 202 LNNAIPLYEPSLTADNLGWKTWGSSLILSQLLVDYLHTVGVHITASCNQKKI-KVLELGS 260

Query: 91  GTGLVGLCIGLLEKNNFHKD-IDAYITDIDQIVPLMKQNIQLNGIENEVSAEELWWGEP 148
           GTGLVGL      K  +  D ++ ++TD+ +IV  +K+N+ LN +++ V AE L W  P
Sbjct: 261 GTGLVGLSWASKWKELYGTDKMEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTNP 319

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 70/128 (54%), Gaps = 17/128 (13%)

Query: 26  LSFGGRLKNPLKIHEDG-GESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFR- 83
            +F G L +P++I+E        G K W A      FIL    S  L+N  A ++  F+ 
Sbjct: 192 FTFEG-LPSPIEIYEPSLTADNLGWKTWGAS-----FIL----SQKLINVLAESTFNFKP 241

Query: 84  KIVELGSGTGLVG---LCIGLLEKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIENEVSA 140
           +++ELGSGTGL G   LC  + +  N H +I  ++TD+  IV  +++N+++N +E+  + 
Sbjct: 242 RVLELGSGTGLAGISWLCKWVQKYGNGHTEI--FLTDLPVIVANLQKNVEVNKVESFATV 299

Query: 141 EELWWGEP 148
             L W +P
Sbjct: 300 SALDWTDP 307

>NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {ON}
           Anc_4.352
          Length = 322

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 83/186 (44%), Gaps = 31/186 (16%)

Query: 48  GGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNF 107
           G + W A   L +++++  + D L+N           I+ELG+GTGLV L I  ++K   
Sbjct: 123 GFRTWAASVYLSKYLVD--HEDALIN-------DDDNILELGAGTGLVSLTIASMDKMKD 173

Query: 108 HKDIDAYITDIDQ--IVPLMKQNIQLN--GIENEVSAEELWWGEPLRKTFAPSEHSXXXX 163
           +K    Y+TD D   +   M+ N Q+N   ++N +  ++LWW  P +    P        
Sbjct: 174 NKLRRMYVTDGDSELVSGQMQDNFQMNEVNVDNHIKLQKLWWNSPDQPI--PER------ 225

Query: 164 XXXXXXXXVDLILAADCVYLEKAFPLLEKTLLD-LTEGETPPTILMAYRKRRKADKHFFQ 222
                   V++++ AD  Y    F  L   L   L E E    ++ +  +  K DK  FQ
Sbjct: 226 --------VNVVIGADVTYDSTCFTDLCSCLRQCLLESECYKCLIASTIRNVKTDK-LFQ 276

Query: 223 KIKKNF 228
              ++F
Sbjct: 277 STVEHF 282

>KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 400

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 49/70 (70%), Gaps = 3/70 (4%)

Query: 83  RKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEE 142
           ++++ELGSGTGLVG+   L   ++ + D   ++TD+ +I+P ++ N++LN + N+V+A+ 
Sbjct: 238 KRVLELGSGTGLVGISYAL--THSINGDSVIFLTDLPEILPNLQYNVRLNNL-NDVTADV 294

Query: 143 LWWGEPLRKT 152
           L W +PL  T
Sbjct: 295 LDWTDPLSFT 304

>CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} similar
           to uniprot|P38347 Saccharomyces cerevisiae YBR271w
          Length = 406

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 68/123 (55%), Gaps = 9/123 (7%)

Query: 31  RLKN---PLKIHEDG-GESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIV 86
           R+KN    + +HE        G K W +  +L E ++  S  ++L + + SN K   + +
Sbjct: 190 RIKNLDKTIMLHEPSLTADNLGWKTWGSSLILGEIVV--SYLENLSSTFESNRKV--RTL 245

Query: 87  ELGSGTGLVGLCIGLLEKNNF-HKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEELWW 145
           ELG+GTGLVG+      ++ F +   + Y+TD+ +IV  +K N+++N +++  +A+ L W
Sbjct: 246 ELGAGTGLVGIAWAAKWRDKFCNSKTEIYLTDLPEIVDNLKDNVKINNLQDIATADVLDW 305

Query: 146 GEP 148
             P
Sbjct: 306 TNP 308

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 63/125 (50%), Gaps = 16/125 (12%)

Query: 30  GRLKNPLKIHEDG-GESGCGGKVW----IAGELLCEFILEKSNSDDLLNGWASNSKQFRK 84
             LK  +K+ E        G K W    I   +LC+ I E  N     NG        ++
Sbjct: 175 NNLKKIVKLFEPSLTNDNLGWKTWGSSLILSNILCDRIDE--NFLKSFNG--------KR 224

Query: 85  IVELGSGTGLVGLCIGL-LEKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEEL 143
           I+ELGSGTGLVG+ +   LE+     + + Y+TD+ +IV  +++NI +N + N V ++ L
Sbjct: 225 ILELGSGTGLVGISVASKLEEIGVLDEYEIYLTDLPEIVTNLEKNISINQLANRVVSDVL 284

