Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G006602.286ON49649624170.0
NCAS0G037902.286ON49249819180.0
KAFR0H033102.286ON48849718300.0
TDEL0G021702.286ON48449617670.0
TPHA0C034002.286ON49449617670.0
Kpol_1003.382.286ON49649617510.0
Suva_14.3252.286ON49049717270.0
Skud_14.3072.286ON49049717170.0
YNL022C2.286ON49050017030.0
KNAG0H020002.286ON49849916990.0
Smik_14.3092.286ON49049716790.0
ZYRO0A01892g2.286ON46549716710.0
KLLA0E08361g2.286ON49149716650.0
SAKL0E07678g2.286ON47749616590.0
TBLA0B069602.286ON50850816530.0
CAGL0M06941g2.286ON49249916400.0
Ecym_33252.286ON49649716380.0
Kwal_27.115322.286ON47949716120.0
KLTH0G10362g2.286ON52949616100.0
ADL215W2.286ON48449715380.0
KAFR0J009702.247ON6102881536e-10
ADL254W2.247ON6032881511e-09
SAKL0E08624g2.247ON6112881501e-09
KLLA0F03399g2.247ON6192881492e-09
KNAG0I018702.247ON6292881483e-09
Ecym_32842.247ON6062871455e-09
KLTH0G09460g2.247ON6372871421e-08
Kwal_23.48412.247ON6272701421e-08
CAGL0J10032g2.247ON6192881421e-08
NDAI0D010502.247ON6251841411e-08
TBLA0E038502.247ON6322881412e-08
TDEL0C041502.247ON6142881412e-08
YNL061W (NOP2)2.247ON6182021402e-08
Smik_14.2662.247ON6182021402e-08
NCAS0G030302.247ON4902021392e-08
Suva_14.2802.247ON6202021393e-08
ZYRO0G08998g8.171ON6833071393e-08
ZYRO0A01562g2.247ON6172031393e-08
TPHA0H001508.171ON6493101393e-08
Kpol_1002.1098.171ON6703081375e-08
Kpol_1003.152.247ON6332701366e-08
AFR179C8.171ON7003061359e-08
Skud_14.2712.247ON6191841359e-08
TPHA0C031502.247ON6082071322e-07
KAFR0B022208.171ON6863071278e-07
NDAI0B018308.171ON6863061261e-06
NCAS0B043908.171ON6713091261e-06
KNAG0G015108.171ON6663091242e-06
KLTH0H08096g8.171ON6883061232e-06
KNAG0D020508.171ON6823071224e-06
SAKL0H19448g8.171ON6913061214e-06
Suva_2.978.171ON6703091214e-06
TDEL0B043908.171ON6733071198e-06
Ecym_23538.171ON6903061181e-05
TBLA0A087408.171ON6863101171e-05
Skud_2.818.171ON6813091162e-05
TPHA0C028708.171ON6743061162e-05
Smik_2.928.171ON6743091134e-05
YBL024W (NCL1)8.171ON6843091125e-05
NCAS0B056408.171ON6593091109e-05
CAGL0K01991g8.171ON6722291082e-04
KLLA0F12562g8.171ON7042291028e-04
NDAI0B029808.171ON6793071000.001
Kwal_14.20818.171ON272128940.004
Ecym_30036.1ON319104820.16
Suva_16.396.1ON318104760.81
Skud_16.116.1ON318104760.82
Smik_6.4746.1ON318104760.86
YPL266W (DIM1)6.1ON318104760.89
Kpol_449.126.1ON319104731.9
SAKL0E00660g6.1ON322104732.2
CAGL0L07678g6.1ON317104722.8
KNAG0L024406.1ON317104713.5
ZYRO0F00308g6.1ON319104704.4
NCAS0D022506.1ON319104704.8
ACR026W6.1ON319104695.3
TBLA0H018805.370ON170849706.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00660
         (496 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   935   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   743   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   709   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   685   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   685   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   679   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   669   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   665   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   660   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   659   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   651   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   648   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   645   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   643   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   641   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   636   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   635   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   625   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   624   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   597   0.0  
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    64   6e-10
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    63   1e-09
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    62   1e-09
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    62   2e-09
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    62   3e-09
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    60   5e-09
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    59   1e-08
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    59   1e-08
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    59   1e-08
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    59   1e-08
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    59   2e-08
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    59   2e-08
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    59   2e-08
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    59   2e-08
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    58   2e-08
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    58   3e-08
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    58   3e-08
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    58   3e-08
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    58   3e-08
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    57   5e-08
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    57   6e-08
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    57   9e-08
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    57   9e-08
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    55   2e-07
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    54   8e-07
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    53   1e-06
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    53   1e-06
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    52   2e-06
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    52   2e-06
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    52   4e-06
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    51   4e-06
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    51   4e-06
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    50   8e-06
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    50   1e-05
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    50   1e-05
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    49   2e-05
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    49   2e-05
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    48   4e-05
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    48   5e-05
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    47   9e-05
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    46   2e-04
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    44   8e-04
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    43   0.001
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    41   0.004
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    36   0.16 
Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W (R...    34   0.81 
Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W (R...    34   0.82 
Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}...    34   0.86 
YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essentia...    34   0.89 
Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON} ...    33   1.9  
SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}...    33   2.2  
CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {...    32   2.8  
KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1...    32   3.5  
ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}...    32   4.4  
NCAS0D02250 Chr4 (419581..420540) [960 bp, 319 aa] {ON} Anc_6.1 ...    32   4.8  
ACR026W Chr3 (404011..404970) [960 bp, 319 aa] {ON} Syntenic hom...    31   5.3  
TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5....    32   6.5  

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/496 (91%), Positives = 455/496 (91%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           LHSE           NLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
           SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
           KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNN         
Sbjct: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKS 360

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                        YNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE
Sbjct: 361 TEEDDEVPDEQEDYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRAL 480
           R        SKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRAL
Sbjct: 421 RVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRAL 480

Query: 481 PRDDGGIGFFAVCFER 496
           PRDDGGIGFFAVCFER
Sbjct: 481 PRDDGGIGFFAVCFER 496

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/498 (74%), Positives = 414/498 (83%), Gaps = 8/498 (1%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           M FYRDATWVLE+VEQ++AKGRISGSLQTLV QSC +YKLKCNPKHVYAV+DSCWKYKPY
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LEKVMKKSGILD+IPK+KGKPMYSRLTLML+CHDLLFSK+KRIQMGK PIK YVLKHKSR
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           LHSE           NLSE+V N DS  D+TPVRWIRINPLRC    DV A   E+ KKF
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKF 176

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P RVENW+DIVPGSIYYDEYIP+L+GIHPQDKITSH LYKQGKIIIQDRASCFPAHIL+P
Sbjct: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
            ++D++ID CAAPGNKTTH ASYM  +   +DP +QIYAFEK+PERAKIL+KMIKVAGCS
Sbjct: 237 DENDVVIDGCAAPGNKTTHTASYMIKEP-SKDPKIQIYAFEKNPERAKILDKMIKVAGCS 295

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
           KNI++ VGDFTK A P+K+KDVTGFIVDPSCSGSGIFGRK++DSLNR++ N         
Sbjct: 296 KNIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMN-KDEADKKE 354

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                        YNK+EDLKTRL+KLSSFQFQV+KHAMSFP AKKIVYSTCSIHAEENE
Sbjct: 355 GDEEEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENE 414

