Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G006702.288ON96896850130.0
NCAS0G037802.288ON95795635580.0
KAFR0H033002.288ON96697033760.0
Smik_14.3082.288ON96594132970.0
Suva_14.3242.288ON96890732920.0
YNL023C (FAP1)2.288ON96591332760.0
Skud_14.3062.288ON97091032610.0
KNAG0H019902.288ON97396831390.0
TDEL0G021902.288ON93689531000.0
TBLA0B059502.288ON99590430560.0
ZYRO0A01936g2.288ON95390129370.0
Kpol_1039.452.288ON96891328820.0
CAGL0M06919g2.288ON95695728780.0
SAKL0E07634g2.288ON97489928240.0
KLTH0G10406g2.288ON96390828070.0
TPHA0D015302.288ON96290527800.0
Kwal_27.115182.288ON95391126940.0
KLLA0E08317g2.288ON92190025340.0
ADL213W2.288ON90890924260.0
Ecym_33272.288ON92689323790.0
YDR121W (DPB4)8.275ON196103761.3
KLLA0E00551g4.7ON24284742.3
KAFR0C019503.490ON15772689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00670
         (968 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1935   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1375   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1305   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1274   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1272   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1266   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1260   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1213   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1198   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1181   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...  1135   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...  1114   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...  1113   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...  1092   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...  1085   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...  1075   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...  1042   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   980   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   939   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   920   0.0  
YDR121W Chr4 (693585..694175) [591 bp, 196 aa] {ON}  DPB4Shared ...    34   1.3  
KLLA0E00551g Chr5 complement(45755..46483) [729 bp, 242 aa] {ON}...    33   2.3  
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    31   9.8  

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1935 bits (5013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/968 (98%), Positives = 950/968 (98%)

Query: 1   MSDTELNEVSTHPDPKSLILQASADEIKSSENVSSTSDNXXXXXXXXXXXXXXXXXXMKY 60
           MSDTELNEVSTHPDPKSLILQASADEIKSSENVSSTSDN                  MKY
Sbjct: 1   MSDTELNEVSTHPDPKSLILQASADEIKSSENVSSTSDNDEYDQEDEYAAATAADEDMKY 60

Query: 61  YERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVDRIW 120
           YERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVDRIW
Sbjct: 61  YERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVDRIW 120

Query: 121 KCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHLGPH 180
           KCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHLGPH
Sbjct: 121 KCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHLGPH 180

Query: 181 PECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHSGLC 240
           PECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHSGLC
Sbjct: 181 PECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHSGLC 240

Query: 241 GVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKEI 300
           GVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKEI
Sbjct: 241 GVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKEI 300

Query: 301 RTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIP 360
           RTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIP
Sbjct: 301 RTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIP 360

Query: 361 TCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNIK 420
           TCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNIK
Sbjct: 361 TCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNIK 420

Query: 421 CESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLSCGI 480
           CESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLSCGI
Sbjct: 421 CESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLSCGI 480

Query: 481 HRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCG 540
           HRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCG
Sbjct: 481 HRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCG 540

Query: 541 HTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHKC 600
           HTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHKC
Sbjct: 541 HTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHKC 600

Query: 601 MKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRETY 660
           MKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRETY
Sbjct: 601 MKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRETY 660

Query: 661 VTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDIVPT 720
           VTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDIVPT
Sbjct: 661 VTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDIVPT 720

Query: 721 AIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIHE 780
           AIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIHE
Sbjct: 721 AIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIHE 780

Query: 781 LSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELEKERKLQEFEAR 840
           LSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELEKERKLQEFEAR
Sbjct: 781 LSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELEKERKLQEFEAR 840

Query: 841 TSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVL 900
           TSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVL
Sbjct: 841 TSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVL 900

Query: 901 QDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLSTERLAT 960
           QDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLSTERLAT
Sbjct: 901 QDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLSTERLAT 960

Query: 961 PAIDESTP 968
           PAIDESTP
Sbjct: 961 PAIDESTP 968

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1375 bits (3558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/956 (70%), Positives = 786/956 (82%), Gaps = 13/956 (1%)

Query: 13  PDPKSLILQASADEIKSSENVSSTSDNXXXXXXXXXXXXXXXXXXMKYYERTIQEIAKGD 72
           PDPKSL+L+ S D+       S +S+                   M YYER IQEIAKGD
Sbjct: 12  PDPKSLVLELSDDDSNGESGNSDSSE-------YESDFAGMDDDAMHYYERAIQEIAKGD 64

Query: 73  SYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVDRIWKCPNCYHVNKKV 132
           SYVCMICTVEMDYTCQMYACK+CYRVFDY+CIREWA+KSTEKTVDRIWKCPNCYHVNKKV
Sbjct: 65  SYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRIWKCPNCYHVNKKV 124

Query: 133 PPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHLGPHPECTRMLSITCR 192
           PPKNR TCWCGKVVNPE NPLNPNSCGQTCNA  CVHGC+ ICHLGPHPECTR+++I CR
Sbjct: 125 PPKNRPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKICHLGPHPECTRIITIKCR 184

Query: 193 CGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHSGLCGVCPERLEVNEE 252
           CGKHTKDI CYQS   +G  KFQC + CGLPL+CG+H+C++KCHSGLCG+CPE L   E 
Sbjct: 185 CGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGLCGICPEILNTKEY 244

Query: 253 NAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKEIRTVQYDCDKHSF 312
               ++CYCGS+ + ++KC+D+ +P SA  S + +G KW+GVF C  IR V Y C +HSF
Sbjct: 245 LDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDNIRNVDYKCHEHSF 304

Query: 313 IERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIPTCESHCNKPLKC 372
           +E+CIAPPT+   KPCP+SPKLLKTCPCGKTPL++L + R  CTDPIPTC+S C KPLKC
Sbjct: 305 VEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPIPTCDSRCGKPLKC 364

Query: 373 GKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNIKCESLMSCRRHRC 432
           G+H CPF CH G CMDPCLQI+ +KCSC QQSFLVPCQF   P C  KCESLMSCRRHRC
Sbjct: 365 GRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTTKCESLMSCRRHRC 424

Query: 433 LERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLSCGIHRCQRKCHPGKC 492
            ERCC+GRP AE RKK LFRSQDLMDE+LVE +HICLKECNL+LSCG H+CQRKCHPGKC
Sbjct: 425 TERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCGKHKCQRKCHPGKC 484

Query: 493 PPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCGHTPMPHTCHPLD 552
           PPCLESDSNDLVCPCG+TI+EAPVRCGTKLPPCP+ CIKVVR EYPCGHTPMPHTCHPL+
Sbjct: 485 PPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTCHPLN 544

Query: 553 EPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHKCMKRCHIPGDCQT 612
           EPCPPCTA VFKPCKCGKV +VRTLCFQNDVSCGKICGLPL++C H C KRCH+ G+CQ 
Sbjct: 545 EPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCNHTCQKRCHLLGECQK 604

Query: 613 KCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRETYVTCGAMSNIASA 672
            CKQIC K+RINC+HTC +PCHG T+CPD+PC+VS K+TCECGR+ETYVTCGA S I SA
Sbjct: 605 TCKQICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRKETYVTCGATSTIPSA 664

Query: 673 VTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDIVPTAIAFEELQLPFT 732
            T T +ECDEECE+LERHRQLKEAFGI +  + ST LE E+LKD+   A  FEELQLP+ 
Sbjct: 665 ATKTHIECDEECELLERHRQLKEAFGIVD-SNRSTSLEVEKLKDLAKVATTFEELQLPYN 723

Query: 733 EATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIHELSKAYNLYCESQ 792
           E TLSI+++QE+WC QIEEI+NK MDDK+RPSLHFKPMRPPQRHFI E +K++NLY E+Q
Sbjct: 724 ETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFIQEFAKSFNLYAEAQ 783

Query: 793 DPEPKRSVFIKK--NTTSSKPSFSLSKVLPLYQTFKELEKERKLQEFEARTSKRLVNVEV 850
           D EPKRSVF+KK  + +SSKP  SL   LPLYQTFKELEKERKL+EFEART+ RL+NVE 
Sbjct: 784 DREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERKLKEFEARTTTRLINVEA 843

Query: 851 PEGPTDN-YIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVLQDGKSGVIY 909
           P+   DN Y A+ +GFLIK +SPGTTVEDL+RIFGQ+L STLI NPQYL++QDGK  +IY
Sbjct: 844 PQ--EDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALIY 901

Query: 910 PEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLSTERLATPAIDE 965
           PE+Y  ++A VERD ++LVGHFD ++K+ FI++GVELC ++  +  ERL TP ++E
Sbjct: 902 PENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAMLGERLETPILEE 957

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1305 bits (3376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/970 (65%), Positives = 755/970 (77%), Gaps = 30/970 (3%)

Query: 3   DTELNEVSTHPDPKSLILQASADEIKSS-----ENVSSTSDNXXXXXXXXXXXXXXXXXX 57
           D  LN + THPDPKSL+L+ S D+  S+     E +   SDN                  
Sbjct: 10  DETLN-LHTHPDPKSLVLEFSEDDTSSAASSDDEEMDVLSDNDD---------------- 52

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           M YYER IQEIA GDSY+CMICTVEMDYTC+MYACK+C R+FDYDCIREWA+KSTEKT +
Sbjct: 53  MMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKE 112

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
           RIWKCPNCYHVNKKVP KNR+TCWCGKVVNPE NPLNPNSCGQTCNA +C+HGC+ ICHL
Sbjct: 113 RIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHL 172