Query: 144 WWGEP 148
            W  P
Sbjct: 285 DWTNP 289

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 20/118 (16%)

Query: 32  LKNPLKIHEDGGES-GCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGS 90
           +  P+ +HE    S   G K W A  LL   +   +                ++++ELG+
Sbjct: 192 VARPIVLHEPALTSDNLGLKTWGASLLLSRRVAGFTGK--------------KRVLELGA 237

Query: 91  GTGLVGLCIGLLEKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEELWWGEP 148
           GTGLVG+   L    N   D D ++TD+ +IVP ++ N+ LN + N V A  L W +P
Sbjct: 238 GTGLVGIAYAL---ANIDAD-DVFVTDLPEIVPNLRHNLALNNLTN-VRASVLDWSDP 290

>NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa]
           {ON} Anc_1.325 YBR271W
          Length = 432

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 63/119 (52%), Gaps = 10/119 (8%)

Query: 31  RLKNPLKIHEDGGESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGS 90
           +L  P    ++ G    G  + ++ EL+ +    K+N           SK  R+++ELG+
Sbjct: 221 QLYEPSLTADNLGWKTWGSSLILSQELVNDLETNKNNK---------KSKSIRRVLELGA 271

Query: 91  GTGLVGLCIGLLEKNNF-HKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEELWWGEP 148
           GTGLVG+      +  + ++ I+ ++TD+  IV  +++N+Q N +++ V A+ L W  P
Sbjct: 272 GTGLVGIAWACKWRQLYGNESIEMFVTDLPDIVTNLRKNVQNNDLDDFVVADVLDWTNP 330

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 83/187 (44%), Gaps = 40/187 (21%)

Query: 45  SGCGGKVWIAGELLCEFILEKSNSD-DLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLE 103
           S  G + W A   LC++I   SN D + LNG ++       ++ELG+GTGL  L    L 
Sbjct: 113 STTGFRTWEAASYLCDYI---SNVDTESLNGCST-------VLELGAGTGLCSL---TLL 159

Query: 104 KNNFHKDI-DAYITDIDQ--IVPLMKQNIQLNGIENE----VSAEELWWGEPLRKTFAPS 156
           K  F  D+   Y+TD D   I   +  N +LN +E+E    V  + L WGE       P+
Sbjct: 160 KGKFQDDLKKVYVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGED----SIPN 215

Query: 157 EHSXXXXXXXXXXXXVDLILAADCVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRR-K 215
           +              +D ++ AD  Y +  F  L K L    E E+    L+A   R  +
Sbjct: 216 D--------------IDCVIGADVTYDDTLFDDLFKCLRQCFEIESCKMCLIASTIRNVE 261

Query: 216 ADKHFFQ 222
            D+ F +
Sbjct: 262 TDRKFLE 268

>ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 397

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 45/73 (61%), Gaps = 3/73 (4%)

Query: 78  NSKQFRKIVELGSGTGLVGLCIGLLEKNNFH--KDIDAYITDIDQIVPLMKQNIQLNGIE 135
           N  +  +++ELGSGTGL G+   L++    H   +I+ + TD+ +IVP +++N+++NGI 
Sbjct: 227 NPTKLHRVLELGSGTGLAGIS-WLMKWIEIHGNSNIEMFFTDLQEIVPNLRKNVEINGIS 285

Query: 136 NEVSAEELWWGEP 148
           +    + L W  P
Sbjct: 286 DNSVVDTLDWTCP 298

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 94/211 (44%), Gaps = 41/211 (19%)

Query: 42  GGESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRK---IVELGSGTGLVGLC 98
              S  G + W A   + +F++ K      L   A   K+ RK   ++E+G+GTG+V L 
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKP-----LQQLALMQKEDRKKLNVLEIGAGTGIVSLV 181

Query: 99  IGLLEKNNFHKDID-AYITDIDQ--IVPLMKQNIQLNG--IEN--EVSAEELWWGEPLRK 151
             LLEK  + + ++  Y+TD D   +   +K+N +LN    EN  +V  + LWWG     
Sbjct: 182 --LLEK--YREFVNRMYVTDGDSNLVERQLKRNFELNDALCENGPDVKLQRLWWGSDR-- 235

Query: 152 TFAPSEHSXXXXXXXXXXXXVDLILAADCVYLEKAFPLLEKTLLD-LTEGETPPTILMAY 210
              P +              +DL++AAD  Y    FP L + L + L        +L A 
Sbjct: 236 --IPDD--------------IDLVVAADVTYDSTIFPELCQCLAECLAISRCKMCLLSAT 279

Query: 211 RKRRKADKHFFQKIKK---NFDIVEIKDFEK 238
            +    DK F Q+  K   N+ +V   + +K
Sbjct: 280 IRSESTDKLFAQECNKIGLNYTVVSSTEHDK 310