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDD--PAKCQALADGCIR 478
           R        SKVKQWGWKVA +  VIPTWPRRGK+EEFEEVFR+D   +KC+ LA GCIR
Sbjct: 415 RVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIR 474

Query: 479 ALPRDDGGIGFFAVCFER 496
           ALPR DGGIGFFAVCFER
Sbjct: 475 ALPRSDGGIGFFAVCFER 492

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/497 (70%), Positives = 405/497 (81%), Gaps = 12/497 (2%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           M FYRDATWVLEY+EQQ++KGRISGSLQ+LVL+SC KYKLK NPKH+YAV+DSCWKYKP+
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LEKVM KSGIL DIPKKKGKP+Y+RLTL+LL HDLL SK KRIQMGKHPIK +VL++KSR
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           LHSE           +LSE+VD  DS+ D+TPVRW RINPLRC    D +AV++EL KKF
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRC---PDASAVMKELEKKF 177

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P+RVE+W  IVPGSIY+DE+IP+L+GIHPQDKITSHELYKQG+IIIQDRASCFPAHILNP
Sbjct: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
           + +D IIDAC+APGNKTTHVASYMFG+   +D  V+I+AFEKDPERAK+L+KMIKVAGCS
Sbjct: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD--VRIFAFEKDPERAKVLQKMIKVAGCS 295

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
           K I V VGDFTK ATP KF DVTGFIVDPSCSGSGIFGRKY+DSLNRQ+           
Sbjct: 296 KQISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVP 355

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                          +  +L+ RL+KLSSFQFQV+KHAMSFP AK+IVYSTCSIHAEENE
Sbjct: 356 DEQEEMAE------KENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENE 409

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPA-KCQALADGCIRA 479
           R         KVKQWGWK+A +ESVIP WPRRG + EF+E+FRD  A +CQ +ADGCIRA
Sbjct: 410 RVALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRA 469

Query: 480 LPRDDGGIGFFAVCFER 496
           LPR+DGGIGFFA+CFER
Sbjct: 470 LPREDGGIGFFAICFER 486

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/496 (65%), Positives = 391/496 (78%), Gaps = 12/496 (2%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           MNFYRDATWVLEYVEQ++ KGR+SGS+QTLVL+SC +YKLK +PKH+YAV+DSCW+YK  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LEK+MK+S I DDIPKKKGKP+YSRLTL+L+CHDLL SK KRIQMGK PIKEYVLKHK+R
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           L+SE           +LSEIVD  DS+ DVTPVRWIRINPLRC +  DV  VL+EL KKF
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRCPKN-DVEPVLKELIKKF 179

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P+RV +W+DI  G++YYDE++P+L+G+HP+DKITSHELY+QGKIIIQDR+SCFPAHILNP
Sbjct: 180 PQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNP 239

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
            K+D++IDACAAPGNKTTHVA+++  +  +E    +IYAFEKDP RA IL+KM  VAGC 
Sbjct: 240 GKNDVVIDACAAPGNKTTHVAAHILPEYTREQTP-KIYAFEKDPARANILKKMTSVAGCG 298

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
           + +++ VGDFTK A P  FKDVTG IVDPSCSGSGIFGRK VDS N  +           
Sbjct: 299 QTVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTETDSEIPD 358

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                            +D+  RL+KL+SFQFQV+KHAMS P AKKIVYSTCSIHAEENE
Sbjct: 359 EEEKMVG----------DDVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENE 408

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRAL 480
           R          +K+WGWKVA++E VIP WPRRGK++EFE+VFRDDP KC  LADGCIRAL
Sbjct: 409 RVVIDLLLDRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDPVKCNELADGCIRAL 468

Query: 481 PRDDGGIGFFAVCFER 496
           P++DGGIGFFAVCF+R
Sbjct: 469 PQEDGGIGFFAVCFKR 484

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/496 (63%), Positives = 398/496 (80%), Gaps = 4/496 (0%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           MNFYRDATWVLE++E+++AKG+ISGS+Q++VL+SC  YK++ NPKH+YAV+ SCWKYKPY
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LE +MKKSGIL++IPKK GKP + RLT++LLCHDLLFSKSKRIQMGKHP+KEYVLK+K+ 
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           L SE           +  +++ + D   D+TPVRW RINP+R    + V  +LEEL KKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P RV++W+ I  G+IY+DE+IP+L+G+H +DKITSHELYKQGKIIIQDRASCFPAH+LNP
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
            KDDI+ID+CAAPGNKTTH A+Y+ G    +D  +QI+AFEKDPERAK+L+KM++ AGC+
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILG-GPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCA 299

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
           + I+V VGDFTK ATP+KFK+VTGFIVDPSCSGSGIFGRK++D+LN+++           
Sbjct: 300 RTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEG---EDVDED 356

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                        ++KK+DLKTRL+KL+SFQFQV+KHAM+FP A+K+VYSTCSIHAEENE
Sbjct: 357 DESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENE 416

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRAL 480
           R          +K+ GW+VA +E VIPTWPRRG ++EF+EVFRDD  KC+ +A GCIRAL
Sbjct: 417 RVVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRAL 476

Query: 481 PRDDGGIGFFAVCFER 496
           P++DGGIGFFAVCFER
Sbjct: 477 PKEDGGIGFFAVCFER 492

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/496 (66%), Positives = 395/496 (79%), Gaps = 1/496 (0%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           M+FYRD+TWVLEY+E++ AK +ISGSLQ LVL+SC KYK+K NP+HVYA + SCWK KPY
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LEKVMK+SGILDDIP KKGKP + RLTL+LLCHDLL SKSKRIQMGKHPIK Y+LK+K+R
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           LHSE           +LSE++++ +S +D+TPVRWIRINP+R    + +  ++ EL KKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P RV +W+DIVPG+IY+D+YIP+L+G+H +DKITSHELYK GK+IIQDRASCFPAHILNP
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
            K+DI+IDACAAPGNKTTH ASY+ G  K+ D   QIYAFEKDPERAKIL+ MIKVAGCS
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKK-DQTTQIYAFEKDPERAKILQHMIKVAGCS 299

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
             IQV VGDFTK ATP+KF++VTGFIVDPSCSGSGIFGRKYVDS+N+++           
Sbjct: 300 NTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQD 359

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                          K++DLKTRL+KL+SFQFQV+KHAMSFP AKKIVYSTCSIHAEENE
Sbjct: 360 DEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENE 419

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRAL 480
                     KV++WGWKVA +  VIPTWPRRG   EF +VFRD+  KCQ LADGCIR L
Sbjct: 420 GVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVL 479

Query: 481 PRDDGGIGFFAVCFER 496
           P++DGGIGFFAVCFER
Sbjct: 480 PKEDGGIGFFAVCFER 495

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/497 (67%), Positives = 398/497 (80%), Gaps = 9/497 (1%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           MNFYRDATWVLE +E++ AK RISGS+QTLVL+SC +YKLK NPKH+YAV+DSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LEKVMKK+ IL++IPKKKGKP+++RLTL+LLCHDLL SK KRIQMGKHPIKEYVLK KS 
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           LHSE           +LSE+V + D   D+ PVRWIRINPL+C+   +   VL EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
            ++V+NW+++VPGSIY+DEYIP+L+GIHP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
             +DI+IDAC+APGNKTTH ASY+F +  + D  +QIYAFEKDPERAKIL+KMIKVAGCS
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPK-DKKIQIYAFEKDPERAKILQKMIKVAGCS 299