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGN-SKFQCKDECGLPLSCGIHKCKRKCH 236
           GPHPEC R +++ C CGKH + I C+QSK+  G  ++F C++ECGLPLSCGIH CK+KCH
Sbjct: 173 GPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCH 232

Query: 237 SGLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFA 296
           SGLCG CPE LEVNEE    +KCYCG ET+KS  CKD+K P +   S DAEGNKW+GVF+
Sbjct: 233 SGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTT--LSRDAEGNKWVGVFS 290

Query: 297 CKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCT 356
           C +IR V+Y C KHSF+E C+APPT+S  K CP+SP LLKTCPCG+TPL  L+KPR  CT
Sbjct: 291 CNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCT 350

Query: 357 DPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPH 416
           DP+PTCE+ CNKPLKCGKH+CPF CH G CMDPC+QI+ + CSC Q  FL PCQF G PH
Sbjct: 351 DPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPH 410

Query: 417 CNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLL 476
           CNIKCESLMSCRRHRC ERCCSGRP AEKRKKTLFRS D+ DETLVEA+H+CLKECNL+L
Sbjct: 411 CNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLML 470

Query: 477 SCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNE 536
           SCG HRCQRKCHPGKCPPCLESDSNDLVCPCGKT+VEAPVRCGTKL PC F CIKV+RNE
Sbjct: 471 SCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNE 530

Query: 537 YPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDC 596
             CGH P+PH+CHPLD+PCPPCTA VFKPCKCGK  +VRT+CFQ DVSCGKICGLPL  C
Sbjct: 531 SVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTC 590

Query: 597 PHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGR 656
            HKC K CH  G+CQ KCKQ+C K+R+NC H C + CHG+TEC D PC VS K++C CGR
Sbjct: 591 HHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTKISCPCGR 650

Query: 657 RETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKD 716
           RE+YVTC A S I SA   T L+C+EECE+++RHR+L+EAFGI E      +L  ERL+ 
Sbjct: 651 RESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVE-KEEPENLGTERLQS 709

Query: 717 IVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRH 776
              +A  +++LQLP+TE  L  +++Q  WC+QIEE++ KFMDD SRPSLHFKPMRPPQR+
Sbjct: 710 FAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRY 769

Query: 777 FIHELSKAYNLYCESQDPEPKRSVFIKKNT--TSSKPSFSLSKVLPLYQTFKELEKERKL 834
           FIHE++KA+NLY ESQD EPKRSVF+KKN   TS KP+  LS VLP+YQ FK+LEKERK 
Sbjct: 770 FIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKA 829

Query: 835 QEFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKN 894
           ++FEART+ RL+N+ + +   +    E NG +IK+LS G T+E L   F ++ KSTLIKN
Sbjct: 830 KQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKN 889

Query: 895 PQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLS 954
           PQYL++++  +G+IYPE +  IT  V  D   LVGHF+V+ K+  I + VE+C I++ L 
Sbjct: 890 PQYLIIEN--NGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENELP 947

Query: 955 TERLATPAID 964
            ERL TP ++
Sbjct: 948 EERLETPRLE 957

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1274 bits (3297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/941 (64%), Positives = 726/941 (77%), Gaps = 9/941 (0%)

Query: 29  SSENVSSTSDNXXXXXXXXXXXXXXXXXXMKYYERTIQEIAKGDSYVCMICTVEMDYTCQ 88
           SSE  SS  DN                  M+YYER+IQEI+KGDSY+CMICTVEMDYTCQ
Sbjct: 25  SSEQDSSVEDNNEQPSSYEEETDDD----MQYYERSIQEISKGDSYICMICTVEMDYTCQ 80

Query: 89  MYACKECYRVFDYDCIREWAVKSTEKTVDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNP 148
           M+ACK CYRVFDY CIREWA+KSTEKTVDRIWKCPNCYHV KKVP  NR TCWCGKVVNP
Sbjct: 81  MFACKRCYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVNP 140

Query: 149 EANPLNPNSCGQTCNAKICVHGCTNICHLGPHPECTRMLSITCRCGKHTKDIFCYQSKTF 208
           + NPL+PNSCGQTC+A IC+HGC+  CHLGPHPECTRM+ I C CGKH++ IFCYQSK  
Sbjct: 141 DPNPLDPNSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAM 200

Query: 209 KGNSKFQCKDECGLPLSCGIHKCKRKCHSGLCGVCPERLEVNEENAWILKCYCGSETQKS 268
           K N  F+C++ECGLPLSC +H CKRKCH+GLCG CPE +   +     +KCYCG+ ++ S
Sbjct: 201 KKN--FKCQEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRAS 258

Query: 269 MKCKDIKIPESAKYSSDAEGNKWIGVFACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPC 328
           +KC + + P+S + S D  GN+WIGVFAC +IRTV + C KHSFIE C++PP+++  K C
Sbjct: 259 IKCSEARFPKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVC 318

Query: 329 PYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGACMD 388
           P+ P LLKTCPCG+T L +L KPR  C DPIPTC S C+KPLKCGKH CPF CH  ACMD
Sbjct: 319 PFLPSLLKTCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMD 378

Query: 389 PCLQIETRKCSCEQQSFLVPCQFTGSPHCNIKCESLMSCRRHRCLERCCSGRPAAEKRKK 448
           PCLQI++ KC+CEQ +F VPC F G P CNIKCESLMSCRRHRC +RCCSGRP+A KR+K
Sbjct: 379 PCLQIDSAKCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRK 438

Query: 449 TLFRSQDLMDETLVEAEHICLKECNLLLSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCG 508
             FRSQDL+DE+LVEA+HICLK CNL LSCGIH+CQRKCHPGKCPPCLESDSNDL+CPCG
Sbjct: 439 NFFRSQDLLDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCG 498

Query: 509 KTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKC 568
           KT+V APVRCGT+LP C   CIKVVR E  CGH PMPHTCHPL  PCPPCT  VFKPCKC
Sbjct: 499 KTVVPAPVRCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKC 558

Query: 569 GKVKEVRTLCFQNDVSCGKICGLPLKDCPHKCMKRCHIPGDCQTKCKQICGKRRINCDHT 628
           GK  +VRT+CFQ DVSCG  CGL L  C H C K CH+PG+CQ  CKQICG  R++C HT
Sbjct: 559 GKKDKVRTVCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHT 618

Query: 629 CSRPCHGNTECPDVPCTVSAKVTCECGRRETYVTCGAMSNIASAVTTTILECDEECEMLE 688
           C +PCHG TECPD+PC    K+TC+CGR E  VTC A S +  A  +++L+CDEECE L+
Sbjct: 619 CPKPCHGKTECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEALK 678

Query: 689 RHRQLKEAFGIKEIISSSTDLEFERLKDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQ 748
           R ++L+EAFGIKE  ++ T  E + LK +V  A  FEEL LPFTE TLS++S+QERWC Q
Sbjct: 679 RLKELREAFGIKEESNNVTSNELDALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQ 738

Query: 749 IEEIINKFMDDKSRPSLHFKPMRPPQRHFIHELSKAYNLYCESQDPEPKRSVFIKK--NT 806
           IE I+NK MDDK+R SLHFKPMRPPQRHFI EL+KAY LY ESQD EP RSVFIKK  N 
Sbjct: 739 IEVILNKLMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNG 798

Query: 807 TSSKPSFSLSKVLPLYQTFKELEKERKLQEFEARTSKRLVNVEVPEGPTDNYIAEANGFL 866
           TS+KP  SL + LPLY++FK+L+KERK+QEF++RT+ +L+N EV +      +A+ NGFL
Sbjct: 799 TSNKPVLSLGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFL 858

Query: 867 IKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVLQDGKSGVIYPEDYPTITANVERDFKS 926
           +++L  G TVEDL+R F  +LK TL+ NPQYL+L DGK+ ++YPE+Y T + N ERD + 
Sbjct: 859 VRNLVTGNTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMEL 918

Query: 927 LVGHFDVLAKDTFISEGVELCKIDDVLSTERLATPAIDEST 967
           LVGHFD +AK+ F+++ + LC  D+ +  +RL TP I E T
Sbjct: 919 LVGHFDFMAKEAFLADSILLCSTDEEVG-KRLDTPVIQEDT 958

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1272 bits (3292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/907 (65%), Positives = 716/907 (78%), Gaps = 5/907 (0%)

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           M+YYER IQEIAKGDSY+CMICTVEMDYTCQM+ACK+CYRVFDY CIREWA+KSTEKTVD
Sbjct: 54  MQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 113

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
           +IWKCPNCYH+ KKVP +NR TCWCGKVVNP+ NPL+PNSCGQTCNA  CVHGC+ ICHL
Sbjct: 114 KIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKICHL 173

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237
           GPHPECTR + I CRCGKH+K IFCYQSK  K +  F C++ECGLPLSCGIHKCK+KCHS
Sbjct: 174 GPHPECTRTVEIKCRCGKHSKSIFCYQSKAMKKH--FDCQEECGLPLSCGIHKCKKKCHS 231

Query: 238 GLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFAC 297
           GLCG CPE +   ++    +KCYCG  ++ S+KC ++  P+S + S D  GN+WIGVFAC
Sbjct: 232 GLCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFAC 291

Query: 298 KEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTD 357
           K+IRTV Y C KHSFIE CI+PPT++ +K CP+ P LLKTCPCG+T L++L KPR  CTD
Sbjct: 292 KDIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCTD 351

Query: 358 PIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHC 417
           PIPTC S C+KPLKCGKH CPF CH GACMDPCLQ ++ KC+CEQ +FLVPC F   PHC
Sbjct: 352 PIPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPHC 411

Query: 418 NIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLS 477
           NIKCESLMSCRRHRC++RCCSGRP+A +RKK +FRSQDLMDE+LVEA+HICLK CNL LS
Sbjct: 412 NIKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTLS 471