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 84  KIVELGSGTGLVGLCIGLLEKNNF---HKDIDAYITDIDQIVPLMKQNIQLNGIENEVSA 140
           +++ELGSGTGLVG+      +  +     ++  Y+TD+ +IV  +K+N+QLN +E+ V A
Sbjct: 255 RVLELGSGTGLVGISWACKWRELYGIEDSNLQIYLTDLPEIVDNLKKNVQLNKLEHAVVA 314

Query: 141 EELWWGEP 148
           + L W  P
Sbjct: 315 DVLDWTNP 322

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 76/190 (40%), Gaps = 32/190 (16%)

Query: 42  GGESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGL 101
            G+S  G + W     L +F         L+N       +   ++ELG+GTGLV LCI  
Sbjct: 136 SGKSTTGFRTWEGAVYLSKF---------LINNCEKYLIEKTDVIELGAGTGLVSLCI-- 184

Query: 102 LEKNNFHKDI---DAYITDIDQ--IVPLMKQNIQLNGIENE---VSAEELWWGEPLRKTF 153
           LE N+  K I     Y+TD D   +  ++ +N +LN +  E   V   +LWW +P  K  
Sbjct: 185 LE-NDLQKGIKRDKVYVTDGDSELVSSILNKNFELNNVNIEDENVILRKLWWNDPNEKIA 243

Query: 154 APSEHSXXXXXXXXXXXXVDLILAADCVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKR 213
                             + L++ AD  Y     P L   L    +       +++   R
Sbjct: 244 GEDNGK------------IGLVVGADITYDNSVIPDLCACLKQFMDKNRDCKAIISATVR 291

Query: 214 RKADKHFFQK 223
                +FF++
Sbjct: 292 NIDTINFFER 301

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 73/155 (47%), Gaps = 25/155 (16%)

Query: 48  GGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLL--EKN 105
           G K W A  +L + I  + NS  +  G    +    +++ELGSGTGLVG+       E  
Sbjct: 220 GLKTWGASLILSQKICNRFNS--IFAG----TGNLLRVLELGSGTGLVGITFSCKYKESK 273

Query: 106 NFHKDIDAYITDIDQIVPLMKQNIQLNGIENE----VSAEELWWGEPLRKTFAPSEHSXX 161
                 + Y+TD+ +IVP +++N+++N + ++    V A+ L W  P+  T    +    
Sbjct: 274 TALGSCEMYLTDLPEIVPNLQKNVEINNLNSQSGLAVCADVLDWTNPVSFTEKYGDDK-- 331

Query: 162 XXXXXXXXXXVDLILAADCVYLEKAFPLLEKTLLD 196
                      D+IL AD +Y     P+   T++D
Sbjct: 332 ----------FDVILIADPIY-SPQHPVWVVTMID 355

>KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 417

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 78/162 (48%), Gaps = 32/162 (19%)

Query: 30  GRLKNPLKIHEDGGES-GCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVEL 88
           G L+  +K+HE    S   G K W A  +L   + E        N      ++  +I+EL
Sbjct: 198 GGLRTGVKLHEPALTSDNLGLKTWGASLVLARKLCE--------NFSKFERQRDLRILEL 249

Query: 89  GSGTGLVG--LCIGLLEKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIEN----EVSAEE 142
           G+GTGLVG  L + +LE N+ H +   ++TD+ +IV  +K+N+++N   +    +V A+ 
Sbjct: 250 GAGTGLVGISLVLKMLESNSGH-NCSMHLTDLPEIVTNLKENVKINCCNSRSDLKVYADV 308

Query: 143 LWWGEP--LRKTFAPSEHSXXXXXXXXXXXXVDLILAADCVY 182
           L W  P    KT+   +               D++L AD VY
Sbjct: 309 LDWTNPDSFEKTYGAHKF--------------DVLLIADPVY 336

>NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa]
           {ON} Anc_1.325 YBR271W
          Length = 414

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%), Gaps = 1/66 (1%)

Query: 84  KIVELGSGTGLVGLCIGLLEKNNF-HKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEE 142
           +++ELGSGTGLVG+      + +F  ++I+ ++TD+  IV  +K+N+Q N +   V A+ 
Sbjct: 252 RVLELGSGTGLVGIAWASKWRQSFGTENIEMFVTDLPDIVANLKKNVQTNDLTTFVEADI 311

Query: 143 LWWGEP 148
           L W  P
Sbjct: 312 LDWTNP 317

>TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa]
           {ON} Anc_1.325 YBR271W
          Length = 399

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 61/119 (51%), Gaps = 15/119 (12%)

Query: 30  GRLKNPLKIHEDGGES-GCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVEL 88
             L+  +K++E    S   G K W +  +L       +N    L   + +SK   +++EL
Sbjct: 190 NNLEKTIKLYEPALTSDNLGHKTWGSSLVL-------ANRIPTLENCSGSSKP--RVLEL 240