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
            NI V VGDFTK ATP+K K VTGFIVDPSCSGSGIFGRK+ DSLNR++ +         
Sbjct: 300 ANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKID-------EK 352

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                        +  KE+L+TRLAKLSSFQFQ++KHAMSFP AKKIVYSTCSIHAEENE
Sbjct: 353 DDEDDAVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENE 412

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAK-CQALADGCIRA 479
           R          V++WGWKVA++  V+P+WPRRGK+EEFEEVFRD  A   Q LA+GCIRA
Sbjct: 413 RVVIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRA 472

Query: 480 LPRDDGGIGFFAVCFER 496
           LP++DGGIGFFAVCF R
Sbjct: 473 LPKEDGGIGFFAVCFVR 489

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/497 (68%), Positives = 392/497 (78%), Gaps = 9/497 (1%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           MNFYRDATWVLE +E++ AK RISGS+QTLVL+SC KYKLK NPKH+YAV+DSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LEKVMKK+ IL+DIPKKKGKP++SRLTL+LLCHDLL SK KRIQMGKHPIK+YVLK KS 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           LHSE           +LSE+V + D T D+ PVRWIRINPL+C+   D   VL EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
             +V  W+D+VPGSIYYDEYIP+L+GIHP DKIT+HELYK GKIIIQDRASCFPAHIL+P
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
             DDI+IDAC+APGNKTTH ASY+      +D  ++IYAFEKDPERAKIL+KM+KVAGCS
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICS-GPPKDNIIRIYAFEKDPERAKILQKMVKVAGCS 299

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
            NI V VGDFTK ATPDK K  TGFIVDPSCSGSGIFGRK+ DSLN+++ +         
Sbjct: 300 SNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMD-------EK 352

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                        +  KE+L+TRLAKLSSFQFQ++KHAMSFP AKKIVYSTCSIHAEENE
Sbjct: 353 DDDNDVIPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENE 412

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPA-KCQALADGCIRA 479
           R          V++WGWKVA +  VIP+WPRRGK+EEF EVFRD  A   + LA+GCIRA
Sbjct: 413 RVVIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRA 472

Query: 480 LPRDDGGIGFFAVCFER 496
           LP++DGGIGFFAVCFER
Sbjct: 473 LPKEDGGIGFFAVCFER 489

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/500 (67%), Positives = 395/500 (79%), Gaps = 15/500 (3%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           MNFYRDATWVLE +E++ AK RISGS+QTLVL+SC +YKLK NPKH+YAV+DSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LEKVMKK+ IL+DIPKKKGKP++SRLTL+LLCHDLL SK KRIQMGKHPIK+YVLK KS 
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           LHSE            LSE+V + D + D+ PVRWIRINPL+C+   +   VL EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
             +V+ W+++VPGSIYYDE+IP+L+GIHP DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
              DI+ID+C+APGNKTTH ASY++ +  + D + +IYAFEKDPERAK+L+KMIK+AGCS
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPK-DNNTRIYAFEKDPERAKVLQKMIKIAGCS 299

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
            NI V VGDFTK ATP+K+KDVT FIVDPSCSGSGIFGRK+ DS NR++ +         
Sbjct: 300 PNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKID-------DK 352

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                        +  KE+L+TRLAKLSSFQFQ++KHAMSFP AKKIVYSTCSIHAEENE
Sbjct: 353 DDDGGIVPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENE 412

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRD----DPAKCQALADGC 476
           R          V++WGWKVA K  VIP+WPRRGK+EEFEEVFRD    DP   Q LA+GC
Sbjct: 413 RVVIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDP---QQLAEGC 469

Query: 477 IRALPRDDGGIGFFAVCFER 496
           IRALP+ DGGIGFFAVCFER
Sbjct: 470 IRALPKSDGGIGFFAVCFER 489

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/499 (64%), Positives = 394/499 (78%), Gaps = 6/499 (1%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           M+FYRDATWVLE +E Q+AKG++SGSLQTLVL SC ++K+K NPKH+YAV+ SCW+YKP+
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LEKVMKKS ILD++P+KKG P++ RLTL+LLCHDLL SKSKRIQMGKHPIK +VLK+K+R
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           L++E           +LS++ D++D T D+TPVRW R+NPLRC   + V +V+ EL KKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
            ++V++W D+VPGSIYYDEYIP+L+ +HPQDKITSHELYKQGKIIIQDRASCFPAHILNP
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGD-AKQEDPHVQIYAFEKDPERAKILEKMIKVAGC 299
             DDI+IDACAAPGNKTTH+A++MF D    E P VQIYAFEKDPERA++L KMIK+AGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 300 SKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXX 359
           SK I+V VGDFTK ATP    +V G IVDPSCSGSGIFGRKY+DS+N ++ +        
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 360 XXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEEN 419
                             ++LKTRL+KLSSFQFQ++K+A+SFP A K+VYSTCSIHAEEN
Sbjct: 361 ELDAVPEEQEEQEL---DDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEEN 417

Query: 420 ERXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDD--PAKCQALADGCI 477
           ER         KVK+ GW+VA +  VIPTW RRG ++EF++VFR+D   + CQ +ADGCI
Sbjct: 418 ERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCI 477

Query: 478 RALPRDDGGIGFFAVCFER 496
           RALPR+DGGIGFFAVCFER
Sbjct: 478 RALPREDGGIGFFAVCFER 496

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/497 (68%), Positives = 393/497 (79%), Gaps = 9/497 (1%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           MNFYRDATWVLE +E++ AK RISGS+QTLVL+SC +YKLK NPKHVYAV+DSCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LEKVMKK+ IL+DIPKKKGKP++SRLTL+LLCHDLL SK KRIQMGKHPIK+YVLK KS 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           LHSE           NLSE+V + D   D+ PVRWIRINPL+CY       VL EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
             +VE W+++VP SIYYDEYIP+L+GIHP DKIT+HELYK GKIIIQDRASCFPAHILNP
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
             +DI+IDAC+APGNKTTH ASY+  +  + D   +IYAFEKDPERAKIL+KMIK+AGCS
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPK-DSRTRIYAFEKDPERAKILQKMIKIAGCS 299

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
            NI V+VGDFTK ATP+KFKD TGFIVDPSCSGSGIFGRK+ DSLNR++ +         
Sbjct: 300 SNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMD-------DK 352

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                        +  KE+L+TRLAKLSSFQFQ++KHAMSFP AKKIVYSTCSIHAEENE
Sbjct: 353 DDDNDIVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENE 412

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAK-CQALADGCIRA 479
           R          V++WGW+VA +  VIP WPRRGK+EEFEEVFR+  A   Q LA+GCIRA
Sbjct: 413 RVVIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRA 472

Query: 480 LPRDDGGIGFFAVCFER 496
           LP+DDGGIGFFAVCFER
Sbjct: 473 LPKDDGGIGFFAVCFER 489

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/497 (60%), Positives = 382/497 (76%), Gaps = 33/497 (6%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           M+FYRD+TW+LEY+E +E KG++SGSLQ+ VL++CTKYK+K NPKH+YAV+ SCWKY+ Y
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LE++M KSGIL  IP+KKGKP +SRLT+MLLCHDLL SK KRIQMGKHPIK+YVLK+K+R
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           LH+E            LSE+VD +D  +D TPVRWIRINPL+C    D+  V+E+L KKF
Sbjct: 121 LHAELVKLKVKLKVKELSELVDQDDG-DDATPVRWIRINPLKC----DIPVVVEQLNKKF 175