Query: 478 CGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEY 537
           CGIH+CQRKCHPGKCPPCLESDSNDLVCPCGKT++ APVRCGTKLP C + CIKVVR E 
Sbjct: 472 CGIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGES 531

Query: 538 PCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCP 597
            CGH PMPHTCHPLD  CPPCT  VFKPCKCGK  +VRT+CFQ DVSCG  CG PL  C 
Sbjct: 532 ECGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGCH 591

Query: 598 HKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRR 657
           H C K CH+P +CQ  CKQIC ++R NCDH C +PCHG +ECPD+PC    K+TC+CGR 
Sbjct: 592 HTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGRI 651

Query: 658 ETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDI 717
           E  V CGA SN+ S      L+C+EECE L+R ++L+EAFGI E  + ST+ E + LK +
Sbjct: 652 EKKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDTLKKL 711

Query: 718 VPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHF 777
           V  A  FEELQLPFTE  LS++++QE WC QIE I+NK M DK+R SLHFKPMRPPQRHF
Sbjct: 712 VSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRHF 771

Query: 778 IHELSKAYNLYCESQDPEPKRSVFIKK--NTTSSKPSFSLSKVLPLYQTFKELEKERKLQ 835
           I EL+KAYNLY ESQD EP RSVFIKK  N+ SS+P  SL++  PLY++FKEL+KERK+Q
Sbjct: 772 IRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKIQ 831

Query: 836 EFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNP 895
           EF+ART+ +L+N EV +      +A+ NGFL++ L  G  V+DL R F  +LK TL+  P
Sbjct: 832 EFQARTTAKLINFEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVKP 891

Query: 896 QYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLST 955
           QYL++ DGK+ ++YPE+Y  ++ N ERD   LVGHFD +AK+ F+++ + LC ID+ L  
Sbjct: 892 QYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEELG- 950

Query: 956 ERLATPA 962
            RL  P 
Sbjct: 951 RRLDPPV 957

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1266 bits (3276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/913 (65%), Positives = 713/913 (78%), Gaps = 5/913 (0%)

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           M+YYER IQEI+ GDSYVCMICTVEMDYTCQM+ACK CYRVFDY CIREWA+KSTEKTVD
Sbjct: 50  MQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVD 109

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
           RIWKCPNCY+V+K+VP KNR TCWCGKVVNP+ NPL+PNSCGQTCNA  C+HGC+ ICHL
Sbjct: 110 RIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICHL 169

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237
           GPHPECTRM+ I C CGKH+K IFCYQSK  K N  F C++ CGLPLSC IH CK+KCH 
Sbjct: 170 GPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKN--FNCQEVCGLPLSCSIHTCKKKCHP 227

Query: 238 GLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFAC 297
           GLCG CPE +   +     +KCYCG+ T+ ++KC + K P+S K S D  GN+WIGVFAC
Sbjct: 228 GLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFAC 287

Query: 298 KEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTD 357
            + R V Y C KHSFIE CI+PPT++ EK CP+ P  LKTCPCG+T L++L KPR  C D
Sbjct: 288 ADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDD 347

Query: 358 PIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHC 417
           PIPTC+S C KPLKCGKH CPF CH  ACM+PCLQI++ KC+CEQ +F VPC F G P C
Sbjct: 348 PIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRC 407

Query: 418 NIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLS 477
           NIKCESLMSCRRHRC +RCCSGRP+A +RKK LFR+QDL+DE+LVEA+HICLK CNL LS
Sbjct: 408 NIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLS 467

Query: 478 CGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEY 537
           CGIH+CQRKCHPGKCPPCLESDSNDLVCPCG T+V APVRCGTKLP C   CIKVVR E 
Sbjct: 468 CGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGES 527

Query: 538 PCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCP 597
            CGH PMPHTCH LD  CPPCT  VFKPCKCGK  +VRT+CFQ DVSCG  CG+PL  C 
Sbjct: 528 TCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCY 587

Query: 598 HKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRR 657
           H C K CH+PG+CQ  CKQ CG++R+NC+H C +PCHG TECPD+PC    K+ C+CGR 
Sbjct: 588 HTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRI 647

Query: 658 ETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDI 717
           +  VTCGA S+  S   +++L+C+EECE L+R ++LKEAFGIKE  ++ T  E + LK +
Sbjct: 648 KKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKKL 707

Query: 718 VPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHF 777
           V  A  FEELQLPFTEA LS++S+QERWC QIE I+NK MDDK+R SLHFKPMRPPQRHF
Sbjct: 708 VSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHF 767

Query: 778 IHELSKAYNLYCESQDPEPKRSVFIKK--NTTSSKPSFSLSKVLPLYQTFKELEKERKLQ 835
           I EL+KAY LY ESQD EP RSVFIKK  N  S+KP  SL++  PLY++FK+L+KERK Q
Sbjct: 768 IRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQ 827

Query: 836 EFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNP 895
           EF+ART+ +L+N EV +      +A+ NGFL+++L  G T EDL R F  +LK TL+ NP
Sbjct: 828 EFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNP 887

Query: 896 QYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLST 955
           QYL+L DGK+ ++YPE+Y T + N ERD + LVGHFD +AK+ F+++ + LC  ++ L  
Sbjct: 888 QYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELE- 946

Query: 956 ERLATPAIDESTP 968
            RL TP I E +P
Sbjct: 947 RRLDTPVIQEDSP 959

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1260 bits (3261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/910 (64%), Positives = 719/910 (79%), Gaps = 5/910 (0%)

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           ++YYER IQEIAKGDSY+CMICTVEMDYTCQM+ACK+CYRVFDY CIREWA+KSTEKTVD
Sbjct: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
           +IWKCPNCYHV KKVP +NR TCWCG VVNP+ N L+PNSCGQTCNA  CVHGC  ICHL
Sbjct: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237
           GPHPECTRM+ I C CG+H+K IFCYQSK  +   +F C++ECGL LSCG+HKCK+KCHS
Sbjct: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMR--RRFNCQEECGLSLSCGVHKCKKKCHS 232

Query: 238 GLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFAC 297
           GLCG CPE +  ++ +   +KCYCG+  Q S+KC + + P+S + S D  GN+W GVFAC
Sbjct: 233 GLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFAC 292

Query: 298 KEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTD 357
            +IRTV Y C KHSFIE C++PPT+S +K CP+ P LLKTCPCG+T L++L KPR  C D
Sbjct: 293 ADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHD 352

Query: 358 PIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHC 417
           PIPTC S C+KPLKCGKH CPF CH GACMDPCLQI++  CSCEQ +F +PC F  SP C
Sbjct: 353 PIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRC 412

Query: 418 NIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLS 477
           NIKCESLMSCRRHRC++RCCSGRP+A +RKK+ FRSQDL+DE+LVEA+HICLK CNL LS
Sbjct: 413 NIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLS 472

Query: 478 CGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEY 537
           CG+H+CQRKCHPGKCPPCLESDSNDL+C CGKT+V APVRCGTKLP C   CIKVVR E 
Sbjct: 473 CGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGES 532

Query: 538 PCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCP 597
            CGH PMPHTCHP +  CPPCT  VFKPC+CGK  +VRT+CFQ DVSCG  CG+PL  C 
Sbjct: 533 WCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCY 592

Query: 598 HKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRR 657
           H C K CH+ G CQ  CKQICG++R++C HTC +PCHG TECPD+PC    K+TCECGR 
Sbjct: 593 HTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRI 652

Query: 658 ETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDI 717
           +  +TC A  +  S +T++IL+C+EECE L+R ++L+EAFG+ E  ++    E + L ++
Sbjct: 653 KKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSEL 712

Query: 718 VPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHF 777
           V  A  FEELQLPFTEATLS++S+QERWC QIE I+NK MD + R SLHFKPMRPPQRHF
Sbjct: 713 VSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHF 772

Query: 778 IHELSKAYNLYCESQDPEPKRSVFIKK--NTTSSKPSFSLSKVLPLYQTFKELEKERKLQ 835
           IHE++KAYNLY ESQD EP RSVFIKK  N TS KP  SL++  PLY++FK+ +KERKLQ
Sbjct: 773 IHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQ 832

Query: 836 EFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNP 895
           EF+ART+ +L+N EV +  +    A+ NGFL+++L  G TVEDL+R F  +LK TL+ NP
Sbjct: 833 EFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANP 892

Query: 896 QYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLST 955
           QYL+L D +S +IYPE+Y T + N ERD + LVGHFD +AK+ F+++ + LC +D+ +  
Sbjct: 893 QYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIG- 951

Query: 956 ERLATPAIDE 965
           +RL +PAI E
Sbjct: 952 KRLDSPAIQE 961

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1213 bits (3139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/968 (59%), Positives = 718/968 (74%), Gaps = 19/968 (1%)

Query: 13  PDPKSLILQASADEIKSSENVSSTSDNXXXXXXXXXXXXXXXXXXMKYYERTIQEIAKGD 72
           PDPKSL+L  S+D+  S+   + T                     + YYER ++EIAKGD
Sbjct: 8   PDPKSLVLNFSSDDEDSATEANITYSEEEEEEIATSDTEEDQD--LPYYERAVREIAKGD 65

Query: 73  SYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVDRIWKCPNCYHVNKKV 132
            Y CMICTVEMDYTC+M+AC++CYRVFDYDC+REWA+KST+KTVDRIWKCPNCY VNKKV
Sbjct: 66  LYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVDRIWKCPNCYLVNKKV 125

Query: 133 PPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHLGPHPECTRMLSITCR 192
           P KNR TCWCGKVVNPE NPL+PNSCGQTC+AKIC+HGC+ ICHLGPHPEC R  S+ CR
Sbjct: 126 PTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHLGPHPECLRTTSVKCR 185

Query: 193 CGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHSGLCGVCPERLEVNEE 252
           CGK TK+I C+++K  +G + FQC + C   L CGIH+C++ CHSGLCG CPE L V E 
Sbjct: 186 CGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHSGLCGSCPENLTVKEG 245

Query: 253 NAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKEIRTVQYDCDKHSF 312
           +   + CYCG  T+ S+KCKD+ +  + + S +A G++WIGV+ACK+IR+V+Y C +HSF
Sbjct: 246 DDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGDEWIGVYACKDIRSVEYSCRQHSF 303

Query: 313 IERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIPTCESHCNKPLKC 372
            E CIAPPT++  K CP+SPK LKTC CGKTPLQ L K R  C DPIP CES C+K LKC
Sbjct: 304 FEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPIPHCESRCDKLLKC 363

Query: 373 GKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNIKCESLMSCRRHRC 432
           GKH CPF+CH G CMDPC+QI+  KC+CE+ +FLVPC F G+PHC +KCESL+SCRRH+C
Sbjct: 364 GKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQLKCESLLSCRRHKC 423

Query: 433 LERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLSCGIHRCQRKCHPGKC 492
            ERCCSGRPAAE+R+K   R QD+ DETL+EAEH+CLK CNL LSCG H+CQRKCHPGKC
Sbjct: 424 AERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCGQHQCQRKCHPGKC 483

Query: 493 PPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPCGHTPMPHTCHPLD 552
           PPCLESDSNDLVCPCGKTIV APVRCGTKLP C   CIKVV     CGH P+PH CHPLD
Sbjct: 484 PPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISECGHKPIPHACHPLD 543

Query: 553 EPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHKCMKRCHIPGDCQT 612
           +PCPPCTA VFKPCKCGK   VRT+CFQ DVSCG+ CG PL +C H C K CH+PG CQ 
Sbjct: 544 QPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHFCQKTCHLPGQCQA 603

Query: 613 KCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRETYVTCGAMSNIASA 672
            CKQ+C K  +NC H C + CHG   CPD+ C    K+ C CGR+E  VTCGA S ++S+
Sbjct: 604 TCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEVEVTCGATSTLSSS 663

Query: 673 VTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDL---EFERLKDIVPTAIAFEELQL 729
           + T  LECDEECE   RHRQLKEAFGI + +++ + +   E  RL+ +   A  FEELQ 
Sbjct: 664 LFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEGLASKATTFEELQF 723

Query: 730 PFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIHELSKAYNLYC 789
           PFTE+T+S + RQ +WC +IEE +N FMD++ + SLHFKPM+PPQR FI EL+KAYNLY 
Sbjct: 724 PFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRLFIRELAKAYNLYS 783

Query: 790 ESQDPEPKRSVFIKKNT--TSSKPSFSLSKVLPLYQTFKELEKERKLQEFEARTSKRLVN 847
           E+QDPEPKRSVF+KKN   +S+KP FSLS++ PLYQ+FK LEKERK+Q+F A+T+  L+N
Sbjct: 784 EAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKMQDFLAKTTTHLIN 843

Query: 848 VEVPE--GPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVLQDGKS 905
           V++ +       +  + N FLIK++S GTT++DL+ +FG+Y++ TLI+NPQY  L +  S
Sbjct: 844 VKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKTLIRNPQYQELPEENS 903

Query: 906 GVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLS--------TER 957
            ++YPEDY TI+AN   D ++LVGH + +  D F+++  ELC     L         +ER
Sbjct: 904 AIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDASSKLPEEISENDISER 963

Query: 958 LATPAIDE 965
           L TP + E
Sbjct: 964 LETPEVQE 971

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1198 bits (3100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/895 (62%), Positives = 689/895 (76%), Gaps = 6/895 (0%)

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           M YYER +QEIA GD YVCMICTVEMDYTC+MYAC+ CYRVFDY+CIREWA+KSTEKT+D
Sbjct: 38  MAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLD 97

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
           R+WKCPNCY VNK+VP KNR TCWCGK VNP+ NPL+PNSCGQTC+A IC HGC+  CHL
Sbjct: 98  RVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHL 157

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237
           GPHP+C R ++  C+CGKHT++ FCYQ+ + KG S+FQC + CGLPL+CGIHKC+R CHS
Sbjct: 158 GPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHS 217

Query: 238 GLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFAC 297
           G+CG CP  L   + N   ++CYCG E + S KCKD+++  ++  S D +G+ WIG F C
Sbjct: 218 GICGPCPAVLNA-KSNKLKIRCYCGLEHRDSFKCKDVRV--ASDLSKDGKGDSWIGAFGC 274

Query: 298 KEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTD 357
             IR ++Y C +HSF+E+C   P++S +  CP+SPKLLKTCPCG+T L+ LA+PR  CT 
Sbjct: 275 SGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTS 334

Query: 358 PIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHC 417
           PIP C+S C K L CG+H CPF CH G CMDPC+QIET +CSC +  + VPCQF   P C
Sbjct: 335 PIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRC 394

Query: 418 NIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLS 477
           + KCESLMSCRRHRC ERCC GRP AE+R+KT   S++LMDE+ VE+EHICLK+CNL LS
Sbjct: 395 DTKCESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTLS 454

Query: 478 CGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEY 537
           CG H+CQRKCHPGKCPPCLESDSNDLVCPCGKT+VEAPVRCGT+LPPC + CI+V++N Y
Sbjct: 455 CGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAY 514

Query: 538 PCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCP 597
            CGH PMPHTCHPL+EPCP CTAPVFKPCKCGK  +VRTLCFQNDVSCG  CG PL +CP
Sbjct: 515 KCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCP 574

Query: 598 HKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRR 657
           H C K CHIPG+CQ KCKQIC ++RI CDH C   CHGN +CPD+PC +S K+ CEC  +
Sbjct: 575 HMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVK 634

Query: 658 ETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDI 717
           E+++TCGA S   S  TTTIL CDEECE  +RH QL+EAFGI     + +  +   L+++
Sbjct: 635 ESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLENL 694

Query: 718 VPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHF 777
              A +FEEL+LPF+E  L  F++QE WC QIE ++N FMD++ + SLHFKPMRP QRHF
Sbjct: 695 AAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHF 754

Query: 778 IHELSKAYNLYCESQDPEPKRSVFIKK--NTTSSKPSFSLSKVLPLYQTFKELEKERKLQ 835
           IHEL+K+YNLY ESQD EPKRSVF+KK  N  S KP   L   LP+YQ FKE EKE+K Q
Sbjct: 755 IHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQ 814

Query: 836 EFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNP 895
            FEA+T+   VN  +P+       A+ N F +K++S GTT EDLERIF  +LK TL+KNP
Sbjct: 815 RFEAQTTTEFVNF-IPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNP 873

Query: 896 QYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKID 950
           Q+ +    K+G+IYPEDY  I+ NVERD ++LVGHFD L K++FI +G+ELC ID
Sbjct: 874 QFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHID 928

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1181 bits (3056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/904 (63%), Positives = 690/904 (76%), Gaps = 7/904 (0%)

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           + YYER ++EIAKGDSY CMICTVEMD+TC+MYAC+ CYRVFDYDCIREWA+KST+KTVD
Sbjct: 69  LMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKTVD 128

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
           + WKCPNCYH +KKVP K+R TCWCGKVVNP+ NPL+PNSCGQTCNA IC H C   CHL
Sbjct: 129 KTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCLKQCHL 188

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237
           G HPECT++L ITCRCG+ TKDI+C++S+  K  S F C  ECGL L CGIHKC+RKCHS
Sbjct: 189 GSHPECTQLLKITCRCGRETKDIYCHESRRQK--SIFHCDQECGLTLPCGIHKCRRKCHS 246

Query: 238 GLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFAC 297
           GLCG CPE L ++E  +  +KCYCG  + K M CKD+  P S K S + E  +W+G+F C
Sbjct: 247 GLCGSCPELL-IDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDC 305

Query: 298 KEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTD 357
           KE+R+V Y C++H F+E CIAPPTL     CP+SP LLKTCPCGKT LQ +   RT CTD
Sbjct: 306 KEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTD 365

Query: 358 PIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHC 417
           PIPTC++ CNK LKCGKH+CPF CHTG CMDPC+QI+   C+CE+++FLVPCQF G P C
Sbjct: 366 PIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVC 425

Query: 418 NIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLS 477
             KCESLMSCRRHRC+E CCSGRP AE+RKKT+ RS D  DETLVEAEH+CLK+CNL LS
Sbjct: 426 KFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLS 485

Query: 478 CGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEY 537
           CGIH CQRKCHPG CPPCLESDSNDLVCPCGKT++ APVRCGT LPPC + CIKV+R E 
Sbjct: 486 CGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGES 545

Query: 538 PCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCP 597
            CGH PMPH+CH LD+PCP CTAPVFKPCKCGK  +VRT+CFQ DVSCG  CGLPLKDC 
Sbjct: 546 DCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDCY 605

Query: 598 HKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRR 657
           HKC KRCH+PG+CQ  C QIC  +R NC H C++ CH N  CPD+PCTV   V C+CGRR
Sbjct: 606 HKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDCGRR 665

Query: 658 ETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSS-TDLEFERLKD 716
           +    C + S I S   T+ LECDEEC +L R  +LK AFGI   +    T +  ER+++
Sbjct: 666 KLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVAIERIQN 725