Query: 89  GSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIE--NEVSAEELWW 145
           GSGTGLVG+   +   N F +    ++TD+ +IVP ++ N +LN +   N V A+ L W
Sbjct: 241 GSGTGLVGITYTISHSNEFSQ---VFLTDLPEIVPNLRTNAKLNDLSTHNSVIADVLDW 296

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 80/193 (41%), Gaps = 29/193 (15%)

Query: 42  GGESGCGGKVWIAGELLCEFILEKSNSD-DLLNGWASNSKQFRKIVELGSGTGLVGLCIG 100
              S  G + W A   + +F++ K   +  L        K+   ++E+G+GTG+V L + 
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQELALTQEEQEEDKKKLNVLEIGAGTGIVSLVLS 186

Query: 101 LLEKNNFHKDIDAYITDIDQ--IVPLMKQNIQLNGIENE----VSAEELWWGEPLRKTFA 154
              +N  +K    Y+TD D   +   +K+N +LN   +E    +  + LWWG        
Sbjct: 187 QNYRNFVNK---MYVTDGDSDLVERQLKKNFELNDALSEHKPDIRFQRLWWG----SDKV 239

Query: 155 PSEHSXXXXXXXXXXXXVDLILAADCVYLEKAFPLLEKTLLD-LTEGETPPTILMAYRKR 213
           P +              +DL++ AD  Y    FP L K L + L        +L A  + 
Sbjct: 240 PDD--------------IDLVVGADVTYDSTIFPELCKCLAECLAINRCKMCLLSATIRS 285

Query: 214 RKADKHFFQKIKK 226
              DK F Q+  K
Sbjct: 286 ESTDKLFAQECSK 298

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 35/207 (16%)

Query: 42  GGESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGL 101
              S  G + W A   + +F++ +     LL     + K+   ++E+G+GTG+V L +  
Sbjct: 129 SAASTTGFRTWEAALYMGDFLMHEP----LLELVHGDDKKKLNVLEIGAGTGIVSLVLLH 184

Query: 102 LEKNNFHKDIDAYITDIDQ--IVPLMKQNIQLNGIENEVSA----EELWWGEPLRKTFAP 155
             +    K    Y+TD D   +   +++N +LN    E S     + LWWG        P
Sbjct: 185 KYREYVSK---MYVTDGDSDLVETQLRRNFELNDAWREQSPDIRLQRLWWG----SDRVP 237

Query: 156 SEHSXXXXXXXXXXXXVDLILAADCVYLEKAFPLLEKTLLD-LTEGETPPTILMAYRKRR 214
            E              V+L++AAD  Y    FP L + L + L        +L A  +  
Sbjct: 238 DE--------------VNLVVAADVTYDSTIFPELCQCLAECLAMSHCKVCLLSATIRSY 283

Query: 215 KADKHFFQKIKK---NFDIVEIKDFEK 238
             DK F Q+  K    + +V   ++++
Sbjct: 284 STDKEFAQECHKVGLKYSVVTSTEYDR 310

>Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar to
           Ashbya gossypii AER240W
          Length = 396

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 55/99 (55%), Gaps = 16/99 (16%)

Query: 84  KIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEEL 143
           K++ELG+GTGLVG+   +  + +  + I   +TD+  IVP ++ NI+LN ++N V A EL
Sbjct: 239 KVLELGAGTGLVGISYAIAHQASTPQII---LTDLPDIVPNLRSNIKLNNLKN-VHAAEL 294

Query: 144 WWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADCVY 182
            W +    TF  ++H              D+IL +D +Y
Sbjct: 295 DWTD--HSTFI-AQHG---------GDKFDMILVSDPIY 321

>Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}
           YJR129C - Hypothetical ORF [contig 376] FULL
          Length = 322

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 63/155 (40%), Gaps = 44/155 (28%)

Query: 48  GGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNF 107
           G + W A   L E++++        N       +F +I+ELG+GTGLV L    L +   
Sbjct: 134 GFRTWEAALYLAEYLVQ--------NQEYYAQDRFSRILELGAGTGLVSLVWSQLFQATM 185

Query: 108 HKDIDAYITDIDQIVPLMKQNIQLNGIENEVSA------------EELWWGEPLRKTFAP 155
               + Y+TD D    L++Q I+ N   N V+A            + LWWGE +      
Sbjct: 186 K---ELYVTDGDST--LVEQAIRYNFQLNNVTAAPANTLDCQYKFQRLWWGEDV------ 234

Query: 156 SEHSXXXXXXXXXXXXVDLILAADCVYLEKAFPLL 190
                           VD++LAAD  Y     P L
Sbjct: 235 -------------VPDVDIVLAADVTYDASVVPSL 256

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 63/124 (50%), Gaps = 16/124 (12%)