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P RV++W+ + PGSIYYDEY+P+L+GIHP +KITSH+LYKQGK+IIQDRASC PAHILNP
Sbjct: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQED-PHVQIYAFEKDPERAKILEKMIKVAGC 299
            K+D+++DACAAPGNKTTH+A+++   A   +    QI+AFEK+P RAK+L+KM   AGC
Sbjct: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295

Query: 300 SKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXX 359
              +++ VGDFT+ A PD+F+DVT  +VDPSCSGSGIFGRK ++S N  ++         
Sbjct: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQD--------- 346

Query: 360 XXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEEN 419
                             + L+ RL+KLSSFQFQV+KHAMS P A+KIVYSTCS+HAEEN
Sbjct: 347 ------------------QKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEEN 388

Query: 420 ERXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRA 479
           ER        SKVK+WGW+++ +  V+PTWPRRG  EEFEEVFRDD  KCQ LA+ CIRA
Sbjct: 389 ERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRA 448

Query: 480 LPRDDGGIGFFAVCFER 496
           LPR+DGGIGFFAVCF+R
Sbjct: 449 LPREDGGIGFFAVCFQR 465

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/497 (61%), Positives = 381/497 (76%), Gaps = 8/497 (1%)

Query: 1   MNFYRDATWVLEYVEQQEAKG-RISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKP 59
           M FYRDATWVLE+VEQ+ +K  R++GSLQTLVL SC +YKLK NP+H+YA++ S W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  YLEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKS 119
           YL+K++KKSGIL+D+PKKKGKP++++ T+ LL HDLL SKSKRIQMGKHPIK ++LKH++
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 RLHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKK 179
           RL +E           +LS+++  +D  EDVTPVRWIRINP+   +  D   VL EL KK
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDDG-EDVTPVRWIRINPILVKERYD--DVLAELNKK 177

Query: 180 FPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239
           FP+RV +W  IVPGSIYYDEYIP+L+GIHP DKITSHE YK+GKIIIQDRASCFPAHILN
Sbjct: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237

Query: 240 PSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGC 299
           P+  D++IDACAAPGNKTTHVA+++FGD   +   V+I+AFEKDPERAK L+ M+  AGC
Sbjct: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGC 297

Query: 300 SKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXX 359
           +K +++ VGDFTK   P+ F++VTGFIVDPSCSGSGIFGRK +D +N  +          
Sbjct: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTG--SSNTDE 355

Query: 360 XXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEEN 419
                         + K++DLK RLAKLSSFQ+Q++KHAMSFP+AKKI YSTCSIHAEEN
Sbjct: 356 DQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEEN 415

Query: 420 ERXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRA 479
           ER        SKVK+WGWKV  +  VIPTWPRRG   EFEEVF  + AK   LA+GCIRA
Sbjct: 416 ERVVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEAK--ELAEGCIRA 473

Query: 480 LPRDDGGIGFFAVCFER 496
           LP++DGGIGFFAVCFER
Sbjct: 474 LPKEDGGIGFFAVCFER 490

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/496 (64%), Positives = 385/496 (77%), Gaps = 20/496 (4%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           MN YRDATWV EYVEQ+E+KG+I+GSLQTLVL SC +YKLK NPKH+YA++ SCWKYKP+
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LEK++KKSGIL DIPKKKG+P +S  T++LL HDLL SK+KRIQMGKHPIKE+VLKHK R
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           L +E           NLS++V   D + D+TPVRWIRINP+RC  G+ V+ V  EL KKF
Sbjct: 121 LQAELAKLKVKLRVTNLSQLV--KDDSNDMTPVRWIRINPVRC-NGK-VDDVKGELQKKF 176

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P +V NW++IVPG+IY+DE+IP+L+G+HP DKITSHELYK+GKIIIQDRASCFPAHILNP
Sbjct: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
           + +D+IID+C+APGNKTTHVA++MF D +      QI+AFEKDPERAK L+KMI+VAGC 
Sbjct: 237 TPEDVIIDSCSAPGNKTTHVAAHMF-DPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCD 295

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
           K+I+V VGDFTK A PDKF  VTGFIVDPSCSGSGIFGRK +D  N +            
Sbjct: 296 KSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNE---------- 345

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                            +DLKTRL KLSSFQFQ++KHAMSFP AKK+VYSTCSIHAEENE
Sbjct: 346 ----VLPEEEQEKEEMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENE 401

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRAL 480
           R         KV+QWGW+V  +  VIPTW RRG +EEF++V++D   + Q LADGCIRAL
Sbjct: 402 RVVIDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDK-QQAQELADGCIRAL 460

Query: 481 PRDDGGIGFFAVCFER 496
           P++DGGIGFFAVCFER
Sbjct: 461 PKEDGGIGFFAVCFER 476

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/508 (61%), Positives = 392/508 (77%), Gaps = 14/508 (2%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           MNFYRDATWVLE++E Q+ KGR+SGSL +LV++SC ++K++ NPKHVYAV++S WK+KP+
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           +E++M KSGILDDIPKKKGKP+Y RLTL+LL HDL+FSKS+RIQMGKHPIK +VL +K+R
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LHSEXXXXXXXXXXXNLSEIV----DNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEEL 176
           LHSE           NL++++    ++NDST+D+TPVRWIRINP+R  + +  + ++ EL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 177 GKKFPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAH 236
            KKF  +V++W+ I PG IYYDEYIP+L+GI P DKITSHELYK GKIIIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 237 ILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHV-----QIYAFEKDPERAKILE 291
           ILN + DD IIDACAAPGNKTTHVASY+   +   D H+     +++AFEKDPER+KIL+
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIM--SLNNDTHINFDKKRVFAFEKDPERSKILD 298

Query: 292 KMIKVAGCSKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQR-- 349
           KM+K+AGC K +++  GDFTK ATP+K+ +VTGFIVDPSCSGSGIFGRK++D++N  +  
Sbjct: 299 KMVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKL 358

Query: 350 NNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVY 409
                                      K+DL+TRL+KLSSFQFQV+KHAMSFP+AKKIVY
Sbjct: 359 TEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVY 418

Query: 410 STCSIHAEENERXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPA-K 468
           STCSIHAEENER         KVK+WGWKV  +   IPTW RRG + EFE+VF++DPA  
Sbjct: 419 STCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMD 478

Query: 469 CQALADGCIRALPRDDGGIGFFAVCFER 496
            + LA+GCIR LP++DGGIGFFAVCFER
Sbjct: 479 PKQLAEGCIRTLPKEDGGIGFFAVCFER 506

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/499 (65%), Positives = 388/499 (77%), Gaps = 11/499 (2%)

Query: 1   MNFYRDATWVLEYVEQQ-EAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKP 59
           M FYRD+TWVLEY+E Q E  GR+SGSLQT+VL+ C +Y++K NPKH+YA++ SCWKYKP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  YLEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKS 119
           YL+K+MKKSG+LD IP+KKGKP +S+LTL+LLCHDLL SK+KRIQMGKHPIK YVLK+K+
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 RLHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKK 179
            L++E           +LS++VD +D+ +D+TPVRWIRINPLR     D + VL EL KK
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRI-SNHDTDQVLNELKKK 179