Query: 717 IVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRH 776
            +  A A+EEL+LPF EA L+++++Q +WC QIE I+NKFMD+K + SLHFK M+ PQR 
Sbjct: 726 RISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQRS 785

Query: 777 FIHELSKAYNLYCESQDPEPKRSVFIKK--NTTSSKPSFSLSKVLPLYQTFKELEKERKL 834
           F+H L+ AY +Y ESQDPEP RSVF+KK  N TSSKP  +L + LPLY++FKE++KE+K 
Sbjct: 786 FVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKEKKK 845

Query: 835 QEFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKN 894
           QE+EART K L+NVE  E  T     + NGFLIK+L  GTT EDLERIFG+ LK TL+K+
Sbjct: 846 QEYEARTHKTLINVEA-ETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKD 904

Query: 895 PQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLS 954
           PQYLV+ +   G I P DY  I+ NVERD + L+G FD L K+ FI + VELC ID+ L 
Sbjct: 905 PQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEALL 964

Query: 955 TERL 958
            E +
Sbjct: 965 QENV 968

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score = 1135 bits (2937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/901 (59%), Positives = 670/901 (74%), Gaps = 11/901 (1%)

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           M YYER ++EIA+GD+YVCMICTVEMDYTC+M+AC +CYRVFDYDCIREWA+KST +T+D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
           + WKCPNC   + KVP K+R TCWCGKVVNP+ NPL+PNSCGQTC+A IC HGC+ +CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237
           GPHPECTR++SI C+CG+HT+D+ C +  + + N +F C++ CGL L CG+HKC +KCHS
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGR-NQQFTCEESCGLLLPCGVHKCSKKCHS 234

Query: 238 GLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFAC 297
           GLCG C E L    +   ++KCYCG     S++C D+++ +  + S D +GN WIGVF C
Sbjct: 235 GLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVAD--RDSVDDQGNGWIGVFRC 292

Query: 298 KEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTD 357
           K++R V+Y C +HSF+E C   P+L  +  CP+SP +L++CPCG+TPL KL + R  CTD
Sbjct: 293 KDVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTD 352

Query: 358 PIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHC 417
            IPTCES C K L CGKH CP+KCH G CMDPC+Q E   C CE +SFLVPCQF   P C
Sbjct: 353 HIPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRC 412

Query: 418 NIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLS 477
           N KCESLMSCRRHRC E+CCSG+P AE+RKKT F S++L+DE+LVEAEH+CLK CNL L+
Sbjct: 413 NTKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLT 472

Query: 478 CGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEY 537
           CG H+CQRKCHPG+CPPCLESD NDLVCPCGKT+VEAPVRCGTKLPPCP+ CI VVR+ Y
Sbjct: 473 CGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGY 532

Query: 538 PCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCP 597
           PCGHTPMPH CHP +E CPPCTA V KPCKCGK  +VRTLCFQ DVSCG+IC  PL  C 
Sbjct: 533 PCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCR 592

Query: 598 HKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRR 657
           H C K+CH  G CQ KC+QICGK+R+NCDH C +PCHG   CPD PC  S  + C CGR+
Sbjct: 593 HTCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRK 651

Query: 658 ETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDI 717
           E+   CG  S   SA  T  L CDEECE ++R  QLK+A G+KE    + D   E     
Sbjct: 652 ESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKE----NGDSSVENTVSN 707

Query: 718 VPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHF 777
              A  FEEL LPF E  L+I+SRQ+R+C  IE ++N F+DD+ + SLHFKPM+P QRHF
Sbjct: 708 ALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHF 767

Query: 778 IHELSKAYNLYCESQDPEPKRSVFIKK--NTTSSKPSFSLSKVLPLYQTFKELEKERKLQ 835
           +HEL+KAY LY ESQDPEPKRSV++KK  N  S+KPS +L + LP+YQ FK+ EKE K++
Sbjct: 768 VHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIR 827

Query: 836 EFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNP 895
            +E +    LVN  VP+      +A+ NGFLI++L+ GT  EDL+RI+G++LK TL++NP
Sbjct: 828 RYEMQNVTNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNP 886

Query: 896 QYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLST 955
            Y  L D    +I+PE Y  +T N E D + LVGHFD + K+ FI +GVELC++ + L  
Sbjct: 887 VYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQP 946

Query: 956 E 956
           E
Sbjct: 947 E 947

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score = 1114 bits (2882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/913 (59%), Positives = 667/913 (73%), Gaps = 14/913 (1%)

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           + +YER I++IAKGD Y CMICT+E+D T +MYAC  CYRVFDYDCIREWAVKS++K++D
Sbjct: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
           ++WKCPNC H + K+P +NR TCWCGK VNP+ NP  PNSCGQTCNAK C+H C++ CHL
Sbjct: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKG-NSKFQCKDECGLPLSCGIHKCKRKCH 236
           GPHP+C R  +I C CGKHTKD+FCY     K  N KF C ++C + LSCGIHKC R CH
Sbjct: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245

Query: 237 SGLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFA 296
           SG CG CPE +         + CYCGS T   ++C ++KI +S K S D EGN WIGVF 
Sbjct: 246 SGSCGPCPELITKK------VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFK 299

Query: 297 CKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCT 356
           C +IRTV+Y C  HSF E C +PPT+S  K CPYSPKLLKTCPCGKT L      R  CT
Sbjct: 300 CNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCT 359

Query: 357 DPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPH 416
           DPI TCE+ C+KPLKCGKHKCPF CH G CMDPC QIE RKCSC  + F VPCQF   P 
Sbjct: 360 DPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPR 419

Query: 417 CNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLL 476
           CN+KCESLMSCRRHRC  RCCSG+P A+KRKK LF   DL+DE+LVEAEHICLK+CNL L
Sbjct: 420 CNMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKL 479

Query: 477 SCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNE 536
           SCGIH C RKCH GKCPPCLESDS+DLVCPCGKT+VEAPVRCGTKLP C F CIK +   
Sbjct: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539

Query: 537 YPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDC 596
           YPCGH P  H CHP D PCPPCT  VFKPCKCGK ++ + LCFQ   SCGK+C   L  C
Sbjct: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599

Query: 597 PHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGR 656
            H C  +CH+PG+CQ KC QIC KRR+NC HTC + CHG++ CPD+PC V  +V C CGR
Sbjct: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659

Query: 657 RETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTD--LEFERL 714
           R+  + CGA S   S   T +L CD+ C   +R  +L+ AFG+K   SSS D   E ERL
Sbjct: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMK---SSSEDPESELERL 716

Query: 715 KDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQ 774
           K IV    ++EEL+LPF+E  LS++S+Q  WC QIEE+INKF++DK++PSLHFKPM  PQ
Sbjct: 717 KKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQ 776

Query: 775 RHFIHELSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELEKERKL 834
           R+FIH L +AY +Y ESQD EPKRSV++KKN  +  P+ SL + LPLYQ++K++EKERK+
Sbjct: 777 RNFIHALVEAYEMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKERKV 836

Query: 835 QEFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKN 894
           Q FE++ +   +N + PE      + + NGFLIK ++ GTT +DL  +FG +LK TLIK+
Sbjct: 837 QSFESKKNVTYLNYQPPERSLTPDV-KYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKD 895

Query: 895 PQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLS 954
            QY +L DGKS ++YP+DY TI+ NVERD +SL GHFD + K+  + E VE+C I D+L 
Sbjct: 896 AQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDILQ 955

Query: 955 TERLATPAIDEST 967
           TE  A P+ + +T
Sbjct: 956 TES-AEPSEETTT 967

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score = 1113 bits (2878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/957 (56%), Positives = 678/957 (70%), Gaps = 12/957 (1%)

Query: 1   MSDTELNEVSTHPDPKSLILQASADEIKSSENVSSTSDNXXXXXXXXXXXXXXXXXXMKY 60
           ++  E      HPD  SL++  S DE +   N+ +                      M Y
Sbjct: 8   VTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGA------ELSEELSDLDEGDEKDMAY 61

Query: 61  YERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVDRIW 120
           YE+ +QEI KGDSY C+ICTVE+DYTC++YAC++CYRV+DY+CIREWA KST K  D++W
Sbjct: 62  YEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTDKLW 121

Query: 121 KCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHLGPH 180
            CPNC++  K +P KNR TCWCG+ VNPE NPLNPNSCGQTCNAKIC HGC+ ICHLGPH
Sbjct: 122 ACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHLGPH 181

Query: 181 PECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHSGLC 240
            ECTRM+SI C CGK TKDI C+Q + +  +  F C+  C   L CGIHKC RKCH+GLC
Sbjct: 182 QECTRMMSIKCSCGKVTKDIVCFQRRLY--SKGFNCETVCDKLLPCGIHKCNRKCHTGLC 239

Query: 241 GVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKEI 300
           G CPE + +++     ++CYCG  ++  +KCKD++ P +A YS D +G +WIGVF C +I
Sbjct: 240 GSCPETI-ISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKI 298

Query: 301 RTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPIP 360
           R V Y+C +HSF E+C APP++S    C +SPK LKTCPCGK  L  L+KPR+ CTD IP
Sbjct: 299 RKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIP 358

Query: 361 TCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNIK 420
           TC   C K LKCGKHKCPF CH G CMDPC QIE  +C+CEQ+ F +PC F     CN+K
Sbjct: 359 TCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLK 418

Query: 421 CESLMSCRRHRCLERCCSGRPAAEKRKKTL-FRSQDLMDETLVEAEHICLKECNLLLSCG 479
           CESLMSCRRHRC ERCC+GRP AE+R+KT+    +DL DE+ +E  HICLK+CNL LSCG
Sbjct: 419 CESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCG 478