Query: 32  LKNPLKIHEDGGES-GCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGS 90
           L   +++HE    S   G K W A  +L   I +K ++ +        S+  R I+ELG+
Sbjct: 204 LATSIELHEPALTSDNLGLKTWGASLVLARKICQKLSTFE-------PSENLR-ILELGA 255

Query: 91  GTGLVGLCI--GLLEKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIEN----EVSAEELW 144
           GTGLVG+     +LE  +  K    ++TD+  IVP +++N+ LN        EV+ + L 
Sbjct: 256 GTGLVGIAFIQKILEVGSTQK-FRVHLTDLPDIVPNLQKNVDLNKCNREPNVEVAVDVLD 314

Query: 145 WGEP 148
           W +P
Sbjct: 315 WTDP 318

>SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]
           {ON} similar to uniprot|P47163 Saccharomyces cerevisiae
           YJR129C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 335

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 76/181 (41%), Gaps = 30/181 (16%)

Query: 48  GGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNF 107
           G + W A   L + + +  NSD++++      K    +VELG+GTG+V +    L+ N  
Sbjct: 142 GFRTWEAALYLSQHLCK--NSDEIMDELG---KDQITVVELGAGTGIVSMTWAKLQHNRL 196

Query: 108 HKDIDAYITDIDQ--IVPLMKQNIQLNGIEN-EVSAEELWWGEPLRKTFAPSEHSXXXXX 164
            K    Y+TD D   +   M +N QLN +   +   ++LWW         P         
Sbjct: 197 EK---LYVTDGDSSLVENQMHRNAQLNNVGGPKYCFQKLWWN----SDDVPDN------- 242

Query: 165 XXXXXXXVDLILAADCVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKI 224
                   DLILAAD  Y     P L   +    + +T  +++ A  +     K F +K 
Sbjct: 243 --------DLILAADVTYDSSVIPDLVLCIKSSLQAKTKFSLIAATVRNVDTIKVFEEKC 294

Query: 225 K 225
           +
Sbjct: 295 R 295

>KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {ON}
           Anc_4.352 YJR129C
          Length = 283

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 35/174 (20%)

Query: 48  GGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNF 107
           G + W A   L + ++E     +L  G        + ++ELG GTGL  + +G+L++   
Sbjct: 107 GFRTWRAATSLSKLLVEHR---ELTRG--------KTVLELGCGTGLSSITVGVLDE--- 152

Query: 108 HKDIDAYITDIDQ--IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXX 165
           +K +  Y+TD D   +  +   N+ LN +E +V  + L W    R    P +        
Sbjct: 153 YKKL--YVTDGDTGILSEVTTPNLSLNKVERDVQCQRLVWASEDR---VPGD-------- 199

Query: 166 XXXXXXVDLILAADCVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKH 219
                 +D+++ AD  Y    FP L   L +  +       ++A  +R +   H
Sbjct: 200 ------IDVVVGADITYDPTVFPELCTCLDECLQQPKCQCAILACTERNRETVH 247

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 77/165 (46%), Gaps = 30/165 (18%)

Query: 32  LKNPLKIHEDG-GESGCGGKVWIAGELLCEFILEKSNSDDLLNGW--ASNSKQFRKIVEL 88
           L   +K++E        G K W +  +L + ++      + LN +  ++ S    +I+EL
Sbjct: 216 LDQTVKLYEPSLTADNLGWKTWGSSLILSQKMV------NFLNNYKYSNQSDDKLRILEL 269

Query: 89  GSGTGLVGLC--------IGLLEKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIENEVSA 140
           G+GTGLVG+         + L   NN   + +  +TD+ +IV  +++NI +N + +   A
Sbjct: 270 GAGTGLVGISWSCKWKEMMKLTNGNNL-PNTEIILTDLPEIVGNLQRNISINNLNDIARA 328

Query: 141 EELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADCVYLEK 185
             L W  P  K+F   E+S             D+IL AD +Y  K
Sbjct: 329 SVLDWTNP--KSFI-QEYS---------NEKFDIILVADPIYSPK 361

>YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON}
           Putative protein of unknown function; predicted
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 339

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 82/189 (43%), Gaps = 29/189 (15%)

Query: 42  GGESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGL 101
              S  G + W A   + +F++ K   +        + K+   ++E+G+GTG+V L I  
Sbjct: 127 SAASTTGFRTWEAALYMGDFLIHKPLQELAPVQGQDDGKKKLNVLEVGAGTGIVSLVI-- 184

Query: 102 LEKNNFHKDID-AYITDIDQ--IVPLMKQNIQLNG--IENE--VSAEELWWGEPLRKTFA 154
           L+K  +H+ ++  Y+TD D   +   +K+N +LN    ENE  +  + LWWG        
Sbjct: 185 LQK--YHEFVNKMYVTDGDSNLVETQLKRNFELNNEVRENEPDIKLQRLWWG----SDRV 238