Query: 180 FPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239
           FP RV  W DI+PGSIYYDE+IP+LYGIH  DKITSHELYKQGKIIIQDRASCFPAHILN
Sbjct: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 240 PSKDDIIIDACAAPGNKTTHVASYMFGDAKQ-EDPHVQIYAFEKDPERAKILEKMIKVAG 298
           PS DD++IDAC+APGNKTTHVA+++FGD +   + +VQIYAFEKDPERA+IL+KMIK AG
Sbjct: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299

Query: 299 CSKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXX 358
           C KNI V VGDFT+ ATP K+ DVTGFI+DPSCSGSGIFGRK VD LN            
Sbjct: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPD 359

Query: 359 XXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEE 418
                           +K E LK RL+KL+SFQFQ+++HAMSFP AKKIVYSTCSIHAEE
Sbjct: 360 ENDAEETTD-------SKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEE 412

Query: 419 NERXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAK-CQALADGCI 477
           NER         KV+ WGW+VA KE V+PTW RRG  EEF+EVF D   + CQ LADGC+
Sbjct: 413 NERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCV 472

Query: 478 RALPRDDGGIGFFAVCFER 496
           RALP++DGGIGFFAVCF R
Sbjct: 473 RALPKEDGGIGFFAVCFVR 491

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/497 (62%), Positives = 381/497 (76%), Gaps = 16/497 (3%)

Query: 1   MNFYRDATWVLEYVEQQEAK-GRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKP 59
           M FYRD++WVLEY+EQ+ +K  RISGSLQTLVL+SC +YKLK NPKH+YA++ SCWKYK 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  YLEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKS 119
           YLEK++K SG+L D+P KKG+P++S+ T+MLL HDLL SK+KRI MGKHPIK +VLK + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 RLHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKK 179
           RL  E           +LSE+V++ND+  D++PVRWIRINP RC QG+ V+ VL+EL KK
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELVEDNDA--DMSPVRWIRINPFRC-QGK-VDDVLKELRKK 189

Query: 180 FPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239
           FPK+V++W  IVPGSIY DEYIP+LYG+HP DKITSHELYK+GKIIIQDRASCFPA+ILN
Sbjct: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249

Query: 240 PSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGC 299
           P+  D++IDAC+APGNKTTH+A+++F D    D  V+IYAFE+D +RA+ILEKM+  AGC
Sbjct: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDGNASD--VKIYAFERDAKRAEILEKMVTSAGC 307

Query: 300 SKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXX 359
              IQ++VGDFT+ A P  FKDVTGFI+DPSCSGSGIFGR+ VD  N+ +          
Sbjct: 308 ESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSK-------LAE 360

Query: 360 XXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEEN 419
                           + E  KTRLAKLSSFQFQ++KHAMSFP AKK+VYSTCSIHAEEN
Sbjct: 361 KVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEEN 420

Query: 420 ERXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRA 479
           ER          +KQ+GWKVA ++SVIP W RRG + EFEEVF  + A  Q LADGCIRA
Sbjct: 421 ERVVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQA--QELADGCIRA 478

Query: 480 LPRDDGGIGFFAVCFER 496
           LP++DGGIGFFAVCFER
Sbjct: 479 LPKEDGGIGFFAVCFER 495

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/497 (60%), Positives = 373/497 (75%), Gaps = 20/497 (4%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           MNFYRDATWVLEYVE+ E+ GR++GSLQTLVL SC KY LK NPKH+YA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           LEK++KKS IL D+PKKKGK +++  T+ LL HDLLF+K+KRIQMGKHP+KE+VLKHK+R
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           L+SE           +L +++   D   D+TPVRW RINP+RC+   +   V+ EL KKF
Sbjct: 121 LNSELVRLKIKLKVTDLHQLL--KDDRNDMTPVRWFRINPVRCHGKHE--EVMAELAKKF 176

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P RV++W D+VPGSIY+DEYIP+L+G+HP DKITSHELYK GKIIIQDRASCFPAHILNP
Sbjct: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
           S  D+IIDACAAPGNKTTHVA++MF + + ++P   I+AFEKDPERAK L  M+K AGCS
Sbjct: 237 SPSDVIIDACAAPGNKTTHVAAHMFLNDQPQEP--LIHAFEKDPERAKTLRTMVKTAGCS 294

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
           K I + VGDFTK A P  F +V+GFIVDPSCSGSGIFGR+ +D  N+ R           
Sbjct: 295 KGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPTQEEE 354

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                          + +D+K RLAKL+SFQF+++K+A+SFP+AKK+VYSTCSIHAEENE
Sbjct: 355 RQEI-----------EGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENE 403

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRD-DPAKCQALADGCIRA 479
           R        SKVK+WGW+V  +   IPTWPRRG   EFE+VFR+ D AK   LA+ CIR 
Sbjct: 404 RIVIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDTAK--ELAEACIRV 461

Query: 480 LPRDDGGIGFFAVCFER 496
            P++DGGIGFFAVCFER
Sbjct: 462 APKEDGGIGFFAVCFER 478

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/496 (60%), Positives = 367/496 (73%), Gaps = 14/496 (2%)

Query: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60
           MNFYRDATWVLEYVE  E  GR++GSLQTLVL SC KY+LK NPKH+YA + SCW+Y  +
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120
           L+K++K+SGIL DIPKKKGK +++  T+ LL HDLLFSK+KRIQMGKHP+KE+VLK+K+R
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180
           L SE           +L +++   D   D+TPVRW R+NP+RC  G     +L+EL KKF
Sbjct: 167 LSSELVRLKIKLKVTDLQQLL--KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKF 222

Query: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240
           P RV +W +I PG IY+DEYIP L+G+HP DKITSHELYK GK+IIQDRASCFPAHILN 
Sbjct: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282

Query: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300
           S +D+IIDACAAPGNKTTHVA+++F D   E   V+I+AFEKDPERAK L  MI  AGC+
Sbjct: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAVES--VRIHAFEKDPERAKTLRTMINTAGCT 340

Query: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXX 360
           K I+V VGDFT+ A P KF DVTGFI+DPSCSGSGIFGRK +D  N+ + +         
Sbjct: 341 KGIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEEE 400

Query: 361 XXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEENE 420
                            +DLK RL KL+SFQF+++KHAMSFP+AKK+VYSTCS+HAEENE
Sbjct: 401 KEEEREDIS-------DKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENE 453

Query: 421 RXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRAL 480
           R        SKVK+WGW+V  +  VIPTW RRG  +EFEEVFRD+    + LA+ CIR  
Sbjct: 454 RIVVDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT-AKELAEACIRVA 512

Query: 481 PRDDGGIGFFAVCFER 496
           P++DGGIGFFAVCFER
Sbjct: 513 PKEDGGIGFFAVCFER 528

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/497 (58%), Positives = 359/497 (72%), Gaps = 15/497 (3%)

Query: 1   MNFYRDATWVLEYVEQQEA-KGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKP 59
           M FYRDA+WVLEY+EQ+ A K +++GSL +LVLQS  KYKLK + +HVYA++ S WKYK 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  YLEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKS 119
           YL+++++KSG+L D+P+KKG+P + R TL L+ HDLL SK KRI MGKHP+K +VLKH++
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 RLHSEXXXXXXXXXXXNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKK 179
           RL  E           +LS +V   D  ED TPVRWIR+NP R    R+   VL+EL KK
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLV--QDEREDATPVRWIRLNPFRIRGQRE--EVLQELQKK 176