Query: 480 IHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPC 539
           IH+C RKCH GKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLP CP+ CI+VVR E  C
Sbjct: 479 IHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDC 538

Query: 540 GHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHK 599
           GH+PMPH CHP D PCP CTA VFKPCKCGK + VRT+CF  DVSCGK+CG  L+ C HK
Sbjct: 539 GHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHK 598

Query: 600 CMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRET 659
           C K+CH PG CQT CKQ C   R+ C+H C +PCH   ECPD+PCT   K+TC CGR E 
Sbjct: 599 CQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEK 658

Query: 660 YVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDIVP 719
            VTCG  S    A  +T + CDEEC +L+RH QLKEAFGI +   ++ + E  RL+ ++ 
Sbjct: 659 EVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVIS 718

Query: 720 TAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIH 779
           TA  F +L LPFTE  ++ + R E WC  IE  +NK +DD +R SLHFKPMRPPQR+FI 
Sbjct: 719 TASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIR 778

Query: 780 ELSKAYNLYCESQDPEPKRSVFIKKNT--TSSKPSFSLSKVLPLYQTFKELEKERKLQEF 837
           EL+KAYNLY ESQDPEP RSVF+KKN   +S+KP  S+S+  PLYQ++K+LEKE+K   F
Sbjct: 779 ELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANF 838

Query: 838 EARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQY 897
           E+ T+ RL+N      P     A  NGFL+ ++   T+ +DL+ +F  YLKSTL+  PQ+
Sbjct: 839 ESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQF 898

Query: 898 LVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLS 954
            +L + K  VIYP  Y  I+ NVERD ++LV HFD L K++ ++ GVELC I++VL+
Sbjct: 899 QILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLA 955

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score = 1092 bits (2824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/899 (59%), Positives = 659/899 (73%), Gaps = 17/899 (1%)

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           + YYE+TI EI KGDSY CMICT+EMDYTC MYAC ECYRV+D++CIREWA+KS++K++D
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
           + WKCPNCY+VN ++P KNR TCWCGKVV+PE+NP++PNSCGQTCNA IC HGC+  CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237
           GPHPEC R   + C CGKHTKD+FCYQS+  K +  +QC + C L L CG+HKC+RKCHS
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKAS--YQCGEPCNLLLPCGVHKCQRKCHS 225

Query: 238 GLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFAC 297
           G CG C E +      +  + CYCG ET++ + CKD+K   S   S +  G  WIGVF+C
Sbjct: 226 GPCGNCEETI------SGKIMCYCGMETREQIICKDVK---SVAKSKNKSGEIWIGVFSC 276

Query: 298 KEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTD 357
             +R+V+Y C  HSF E C APPT S E  CP+SP+LLKTCPCG TPL+ L  PR  CTD
Sbjct: 277 AHLRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTD 336

Query: 358 PIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHC 417
           PIPTCE+ CNKPLKCGKH CPF CH G CMDPC+ ++   CSC  +SFLVPCQF    HC
Sbjct: 337 PIPTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHC 396

Query: 418 NIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLS 477
           N KCESLMSCRRHRC ERCCSGR  A KR+KT+F ++D +DE+LVEA+HICLK CNL LS
Sbjct: 397 NTKCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLS 456

Query: 478 CGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEY 537
           CGIH C+RKCHPGKC PCLESDSNDL CPCGKT+V APVRCGTKLPPC   CIK ++ + 
Sbjct: 457 CGIHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADT 516

Query: 538 PCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCP 597
            CGH PMPH CH L++PCP CTAP++K CKC KV++VRTLCFQNDVSCGKICGLPLK+C 
Sbjct: 517 VCGHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCS 576

Query: 598 HKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRR 657
           H C + CH PG CQT CKQICG  R  C+H C   CH   +CPD  C V  KVTC CGR+
Sbjct: 577 HTCKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRK 636

Query: 658 ETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDI 717
           E+ + C A ++  S+     L CD++CE  +RHR L EAFGIKE +++      E L+D+
Sbjct: 637 ESILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAPV----EELRDL 692

Query: 718 VPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHF 777
           V +A +F+EL LPFTE+TLS++S+Q  WC QIE  ++K M D +R SLHFKPM+ PQR F
Sbjct: 693 VESAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRF 752

Query: 778 IHELSKAYNLYCESQDPEPKRSVFIKK-NTTSSKPSFSLSKVLPLYQTFKELEKERKLQE 836
           IHEL+ AY LY ESQD EPKRSVF+KK    S  P   L + LPLY +FK+L+KERK++E
Sbjct: 753 IHELANAYALYSESQDREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERKVKE 812

Query: 837 FEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQ 896
            E  T++RL N  V +     + AE N FL+K ++PG T ++L     +YL+ TLI+NP 
Sbjct: 813 LEKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPS 872

Query: 897 YLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLST 955
           Y  L++G   +IYPED+ +I+ NVE D K L  +   + K+  ISEGV+L KID+ L T
Sbjct: 873 YQTLENG-DFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKT 930

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score = 1085 bits (2807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/908 (58%), Positives = 651/908 (71%), Gaps = 18/908 (1%)

Query: 60  YYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVDRI 119
           YYE+TI+EIAKGD Y CMICTVEMD+TC MYAC ECYRVFDY+CIREWAVKST+K+V + 
Sbjct: 63  YYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSVTKT 122

Query: 120 WKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHLGP 179
           WKCPNCY   K VP KNR TCWCGK ++PE NPLNPNSCGQTC+A ICVHGC++ CHLGP
Sbjct: 123 WKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCHLGP 182

Query: 180 HPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHSGL 239
           HP C RM+   CRCGK +KD+FC +++  K    F+C + CGL L CG+HKC+R+CH+G+
Sbjct: 183 HPTCMRMVQTKCRCGKKSKDVFCSEAR--KHQELFRCGNPCGLTLPCGVHKCQRECHNGV 240

Query: 240 CGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKE 299
           CG CPE +      A  + CYCG E+  S+KC+D+KI      S D  G KWIG FAC  
Sbjct: 241 CGECPETI------AKEINCYCGLESLPSIKCQDVKIQSK---SQDGSGKKWIGAFACSR 291

Query: 300 IRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPI 359
           IRTV+Y C +HSF E C APP+++   PCPYSPK LKTCPCG+TPL+ +  PRT CTDPI
Sbjct: 292 IRTVEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDPI 351

Query: 360 PTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNI 419
           PTC++ C K L CG+H+CPFKCHTG CM+ C   +  KCSC  + F+VPC+F G P CN 
Sbjct: 352 PTCDATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNT 411

Query: 420 KCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLSCG 479
           KCESLMSCRRHRC ERCC GR  A+ R+K +F ++D +DE+LVEA+HICLK+CNL LSCG
Sbjct: 412 KCESLMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSCG 471

Query: 480 IHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPC 539
            H CQRKCHPG CPPCLESDSNDLVCPCGKT+  APVRCGT LPPC   CIK ++    C
Sbjct: 472 RHFCQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDC 531

Query: 540 GHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHK 599
           GH PMPH CH LDEPCP CTAPVFK CKCGK K+VRTLCFQN+VSCG++CG  L  C H 
Sbjct: 532 GHPPMPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHHS 591

Query: 600 CMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRET 659
           C K CH  G+CQ+ CKQ+CG  R NC H C   CH  + CPDVPC V+ +V C CG R +
Sbjct: 592 CTKTCHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSS 651

Query: 660 YVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDIVP 719
           + TC A      A     LEC E+C    R  +L EAFG+       T+   + L  +  
Sbjct: 652 FATCAAHEGQDPA-DQRPLECTEDCAAARRRLELMEAFGMNTETVQPTEGIVD-LAALAE 709

Query: 720 TAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIH 779
               F+EL LPFTEA+LSIF++Q  WC QIEE +N+ M D S+PSLHFKPM+PPQRHFIH
Sbjct: 710 KVTTFQELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFIH 769

Query: 780 ELSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELEKERKLQEFEA 839
           EL++AY LYCESQD EPKRSV++KK   S KPS SL + LPLYQ+FK  +KERKL+E E 
Sbjct: 770 ELAQAYKLYCESQDKEPKRSVYVKKTVDSRKPSLSLKEALPLYQSFKNAQKERKLKELER 829

Query: 840 RTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLV 899
            T+ R++N     G +   +A+ NG LI+ +  GT  + +E  F  YLK TLIK+P YL 
Sbjct: 830 STTTRILNY-TSTGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNYLK 888

Query: 900 LQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLSTERLA 959
           L  G   +++ E+Y T + NVERD   +VGH D++AKD+F++EGV +C+++ V++ E   
Sbjct: 889 LDSGDV-MVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMAEE--- 944

Query: 960 TPAIDEST 967
           T   DES+
Sbjct: 945 TNRSDESS 952

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score = 1075 bits (2780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/905 (55%), Positives = 660/905 (72%), Gaps = 15/905 (1%)

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           + YYE+TI++I+KGD Y CMICT+EMDYTC+MYAC+ CYRVFDY+CI+EWA KS  KT+D
Sbjct: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
           ++WKCPNC H +K++P +NR TCWCGKV+NP+ N L+PNSCGQTCN K CVHGC N CHL
Sbjct: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237
           GPH EC+ + ++ C+CG++ KDIFC+Q K    N+ +QC + C LPL+CG+HKCKR CHS
Sbjct: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224

Query: 238 GLCGVCPERL--------EVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGN 289
           GLCG CPE L        E NE   +  KCYCG  ++  + CK + I  +  +S ++EG+
Sbjct: 225 GLCGACPEILSSEQIQSVESNENRKF--KCYCGENSKNEIMCKKLAI--TGTFSKNSEGD 280