Query: 155 PSEHSXXXXXXXXXXXXVDLILAADCVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRR 214
           P +              +DL++ AD  Y     P L + L +    +     L++   R 
Sbjct: 239 PED--------------IDLVVGADVTYDPTILPDLCECLAECLALDRCKLCLLSATIRS 284

Query: 215 KADKHFFQK 223
           ++    F +
Sbjct: 285 ESTVQLFSQ 293

>KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} similar
           to uniprot|P47163 Saccharomyces cerevisiae YJR129C
           Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 317

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 73/186 (39%), Gaps = 42/186 (22%)

Query: 48  GGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNF 107
           G + W +   L E++ E  N  +   G      +F + +ELG+GTGLV +    L K   
Sbjct: 124 GFRTWESALYLSEYLAE--NFPEFSAG------KFSRALELGAGTGLVSIAWAKLFKGYI 175

Query: 108 HKDIDAYITDIDQ--IVPLMKQNIQLNGIENE-------VSAEELWWGEPLRKTFAPSEH 158
            + I   +TD D   +    + N +LNGI+            + LWWGE           
Sbjct: 176 KELI---VTDGDSSLVEQAARVNFKLNGIDTRECHGDCAYKFQRLWWGE----------- 221

Query: 159 SXXXXXXXXXXXXVDLILAADCVYLEKAFPLLEKTL-LDLTEGETPPTILMAYRKRRKAD 217
                        VD++LAAD  Y     P L   L   L++G      L+A   R K  
Sbjct: 222 --------DAVPEVDIVLAADVTYDSSVIPSLTHCLKTALSQG--TQFALVAATVRNKCT 271

Query: 218 KHFFQK 223
              F++
Sbjct: 272 TMAFER 277

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 87/207 (42%), Gaps = 46/207 (22%)

Query: 31  RLKNPLKIHED------GGESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRK 84
           R+ N +KI  +            G + W A   L +++++         G+   +     
Sbjct: 119 RINNQIKIKIEESPYLISAAGTTGFRTWEAAVYLTKYLIDL--------GFPPETV-MEN 169

Query: 85  IVELGSGTGLVGLCIGLLEKNNFHKD--IDAYITDIDQ--IVPLMKQNIQLNGIE--NEV 138
            +ELGSGTG+V   IGL++K   +KD     YITD D   +   + +N+ LNGI+  + V
Sbjct: 170 TLELGSGTGMVS--IGLVKK---YKDQITTLYITDGDSQLLEGQLSRNVMLNGIDSSDSV 224

Query: 139 SAEELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADCVYLEKAFPLLEKTLLDL- 197
             ++L W E         +H             +DLI+AAD  Y     P L   +LD  
Sbjct: 225 KLQKLRWNE---------DH---------IPDNLDLIVAADVTYDSSVIPSLCHCILDCF 266

Query: 198 -TEGETPPTILMAYRKRRKADKHFFQK 223
            +  +      +A  +R +     F++
Sbjct: 267 KSSNKCSTVCYLAATRRNQETIAVFEQ 293

>TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.352
           YJR129C
          Length = 327

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 60/148 (40%), Gaps = 27/148 (18%)

Query: 84  KIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDID-QIVPLMKQNIQLNGIENEVSA-E 141
           K++ELG+GTG+V   + L       K    Y+TD D  +    ++N  LNGIE   +  E
Sbjct: 161 KVLELGAGTGMVSATLALTNPGRLDK---LYVTDGDWHLTQQARKNFSLNGIETSNTYFE 217

Query: 142 ELWWGEPLRKTFAPSEHSXXXXXXXXXXXXVDLILAADCVYLEKAFPLLEKTLLDLTEGE 201
           +L W E    T                   +D ++AAD  Y     P L K    + +  
Sbjct: 218 QLRWNEDPVPT------------------KLDYVVAADVTYDSTVVPDLCKC---IAQSL 256

Query: 202 TP-PTILMAYRKRRKADKHFFQKIKKNF 228
           TP  T L+A   R +     F+   K  
Sbjct: 257 TPRTTCLVAATVRNENTTSTFESTAKEM 284

>TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {ON}
           Anc_1.325 YBR271W
          Length = 421

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 61/118 (51%), Gaps = 10/118 (8%)

Query: 48  GGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEK--- 104
           G K W +  +L ++++  +N +  +N    + ++ R ++ELG+GTGLVG+  G   K   
Sbjct: 215 GWKTWGSSLVLSQYLI--NNFNKYINVNNCHVRKVR-VLELGAGTGLVGISWGCKWKEEV 271

Query: 105 ----NNFHKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEH 158
               N   ++++ ++TD+ +I   + +N+  N + +    + L W +P   T   +E 
Sbjct: 272 TSAGNENLQNMELFLTDLPEITNNLAKNVSTNELSDFCKVDVLNWTDPTSFTNTHTEE 329

>ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa]
           {ON} weakly similar to uniprot|P47163 Saccharomyces
           cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 298

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 68/176 (38%), Gaps = 43/176 (24%)

Query: 48  GGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNF 107
           G + W A   LC+++  +         W     Q  +++E+G+GTGLV   + L      
Sbjct: 117 GHRTWEASLYLCQYLFRQD--------WLP---QVNEVLEIGAGTGLVSTALALAGHQVT 165

Query: 108 HKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXXXX 167
             D D        +V  +++   LN  E  + A+ L WG  L+K   P +          
Sbjct: 166 STDGDP------MVVEQLRKTFNLN--EVNIEAQVLEWG--LQK---PPKS--------- 203

Query: 168 XXXXVDLILAADCVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQK 223
                DL++AAD  Y     P L   L      E   T L+A   R      FFQ+
Sbjct: 204 -----DLVVAADVTYDTAVIPSLGNCL-----RECKTTALVACTIRNSETITFFQE 249

>Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON}
           (182083..183093) [1011 nt, 337 aa]
          Length = 336

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 66/154 (42%), Gaps = 40/154 (25%)

Query: 48  GGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNF 107
           G + W A   +  F +E    D +       SK  + I+ELG+GTGLV   IGL ++  +
Sbjct: 140 GFRTWEAALFMTSFFVETGYLDTM-------SK--KNILELGAGTGLVS--IGLCKQ--Y 186

Query: 108 HKDIDA-YITDIDQIVPLMKQNIQLNGIENEVS------AEELWWGEPLRKTFAPSEHSX 160
              ID  Y+TD D    L++  +  N  ENE+S       ++LWW               
Sbjct: 187 EDSIDKIYVTDGDS--QLVEGQLLKNFNENELSHNDRVILQKLWWN-------------- 230

Query: 161 XXXXXXXXXXXVDLILAADCVYLEKAFPLLEKTL 194
                      +DLI+AAD  Y     P L +T+
Sbjct: 231 ----VDDVPLDLDLIVAADVTYDSSVVPDLCETI 260

>CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129c
          Length = 327

 Score = 36.2 bits (82), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 83/202 (41%), Gaps = 31/202 (15%)

Query: 46  GCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKN 105
             G + W A   L  +++++  S    N  A+ S+    I+ELGSGTGLV L    L   
Sbjct: 129 STGNRTWEAAVYLGLYLIDQCAS----NVVAAPSR----ILELGSGTGLVSLLYQQLYPF 180

Query: 106 NFHKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSXXXXXX 165
           +     D    D D +   +  N+ LN ++  +  ++L WG P       ++        
Sbjct: 181 DKLTMTDG---DWDVVRKRIPGNLSLNDLKPGLEVKQLVWG-PRDANSGDNQWD------ 230

Query: 166 XXXXXXVDLILAADCVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIK 225
                  DLIL +D  Y ++    L + L  L + +     L+    R +A    F+K  
Sbjct: 231 ------YDLILGSDLTYDDRILEPLCQALQWLLKTDGSNEALLGATVRNEATTALFEKYM 284

Query: 226 KNFD-----IVEI--KDFEKYE 240
           + +      I E   +DFE+ E
Sbjct: 285 REYKLQYEVITETTDEDFERLE 306

>Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to
           Ashbya gossypii AER161C
          Length = 320

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 57/147 (38%), Gaps = 43/147 (29%)

Query: 48  GGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNF 107
           G + W A   LC ++ E             +  +F  ++ELG+GTG+V L    L+   F
Sbjct: 131 GFRTWEAALYLCHYLCE-------------SRPRFGTMLELGAGTGIVSLTWHKLQSGQF 177

Query: 108 HKDIDAYITDIDQ--IVPLMKQNIQLNGIE---NEVSAEELWWG-EPLRKTFAPSEHSXX 161
                 Y TD D+  I   +K+    NG++     V  + L W  + + K          
Sbjct: 178 M----TYATDGDKNIIGKQLKETFISNGVDLDKGNVHLQRLLWNVDSIPKN--------- 224

Query: 162 XXXXXXXXXXVDLILAADCVYLEKAFP 188
                      D+ILAAD  Y   A P
Sbjct: 225 -----------DIILAADVTYDHTAIP 240

>KLLA0D16753g Chr4 (1418383..1419351) [969 bp, 322 aa] {ON} similar
           to uniprot|Q12367 Saccharomyces cerevisiae YLR137W
           Hypothetical ORF
          Length = 322

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 44/113 (38%), Gaps = 20/113 (17%)

Query: 36  LKIHEDGGESGCGGKVWIAGELLCEFILEKSNSDDLLNG------------WASNSKQFR 83
           L  + D   S  G  +W     + +++L   N+     G                  + R
Sbjct: 76  LNSNRDNNNSTTGYVIWTTSTFILKWLLYNDNATIFTRGGVKDEVDITSIFQCQQDDKLR 135