Query: 180 FPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239
           FP+RV +W ++ PGSIY DEY+  LYG+HP DKITSHELYK+GKIIIQDRASCFPA IL 
Sbjct: 177 FPRRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILA 236

Query: 240 PSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGC 299
           P + D+IIDACAAPGNKTTHVA+++F +   +  H QI+AFE+DP+RAK L KMI  AGC
Sbjct: 237 PGRSDVIIDACAAPGNKTTHVAAHIFPEGGAD--HAQIHAFERDPQRAKTLRKMIATAGC 294

Query: 300 SKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXX 359
              I+V VGDFT+ A P+ FK+VTGFIVDPSCSGSGIFGR+ VD+    +          
Sbjct: 295 DNAIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSAD 354

Query: 360 XXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEEN 419
                              +LK RLAKLSSFQFQ++KHAMSFP+AKK++YSTCS+HAEEN
Sbjct: 355 VPEEETFEATKSAV-----ELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEEN 409

Query: 420 ERXXXXXXXXSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRA 479
           ER        SKV++ GWKVA++  VIP WPRRG   EFEEVF   P + + LA GCIR 
Sbjct: 410 ERVVIDLLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVF---PDQAEELAGGCIRV 466

Query: 480 LPRDDGGIGFFAVCFER 496
           LP++DGGIGFFAVCFER
Sbjct: 467 LPKEDGGIGFFAVCFER 483

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 116/288 (40%), Gaps = 62/288 (21%)

Query: 138 SEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYY 197
           +E V+  ++ E   P+  IR N L+  + RD+   L   G    + + NW  +  G   +
Sbjct: 251 AEAVEFFEANEVARPI-TIRTNTLKTRR-RDLAQTLVNRGVNL-QPIGNWTKV--GLQIF 305

Query: 198 DEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKT 257
           D  +P   G  P+        Y  G+ I+Q  +S  P   L+P +++ I+D  +APG KT
Sbjct: 306 DSQVP--IGATPE--------YLAGQYILQAASSFLPVIALDPQENERILDMASAPGGKT 355

Query: 258 THVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPD 317
           T++++ M            ++A + +  R K L   I   GC+  I   V ++     P 
Sbjct: 356 TYISALMKNTG-------CVFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPK 405

Query: 318 KFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKK 377
                   ++D  CSG+G+ G+     ++R   +                          
Sbjct: 406 VIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD-------------------------- 439

Query: 378 EDLKTRLAKLSSFQFQVIKHAMSFPTAKK-----IVYSTCSIHAEENE 420
                   ++   Q Q++  A+    A       IVYSTCS+  EE+E
Sbjct: 440 ------FIQIPHLQKQLLLSAIDSVDANSKSGGVIVYSTCSVAVEEDE 481

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 117/288 (40%), Gaps = 62/288 (21%)

Query: 138 SEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYY 197
           +E ++  ++ E   PV  IR N L+  + RD+   L   G    + + +W  +  G   +
Sbjct: 243 AEAMEFFEANEVARPV-TIRTNTLKTRR-RDLAQNLVNRGVNL-QPIGSWTKV--GLQIF 297

Query: 198 DEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKT 257
           D  +P   G  P+        Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KT
Sbjct: 298 DSQVP--VGATPE--------YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKT 347

Query: 258 THVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPD 317
           T++++ M            ++A + +  R K L   I   GC+  I   V ++     P 
Sbjct: 348 TYISAMMKNTG-------CVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPK 397

Query: 318 KFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKK 377
                   ++D  CSG+G+ G+     +NR   +                          
Sbjct: 398 VIGGFDRILLDAPCSGTGVIGKDQSVKVNRTEKD-------------------------- 431

Query: 378 EDLKTRLAKLSSFQFQVIKHAM-SFPTAKK----IVYSTCSIHAEENE 420
                   ++   Q Q+I  A+ S  +  K    IVYSTCS+  EENE
Sbjct: 432 ------FMQIPHLQKQLILSAIDSVDSNSKHGGVIVYSTCSVAVEENE 473

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 114/288 (39%), Gaps = 62/288 (21%)

Query: 138 SEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYY 197
           +E ++  ++ E   P+  IR N L+  + RD+   L   G    + + +W  +  G   +
Sbjct: 250 AEAMEFFEANEIARPI-TIRTNTLKTRR-RDLAQTLVNRGVNL-QPIGSWTKV--GLQIF 304

Query: 198 DEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKT 257
           D  +P   G  P+        Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KT
Sbjct: 305 DSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKT 354

Query: 258 THVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPD 317
           T++++ M            ++A + +  R K L   I   GC   I   V ++     P 
Sbjct: 355 TYISALMKNTG-------CVFANDANKARTKSLIANIHRLGCHNTI---VCNYDAREFPK 404

Query: 318 KFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKK 377
                   ++D  CSG+G+ G+     ++R   +                          
Sbjct: 405 VIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD-------------------------- 438

Query: 378 EDLKTRLAKLSSFQFQVIKHAMS-----FPTAKKIVYSTCSIHAEENE 420
                   ++   Q Q+I  A+        T   IVYSTCS+  EENE
Sbjct: 439 ------FMQIPHLQKQLILSAIDSVDAHSKTGGVIVYSTCSVAVEENE 480

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 116/288 (40%), Gaps = 62/288 (21%)

Query: 138 SEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYY 197
           +E ++  ++ E   PV  IR N L+  + RD+   L   G    + + +W  +  G   +
Sbjct: 253 AEAMEFFEANEIARPV-TIRTNTLKTRR-RDLAQTLVNRGVNL-QPIGSWTKV--GLQIF 307

Query: 198 DEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKT 257
           D  +P   G  P+        Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KT
Sbjct: 308 DSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKT 357

Query: 258 THVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPD 317
           T++++ M            ++A + +  R K L   I   GC+  I   V ++     P 
Sbjct: 358 TYISAMMKNTG-------CVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPK 407

Query: 318 KFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKK 377
                   ++D  CSG+G+ G+     ++R   +                          
Sbjct: 408 VIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD-------------------------- 441

Query: 378 EDLKTRLAKLSSFQFQVIKHAM-----SFPTAKKIVYSTCSIHAEENE 420
                   ++   Q Q++  A+     +  T   IVYSTCS+  +ENE
Sbjct: 442 ------FMQIPHLQKQLLLSAIDSVDSNSKTGGVIVYSTCSVAVDENE 483

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 115/288 (39%), Gaps = 62/288 (21%)

Query: 138 SEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYY 197
           +E ++  ++ E   P+  IR N L+  + RD+   L   G    + + NW  +  G   +
Sbjct: 268 AEALEFFEANEIARPI-TIRTNTLKTRR-RDLAQSLVNRGVNL-QPIGNWTKV--GLQIF 322

Query: 198 DEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKT 257
           D  +P   G  P+        Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KT
Sbjct: 323 DSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKT 372

Query: 258 THVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPD 317
           T++++ M            ++A + +  R K L   I   GC+  I   V ++     P 
Sbjct: 373 TYISAMMKNTG-------CVFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPK 422