Query: 290 KWIGVFACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLA 349
           KWIG FACK  R V Y C++HSFIE C A  ++S +K CPY+PKLL +CPCGKT L++LA
Sbjct: 281 KWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLA 340

Query: 350 KPRTLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPC 409
           + R  CTDPIPTCE+ C K LKCGKH CP+ CH G+CMDPC+Q+E   CSC Q+ FLVPC
Sbjct: 341 QKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPC 400

Query: 410 QFTGSPHCNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICL 469
            F  +P C  KCESLMSCRRHRC ++CC+G+P A+KRKK L   ++L DE+LVEA HICL
Sbjct: 401 NFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICL 460

Query: 470 KECNLLLSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQC 529
           KECNL LSCGIH C RKCHPG+CP CL SDSNDLVCPCGKT++EAPVRCG+KLPPCPF+C
Sbjct: 461 KECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFEC 520

Query: 530 IKVVRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKIC 589
           IKV+   YPCGH P PH CHP  EPCPPCTA V +PCKCGK   V+ +CFQ   SCG+IC
Sbjct: 521 IKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEIC 580

Query: 590 GLPLKDCPHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAK 649
              L++C HKC  +CH  G CQ  CKQ+C K R NC+H C   CHG++ CPDVPC    K
Sbjct: 581 NKELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTK 640

Query: 650 VTCECGRRETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDL 709
           V+C+CGR++ Y  C A  + +SA +  +L CDE+CE   RH QL++AFG    + +S + 
Sbjct: 641 VSCKCGRKQEYRKCYATLDNSSA-SIELLPCDEDCEAHARHLQLRDAFGYDSSLDTS-NK 698

Query: 710 EFERLKDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKP 769
             + ++ ++     +EEL+LP+ ++ +S +S+Q +WC QIE+I+ KF+ DK++ +LHFKP
Sbjct: 699 NIQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKP 758

Query: 770 MRPPQRHFIHELSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELE 829
           M+P QRHF+ ELS ++NLY ESQDPEPKRSVF+K+   +  P+ SL +VLPL+  FK+LE
Sbjct: 759 MKPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLE 818

Query: 830 KERKLQEFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKS 889
           KERK+Q FE+ + ++ +N E P+        + NGF IK +SPG T EDL  +FG+ LKS
Sbjct: 819 KERKIQHFESTSQRKYINYE-PKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKS 877

Query: 890 TLIKNPQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKI 949
           TLIKN  Y +L +    +IYPE Y +IT +V +D + LVGHFD + K+  I + + LC +
Sbjct: 878 TLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNV 937

Query: 950 DDVLS 954
           +  ++
Sbjct: 938 EGYIN 942

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score = 1042 bits (2694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/911 (56%), Positives = 649/911 (71%), Gaps = 18/911 (1%)

Query: 60  YYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVDRI 119
           YYE+T++EI KGD Y CMICTVEMD+TC MYAC +CYRVFD++CIREWA+KST+K+V + 
Sbjct: 45  YYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSKT 104

Query: 120 WKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHLGP 179
           WKCPNCY   K+VP KNR TCWCGK V PE NPLNPNSCGQTC+A+IC HGC++ICHLGP
Sbjct: 105 WKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGP 164

Query: 180 HPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHSGL 239
           HP C RM+ + C CGK  K +FC+++  F  +  F C   CGL L CGIHKC+RKCHSG+
Sbjct: 165 HPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDS--FICDSPCGLTLPCGIHKCQRKCHSGI 222

Query: 240 CGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFACKE 299
           CG CPE +         + CYC  E++ S+KC +++I      S D+ GNKW+G F+C+ 
Sbjct: 223 CGECPESI------YGTINCYCKLESKPSLKCTEVRI---EGRSRDSSGNKWVGAFSCEN 273

Query: 300 IRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTDPI 359
           IRTV++ C KHSF E C APP++S + PCP+SP+ LKTCPCG++PL+++   R+ CTDPI
Sbjct: 274 IRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPI 333

Query: 360 PTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHCNI 419
           PTC+S C K L+CGKHKCPFKCHTG+CM+ CL  +  KCSC  + F+VPC+F     CN 
Sbjct: 334 PTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNT 393

Query: 420 KCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLSCG 479
           KCE+LMSCRRHRC+ERCC GR  A+ R+K +F ++D +DE+LVEA+HICLK+CNL LSCG
Sbjct: 394 KCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCG 453

Query: 480 IHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEYPC 539
            H C+RKCHPG C PCLESDSNDLVCPCGKT+V APVRCGT LP C   CIK ++   PC
Sbjct: 454 KHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPC 513

Query: 540 GHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCPHK 599
           GH PMPH CHPL+EPCP CTAPVFK CKC K  +VRTLCFQNDVSCG++CG  L  C H 
Sbjct: 514 GHPPMPHPCHPLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHI 573

Query: 600 CMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRRET 659
           C K CH  G+CQT CKQ CGK R NC+H C   CH  T CPD PC     + C CG R T
Sbjct: 574 CQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRST 633

Query: 660 YVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDIVP 719
            VTCGA  N A A   T LEC+ +C++  RH +L EAFGIK   +  +    E L+ +  
Sbjct: 634 TVTCGANENRAPA-EETALECNNDCDVARRHHELMEAFGIKNDANQGSK-SLEDLEALAE 691

Query: 720 TAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHFIH 779
               F+EL LPF+EATLSIFS+Q  WC QIEE + + M+DK++PSLHFKPMRPPQRHFIH
Sbjct: 692 KVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIH 751

Query: 780 ELSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELEKERKLQEFEA 839
           EL +AY+LYCESQD EPKRSVF+KK   S +PS SL   LPLY +FK  ++E+KL+E E 
Sbjct: 752 ELGQAYHLYCESQDQEPKRSVFVKKTADSQRPSISLKVALPLYYSFKSAQREKKLKETER 811

Query: 840 RTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLV 899
            T+ R++N  V +       A  NG L++++  G   + ++  F +YLK TL+K+P YL+
Sbjct: 812 HTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLL 871

Query: 900 LQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKI----DDVLST 955
           L  G   ++Y +DY T + NVE D + +VGH D + K+  ++EGV   ++    DD+ S+
Sbjct: 872 LASGDV-LVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFLDDLESS 930

Query: 956 ERLATPAIDES 966
              A  +I  S
Sbjct: 931 TSDAATSISNS 941

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  980 bits (2534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/900 (52%), Positives = 611/900 (67%), Gaps = 18/900 (2%)

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           + YYE+T++EI  GD YVCMICTVE+D TC+MYAC  CYRVFDY+C+REWA+KST KT+D
Sbjct: 32  IPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLD 91

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
           + WKCPNCY +N K+P + RSTCWCGKVVNP+ N L+PNSCGQTCNA  CVHGC+ +CHL
Sbjct: 92  KSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHL 151

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237
           GPHPEC   + I C+CGKH K I C +SK   GNS + C D CGL L CG H C++ CH+
Sbjct: 152 GPHPECLIPVQIKCKCGKHCKQIPCSRSKVL-GNS-YNCGDVCGLLLPCGKHTCQKTCHT 209

Query: 238 GLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFAC 297
           G CG C   ++        L CYCGS+ +  ++C D+++ +   YS D  G KWIGV++C
Sbjct: 210 GFCGPCESIIKTE------LPCYCGSDVKSGIQCSDLRVLD---YSKDVSGKKWIGVYSC 260

Query: 298 KEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTD 357
            E+RT+ Y CD H+++E+C+AP  +   +PCP+SPK LKTCPCGKT L++L KPR  CTD
Sbjct: 261 GEVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTD 320

Query: 358 PIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHC 417
            IPTC + C K L CGKH CPF CHTG CMDPCL I    C+C  ++FL PCQ   +P C
Sbjct: 321 TIPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRC 380

Query: 418 NIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLS 477
           NIKCES MSCRRH+C+E CCSG+PAA+KR+KTLF  +DL +ETLVE EH+CLK+CNL LS
Sbjct: 381 NIKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLS 440

Query: 478 CGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEY 537
           CGIH C  KCHPGKCPPCLESD NDLVCPCGKT+V APVRCGTKLPPCP  CIK+     
Sbjct: 441 CGIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPA 500

Query: 538 PCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQND--VSCGKICGLPLKD 595
           PCGH   PH CHP    CPPCTA V K C+C K  ++RTLC   D  V+CG  CGLPL  
Sbjct: 501 PCGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLAT 560

Query: 596 CPHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECG 655
           C HKC K+CH+ G+C+ KC + CG +R  C H C   CHGN+ CP+  C     +TC+C 
Sbjct: 561 CHHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCN 620

Query: 656 RRETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLK 715
           RR   V CGA  +  S   T  L CDEEC  L+RH +L EAFG+ E   ++     E+L+
Sbjct: 621 RRTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTK----EQLE 676

Query: 716 DIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQR 775
            IV  A  F++L +P++E  L+++ +Q  WC QI  + +KF++D  + SLH KPMR PQR
Sbjct: 677 SIVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQR 736

Query: 776 HFIHELSKAYNLYCESQDPEPKRSVFIKK-NTTSSKPSFSLSKVLPLYQTFKELEKERKL 834
            FI EL+ AY LY ESQD EP RSV++KK  + S KP  +L     LYQ FK LEKER  
Sbjct: 737 QFIKELASAYALYSESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQ 796

Query: 835 QEFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKN 894
           + +  + +K L+N+   E P        N  +I  +   + ++++E +   +LK TL+K 
Sbjct: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856

Query: 895 PQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLS 954
           PQY  L+D  S +I+PE+Y  IT N   D + ++       +D  ++ GVE+C++D+ LS
Sbjct: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLS 916