Query: 84  KIVELGSGTGLVGLCIGLLEKNNFHKDIDAYI-TDIDQIVPLMKQNIQLNGIE 135
            ++ELG+GT  +   +       F   +D Y+ TD   I+P +K NIQ N  E
Sbjct: 136 YVLELGTGTSPMFPIV-------FSNYVDKYVATDQKDILPRLKDNIQENQSE 181

>TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4.352
           YJR129C
          Length = 316

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 7/67 (10%)

Query: 85  IVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQIVP--LMKQNIQLNGI--ENEVSA 140
           +VE+G+GTG+V + I  ++  N        +TD D+ V    + +N QLNGI  +  V  
Sbjct: 149 VVEIGAGTGMVSIGIMKMQGQNISS---VLVTDGDEYVANKQLPKNFQLNGIVDDTRVKF 205

Query: 141 EELWWGE 147
           +++ W E
Sbjct: 206 QKIRWNE 212

>AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR129C
          Length = 316

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 9/64 (14%)

Query: 86  VELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQIV--PLMKQNIQLNGIENE--VSAE 141
           +ELG+GTGLV L    L       +  AYITD D  +    + +N+ LNG+ +    S  
Sbjct: 154 LELGAGTGLVSL--AWLRSR---PESSAYITDGDSALLEGHLAENLALNGLRSSPRASLR 208

Query: 142 ELWW 145
            LWW
Sbjct: 209 RLWW 212

>KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 308

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 63/165 (38%), Gaps = 44/165 (26%)

Query: 43  GESGCGGKVWIAGELLCEFILEKS----NSDDLLNGWASNSKQFRKIVELGSGTGLVGLC 98
            +   G + W A   LC ++ +        D L+             +ELG GTG++ + 
Sbjct: 110 AQGTTGFRTWEAALFLCHYMTQHPGLFVTHDSLM-------------LELGCGTGIISIL 156

Query: 99  IGLLEKNNFHKDIDA---YITDIDQ-IVPLMKQNIQLNG-IENE----VSAEELWWGEPL 149
             +++ +    D  A    +TD D  ++  +  N QLNG + N+    +  + L W E  
Sbjct: 157 YKMIKDS--QGDCKAGTIIVTDGDSNLLQQVSTNFQLNGSLSNDGDVNIGFQRLRWNEDE 214

Query: 150 RKTFAPSEHSXXXXXXXXXXXXVDLILAADCVYLEKAFPLLEKTL 194
              +                  +DLILAAD  Y     P L K L
Sbjct: 215 LSNY----------------NEIDLILAADVTYDTSVIPDLVKCL 243

>TBLA0E04960 Chr5 (1268270..1270861) [2592 bp, 863 aa] {ON}
           Anc_4.383 YHR204W
          Length = 863

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 44  ESGCGGKVWIAGELLCEFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIG--- 100
           E    GK+   GE+L + IL+ +N DD+ N    NS  F     +   T L G  +G   
Sbjct: 752 EKLAPGKISSYGEILGDDILDNTNYDDISNVEKDNSSNFESGSFVLRATILDGNILGSNS 811

Query: 101 --LLEKNNFHKDIDAY 114
             +L K+   K + AY
Sbjct: 812 SIILNKDAIMKSVTAY 827

>KLTH0E15730g Chr5 complement(1396500..1398224) [1725 bp, 574 aa]
           {ON} similar to uniprot|P53248 Saccharomyces cerevisiae
           YGR077C PEX8 Required for peroxisome assembly peroxisome
           associated protein containing a PTS1 signal
          Length = 574

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 25/50 (50%)

Query: 95  VGLCIGLLEKNNFHKDIDAYITDIDQIVPLMKQNIQLNGIENEVSAEELW 144
           V   I  L K NFH DI A + ++   VP ++  + L+ + + +   + W
Sbjct: 14  VDYIINALSKPNFHGDIKAILNNLVYYVPRVRSKVNLDRLLHAMFCSKAW 63

>NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON}
           Anc_7.430
          Length = 750

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 5/74 (6%)

Query: 19  EHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCEFILEKSNSDD-----LLN 73
           E L   D+  GG++   L   +D   SGCG  +  A       + +   SD+     L  
Sbjct: 590 ECLATLDVCMGGKIAEELIYGKDNTTSGCGSDLQSATNTARSMVTQYGMSDEVGPISLAE 649

Query: 74  GWASNSKQFRKIVE 87
            W S S + R + +
Sbjct: 650 NWESWSNKIRDVAD 663

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.141    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,677,100
Number of extensions: 1295436
Number of successful extensions: 3323
Number of sequences better than 10.0: 62
Number of HSP's gapped: 3329
Number of HSP's successfully gapped: 62
Length of query: 255
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 148
Effective length of database: 41,212,137
Effective search space: 6099396276
Effective search space used: 6099396276
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)