Query: 318 KFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKK 377
                   ++D  CSG+G+ G+     ++R   +                          
Sbjct: 423 VIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD-------------------------- 456

Query: 378 EDLKTRLAKLSSFQFQVIKHAMSFPTAKK-----IVYSTCSIHAEENE 420
                   ++   Q Q++  A+    A       IVYSTCS+  EE+E
Sbjct: 457 ------FIQIPHLQKQLLLSAIDSVDANSKKGGIIVYSTCSVAVEEDE 498

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 112/287 (39%), Gaps = 65/287 (22%)

Query: 139 EIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYYD 198
           E  + N+ +  +T    IR N L+  + RD+   L   G    + +  W  +  G   +D
Sbjct: 249 EFFEANEVSRPIT----IRTNTLKTRR-RDLAQTLVNRGVNL-QPIGTWTKV--GLQIFD 300

Query: 199 EYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTT 258
             +P   G  P+        Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KTT
Sbjct: 301 SQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTT 350

Query: 259 HVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPDK 318
           ++++ M            ++A + +  R K L   I   GC+  I   V ++     P  
Sbjct: 351 YISALMKNTG-------CVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKV 400

Query: 319 FKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKE 378
                  ++D  CSG+G+  +     ++R   +                           
Sbjct: 401 IGGFDRILLDAPCSGTGVIAKDQSVKVSRTEKD--------------------------- 433

Query: 379 DLKTRLAKLSSFQFQVIKHAM-----SFPTAKKIVYSTCSIHAEENE 420
                  ++   Q Q+I  A+     +  T   IVYSTCS+  EENE
Sbjct: 434 -----FMQIPHLQKQLILSAIDSVDSNSKTGGIIVYSTCSVAVEENE 475

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 112/287 (39%), Gaps = 65/287 (22%)

Query: 139 EIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYYD 198
           E  + N+ +  VT    IR N L+  + RD+   L   G    K +  W  +  G   +D
Sbjct: 271 EFFEANEVSRPVT----IRTNSLKTRR-RDLAQTLVNRGVNL-KPIGPWTKV--GLQIFD 322

Query: 199 EYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTT 258
             +P   G  P+        Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KTT
Sbjct: 323 SQVP--IGATPE--------YLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTT 372

Query: 259 HVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPDK 318
           ++++ M            ++A + +  R K L   I   GC+  I   V ++     P  
Sbjct: 373 YISAMMKNTG-------CVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKV 422

Query: 319 FKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKE 378
                  ++D  CSG+G+  +     ++R   +                           
Sbjct: 423 IGGFDRILLDAPCSGTGVIAKDQSVKVSRTDKD--------------------------- 455

Query: 379 DLKTRLAKLSSFQFQVIKHAM-----SFPTAKKIVYSTCSIHAEENE 420
                  ++   Q Q++  A+     +  T   IVYSTCS+  EENE
Sbjct: 456 -----FMQIPHLQKQLLLSAIDSVDANSKTGGVIVYSTCSVAVEENE 497

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 105/270 (38%), Gaps = 61/270 (22%)

Query: 156 IRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITS 215
           IR N L+  + RD+   L   G    K +  W  +  G   +D  +P   G  P+     
Sbjct: 282 IRTNSLKTRR-RDLAQTLVNRGVNL-KPIGPWTKV--GLQIFDSQVP--IGATPE----- 330

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHV 275
              Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KTT++++ M           
Sbjct: 331 ---YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTG------- 380

Query: 276 QIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSG 335
            ++A + +  R K L   I   GC+  I   V ++     P         ++D  CSG+G
Sbjct: 381 CVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTG 437

Query: 336 IFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVI 395
           +  +     ++R   +                                  ++   Q Q++
Sbjct: 438 VIAKDQSVKVSRTEKD--------------------------------FIQIPHLQKQLL 465

Query: 396 KHAM-----SFPTAKKIVYSTCSIHAEENE 420
             A+     +  T   IVYSTCS+  EENE
Sbjct: 466 LSAIDSVDANSKTGGVIVYSTCSVAVEENE 495

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/288 (22%), Positives = 116/288 (40%), Gaps = 62/288 (21%)

Query: 138 SEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYY 197
           +E ++  ++ E   P+  IR N L+  + RD+   L   G    + + +W  +  G   +
Sbjct: 259 AEALEFFEANEIARPI-TIRTNTLKTSR-RDLAQALVNRGVNL-QPIGSWTKV--GLQIF 313

Query: 198 DEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKT 257
           D  +P   G  P+        Y  G  I+Q  +S  P   L+P +++ ++D  +APG KT
Sbjct: 314 DSQVP--IGATPE--------YLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKT 363

Query: 258 THVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPD 317
           T++++ M            ++A + + +R K L   I   GC+  I   V ++     P 
Sbjct: 364 TYISALMKNTG-------CVFANDANKKRTKSLIANIHRLGCTNTI---VCNYDAREFPK 413

Query: 318 KFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKK 377
                   ++D  CSG+G+ G+     ++R   +                          
Sbjct: 414 VIGGFDRVLLDAPCSGTGVIGKDQSVKVSRTEKD-------------------------- 447

Query: 378 EDLKTRLAKLSSFQFQVIKHAMSFPTAKK-----IVYSTCSIHAEENE 420
                   ++   Q Q++  A+    A       IVYSTCS+  EE+E
Sbjct: 448 ------FIQIPHLQKQLLLSAIDSVDANSKKGGVIVYSTCSVAVEEDE 489

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 81/184 (44%), Gaps = 24/184 (13%)

Query: 156 IRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITS 215
           IR N L+  + RD+   L   G    + + +W  +  G   +D  +P   G  P+     
Sbjct: 280 IRTNTLKTRR-RDLAQALVNRGVNL-QPIGSWTKV--GLQIFDSQVP--IGATPE----- 328

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHV 275
              Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KTT++++ M           
Sbjct: 329 ---YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALMKNTG------- 378

Query: 276 QIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSG 335
            ++A + +  R K L   I   GC+  I   V ++     P         ++D  CSG+G
Sbjct: 379 TVFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTG 435

Query: 336 IFGR 339
           + G+
Sbjct: 436 VIGK 439

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 116/288 (40%), Gaps = 62/288 (21%)

Query: 138 SEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYY 197
           SE ++  ++ E   P+  IR N L+  + RD+   L   G    + +  W  +  G   +
Sbjct: 270 SEAIEFFEANEVSRPI-TIRTNTLKTRR-RDLAQALVNRGVNL-QPIGAWTKV--GLQIF 324

Query: 198 DEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKT 257
           D  +P   G  P+        Y  G  I+Q  +S  P   L+P +++ ++D  +APG KT
Sbjct: 325 DSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKT 374

Query: 258 THVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPD 317
           T++++ M            I+A + +  R K L   I   GC+  I   V ++     P 
Sbjct: 375 TYISALMKNTG-------CIFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPK 424

Query: 318 KFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKK 377
                   ++D  CSG+G+ G+     ++R   +                          
Sbjct: 425 VIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD-------------------------- 458

Query: 378 EDLKTRLAKLSSFQFQVIKHAM-SFPTAKK----IVYSTCSIHAEENE 420
                   ++   Q Q+I  A+ S  +  K    +VYSTCS+  EE+E
Sbjct: 459 ------FIQIPHLQKQLILSAIDSLDSNSKNGGVLVYSTCSVAVEEDE 500