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  939 bits (2426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/909 (51%), Positives = 590/909 (64%), Gaps = 22/909 (2%)

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           + YYE+T+ E+  G++Y C+ICTVEMD +C MYAC +CYRV+DY+CIR WA+K+T  TVD
Sbjct: 16  IPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTVD 75

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
           R WKCPNCYHVN+KVPPKNR TCWCGK VN + N +NPNSCGQTC A IC HGC+ +CHL
Sbjct: 76  RTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCHL 135

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237
           GPH EC   +   CRCGK T++I CY++K  K N  F C   CGLP+ CGIHKC+R CH+
Sbjct: 136 GPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRN--FSCDQPCGLPMPCGIHKCERVCHN 193

Query: 238 GLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFAC 297
           G CG C       EE A  +KCYCG  T+  M C ++ +   +K S   +   WIG FAC
Sbjct: 194 GPCGPC------KEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVS---KYKSWIGAFAC 244

Query: 298 KEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTD 357
             +R V Y C KHSF E+CIAPP+L    PCPYSP+   TCPCGKT L +L   RT CTD
Sbjct: 245 DRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTD 304

Query: 358 PIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHC 417
            I +C   C K L CG H CP  CH G CMDPCL I  +KC+CEQ+ FLVPCQF  SP C
Sbjct: 305 HISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSC 364

Query: 418 NIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLS 477
             KCESLMSCRRHRC ERCCSGRP + KR  +  R +   DE+ VEA+H+CLK+CN +L 
Sbjct: 365 TAKCESLMSCRRHRCAERCCSGRPHSVKR-NSRRRRESPDDESEVEAQHVCLKDCNRVLL 423

Query: 478 CGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEY 537
           CGIH C  KCH GKCPPCLESDSNDL+CPCGKTIV APVRCGTKLP C   C   + + +
Sbjct: 424 CGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTW 483

Query: 538 PCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCP 597
           PCGH+P  H CHPLDEPCPPCT  V K C+CGK  E+RT C+ +DVSC + C  PL  C 
Sbjct: 484 PCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGK-NEIRTFCYNDDVSCSRPCKKPLSYCN 542

Query: 598 HKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRR 657
           H C   CH  G CQ  CKQ CG  R  C+H C   CHG+T CP+ PCT    +TC CG +
Sbjct: 543 HFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHK 602

Query: 658 ETYVTCGAMSNIASAVTTTI-LECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKD 716
            +   C   +     +  +  L CDE+C   +RH+QL  AFG+ E  +S  D        
Sbjct: 603 SSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALL---- 658

Query: 717 IVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRH 776
           +   + +F++L LPFTE  LS+F++Q +WC QIE+ + K MDD S  +LHFKPMR  QR 
Sbjct: 659 LAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRR 718

Query: 777 FIHELSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELEKERKLQE 836
           F+HELS ++ LY ESQDPEPKRSV++KK   S  P+  LSK  PLY +FK+LE+E K   
Sbjct: 719 FVHELSSSFGLYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREFKANS 778

Query: 837 FEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQ 896
            E+  +K+LV+V + + P   + A  N  L+  L+   +   L   F  Y   TL+  PQ
Sbjct: 779 -ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQ 837

Query: 897 YLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLS-T 955
           Y+V   G  G I+P DY +++AN E+D   L G+F +L ++  +   +  CK+D  L+  
Sbjct: 838 YVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRI 895

Query: 956 ERLATPAID 964
               +PA D
Sbjct: 896 GSCESPAAD 904

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/893 (50%), Positives = 583/893 (65%), Gaps = 18/893 (2%)

Query: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117
           + YYE+ I++I  G  Y C+ICTVE+D TC+MYAC  CYRV+DY+CI EWA KS++++ D
Sbjct: 28  LPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSAD 87

Query: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177
             WKCPNCYH   KV PK RSTCWCGK +NPE N   PNSCGQTC A IC HGC + CHL
Sbjct: 88  STWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCHL 147

Query: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237
           GPHP+C   + + C+CGK T+ I CYQ+K  K   K  CK  CGLPL CG+H C++ CHS
Sbjct: 148 GPHPKCMVPVGLKCKCGKITEQISCYQTKAVK--PKLSCKLPCGLPLPCGVHTCQKICHS 205

Query: 238 GLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFAC 297
           G CG C      N   +   KCYCGS    S+ CKD+ +    K S   +  KWIGVF+C
Sbjct: 206 GPCGRC------NTVMSGKFKCYCGSNHLDSIICKDVAV---TKMSRSGKHKKWIGVFSC 256

Query: 298 KEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTD 357
           K IR V+Y C +HSF E C   P+      CPYSP + KTC CG T L  + + R  CTD
Sbjct: 257 KNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTD 316

Query: 358 PIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHC 417
           PIPTC+  C KPL CGKH CP  CH G CMDPCLQIE RKCSC++++FL PCQF G P C
Sbjct: 317 PIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSC 376

Query: 418 NIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLS 477
           NIKCE+LMSCRRHRC++RCCSG+P A  R  T+    D  DE+L+EAEHIC K CN  LS
Sbjct: 377 NIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLS 436

Query: 478 CGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEY 537
           CG+H C  KCHPGKCPPCLESDSNDLVCPCGK+++ APVRCGT  P C + CI  +R   
Sbjct: 437 CGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSM 496

Query: 538 PCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCP 597
           PCGH    H CHP  E CPPCTA V+KPCKCGK+   RT+CFQND+SCG+ C   L +C 
Sbjct: 497 PCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCH 556

Query: 598 HKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRR 657
           H C K+CH PG+C   C ++CG +R  C+H C+  CHG+  CPDVPC     V+C CGRR
Sbjct: 557 HLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRR 616

Query: 658 ETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDI 717
              V CGA  +  SA  T  L CD++C  +++H+ L +     E    ST+        +
Sbjct: 617 SLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSE----STNKAEHGSSSV 672

Query: 718 VPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHF 777
           +    ++E+L LP++E  + +FS+Q  WC+ I++ + + ++DKSR SLHFKPM+ PQR F
Sbjct: 673 INKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQF 732

Query: 778 IHELSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELEKERKLQEF 837
           +HELSKA+ LY ESQD EPKRSVF+K   TS  P+  LS+ L LYQ  K  +KER+  E 
Sbjct: 733 VHELSKAFGLYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRMKTFQKERRDLEL 792

Query: 838 EARTSKRLVNVEVPEGPTDNYI-AEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQ 896
           +  T+K L+++ + +G     + A  N  LI  +    TVE+++  F + LK TL+K+PQ
Sbjct: 793 QHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQ 852

Query: 897 YLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKI 949
           + ++    +  IYP ++  I+ANVE D + LV +F  + +   I   V   K+
Sbjct: 853 FRLINS--NAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKL 903

>YDR121W Chr4 (693585..694175) [591 bp, 196 aa] {ON}  DPB4Shared
           subunit of DNA polymerase (II) epsilon and of
           ISW2/yCHRAC chromatin accessibility complex; involved in
           both chromosomal DNA replication and in inheritance of
           telomeric silencing
          Length = 196

 Score = 33.9 bits (76), Expect = 1.3,   Method: Composition-based stats.
 Identities = 30/103 (29%), Positives = 43/103 (41%), Gaps = 22/103 (21%)

Query: 854 PTDNYIAEANGFLIKDL-SPGTTVEDLER-IFGQYLKSTLIKNPQYLVLQDGKSGVIYPE 911
           PT +YI E     I+DL  P +T+ +L R +  Q  K  LI     L LQ G +      
Sbjct: 15  PTTSYIKEQENITIQDLLFPKSTIVNLAREVPQQSGKKLLINKDASLALQRGAT------ 68

Query: 912 DYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLS 954
                           V H  + A++   S+  + C +DDVLS
Sbjct: 69  --------------VFVNHLLLFAREIAKSQDKKSCSVDDVLS 97

>KLLA0E00551g Chr5 complement(45755..46483) [729 bp, 242 aa] {ON}
           similar to uniprot|P10080 Saccharomyces cerevisiae
           YHL034C SBP1 Single-strand nucleic acid binding protein
          Length = 242

 Score = 33.1 bits (74), Expect = 2.3,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 9/84 (10%)

Query: 849 EVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNPQYLVLQDGKSGVI 908
           E+ E  T   +       + +LSP T+ EDL+++FG+ +K   ++ P    LQ  ++   
Sbjct: 3   EIIETSTKIVVDPETSIFVGNLSPETSPEDLQKVFGESVK---VEIP---TLQSDRT--- 53

Query: 909 YPEDYPTITANVERDFKSLVGHFD 932
           YP  +  +T + + D + L   FD
Sbjct: 54  YPRIFAFVTFDDKVDVEDLRSKFD 77

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score = 30.8 bits (68), Expect = 9.8,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 728 QLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLH-FKPMRPPQRHFIHELSKAYN 786
           +L + +  +S+  R++R  + +   +N+  D++ +      + ++  +R FI+E +KA+N
Sbjct: 86  RLTYNKEVMSLGKREKRDVESLVSEMNRISDERYKKGAQKRRRLKDTERGFINEQNKAFN 145

Query: 787 LYCESQDPEPKR 798
           L  E +    K+
Sbjct: 146 LRLEKEKENGKK 157

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.449 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 104,431,222
Number of extensions: 4585649
Number of successful extensions: 11956
Number of sequences better than 10.0: 62
Number of HSP's gapped: 11207
Number of HSP's successfully gapped: 69
Length of query: 968
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 849
Effective length of database: 39,836,145
Effective search space: 33820887105
Effective search space used: 33820887105
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)