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 116/288 (40%), Gaps = 62/288 (21%)

Query: 138 SEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYY 197
           +E ++  ++ E   P+  IR N L+  + RD+   L   G    + + +W  +  G   +
Sbjct: 253 AEAMEFFEANEIARPI-TIRTNTLKTRR-RDLAQALVNRGVNL-QPIGSWTKV--GLQIF 307

Query: 198 DEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKT 257
           D  +P   G  P+        Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KT
Sbjct: 308 DSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKT 357

Query: 258 THVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPD 317
           T++++ M            ++A + +  R K L   I   GC+  I   V ++     P 
Sbjct: 358 TYISALMKNTG-------CVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPK 407

Query: 318 KFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKK 377
                   ++D  C+G+G+ G+     ++R   +                          
Sbjct: 408 VIGGFDRILLDAPCTGTGVIGKDQSVKVSRTEKD-------------------------- 441

Query: 378 EDLKTRLAKLSSFQFQVIKHAM-----SFPTAKKIVYSTCSIHAEENE 420
                   ++   Q Q++  A+     +  T   IVYSTCS+  EE+E
Sbjct: 442 ------FIQVPHLQKQLLLSAIDSVDSNSKTGGIIVYSTCSVAVEEDE 483

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 90/202 (44%), Gaps = 25/202 (12%)

Query: 138 SEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYY 197
           +E ++  ++ E   P+  IR N L+  + RD+   L   G    + + +W  +  G   +
Sbjct: 256 AEAMEFFEANEIARPI-TIRTNTLKTRR-RDLAQTLVNRGVNL-QPIGSWTKV--GLQIF 310

Query: 198 DEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKT 257
           D  +P   G  P+        Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KT
Sbjct: 311 DSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKT 360

Query: 258 THVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPD 317
           T++++ M            ++A + +  R K L   I   GC+  I   V ++     P 
Sbjct: 361 TYISAMMKNTG-------CVFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPK 410

Query: 318 KFKDVTGFIVDPSCSGSGIFGR 339
                   ++D  CSG+G+ G+
Sbjct: 411 VIGGFDRILLDAPCSGTGVIGK 432

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 90/202 (44%), Gaps = 25/202 (12%)

Query: 138 SEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYY 197
           +E ++  ++ E   P+  IR N L+  + RD+   L   G    + + +W  +  G   +
Sbjct: 256 AEAMEFFEANEIARPI-TIRTNTLKTRR-RDLAQTLVNRGVNL-QPIGSWTKV--GLQIF 310

Query: 198 DEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKT 257
           D  +P   G  P+        Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KT
Sbjct: 311 DSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKT 360

Query: 258 THVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPD 317
           T++++ M            ++A + +  R K L   I   GC+  I   V ++     P 
Sbjct: 361 TYISAMMKNTG-------CVFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPK 410

Query: 318 KFKDVTGFIVDPSCSGSGIFGR 339
                   ++D  CSG+G+ G+
Sbjct: 411 VIGGFDRILLDAPCSGTGVIGK 432

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 90/202 (44%), Gaps = 25/202 (12%)

Query: 138 SEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYY 197
           +E ++  ++ E   P+  IR N L+  + RD+   L   G    + + +W  +  G   +
Sbjct: 128 AEALEFFEANEIARPI-TIRTNTLKTRR-RDLAQALVNRGVNL-QPIGSWTKV--GLQIF 182

Query: 198 DEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKT 257
           D  +P   G  P+        Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KT
Sbjct: 183 DSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKT 232

Query: 258 THVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPD 317
           T++++ M            ++A + +  R K L   I   GC+  I   V ++     P 
Sbjct: 233 TYISAMMKNTG-------CVFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPK 282

Query: 318 KFKDVTGFIVDPSCSGSGIFGR 339
                   ++D  CSG+G+ G+
Sbjct: 283 VIGGFDRILLDAPCSGTGVIGK 304

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 90/202 (44%), Gaps = 25/202 (12%)

Query: 138 SEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYY 197
           +E ++  ++ E   PV  IR N L+  + RD+   L   G    + + +W  +  G   +
Sbjct: 258 AEAMEFFEANEIARPV-TIRTNTLKTRR-RDLAQTLVNRGVNL-QPIGSWTKV--GLQIF 312

Query: 198 DEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKT 257
           D  +P   G  P+        Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KT
Sbjct: 313 DSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKT 362

Query: 258 THVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPD 317
           T++++ M            ++A + +  R K L   I   GC+  I   V ++     P 
Sbjct: 363 TYISAMMKNTG-------CVFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPK 412

Query: 318 KFKDVTGFIVDPSCSGSGIFGR 339
                   ++D  CSG+G+ G+
Sbjct: 413 VIGGFDRILLDAPCSGTGVIGK 434

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 114/307 (37%), Gaps = 73/307 (23%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L+      ++D CAAPG+KT  +  Y+  D   ++P   + A +
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRD--NDEPSGFVVAND 199

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKA-ATPDKF--KDVTGF---IVDPSCS 332
            D +R+ +L   +K    S N+ V   D   F +  A PD    KD+  F   + D  CS
Sbjct: 200 ADAKRSHMLVHQLKRLN-SANLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPCS 258

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLSSFQ 391
           G G   RK V                                N   D  T+    L + Q
Sbjct: 259 GDGTM-RKNV--------------------------------NVWRDWTTQNGLALHNVQ 285

Query: 392 FQVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV----------- 439
             ++   +    +  ++VYSTCS++  ENE           +++WG KV           
Sbjct: 286 LNILNRGLHLLKSGGRLVYSTCSMNPIENE-----AVVAEALRKWGGKVRLVDCSDKLPG 340

Query: 440 AAKESVIPTWPRRGKIEEFEEVFRD----------DPAKCQALADGCIRALPRDDGGIGF 489
             + + I  WP   +  E +E   D          D    +   D C+R  P      GF
Sbjct: 341 LVRSNGINQWPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGF 400

Query: 490 FAVCFER 496
           F    E+
Sbjct: 401 FITVLEK 407

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 86/203 (42%), Gaps = 37/203 (18%)

Query: 219 YKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIY 278
           Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KTT++++ M            ++
Sbjct: 323 YLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGC-------VF 375

Query: 279 AFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFG 338
           A + +  R K L   I   GC+  I   V ++     P         ++D  CSG+G+ G
Sbjct: 376 ANDANKSRTKSLVANIHRLGCTNTI---VCNYDAREFPRVIGGFDRILLDAPCSGTGVIG 432

Query: 339 RKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHA 398
           +     ++R   +                      + +   L+ +L  L S    V  H+
Sbjct: 433 KDQSVKVSRTEKD----------------------FMQIPHLQKQL--LLSAIDSVDSHS 468

Query: 399 MSFPTAKKIVYSTCSIHAEENER 421
               T   IVYSTCS+  EE+E+
Sbjct: 469 K---TGGIIVYSTCSVAVEEDEQ 488

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/310 (23%), Positives = 121/310 (39%), Gaps = 77/310 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L+      ++D CAAPG+KT  +   +  D+  ++P   + A +
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDS--DEPSGFVIAND 197

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGDF---------TKAATPDKFKDVTGFIVDPSCS 332
            D +R+ +L   +K    S N+ +   D          TK A+  +       + D  CS
Sbjct: 198 ADNKRSHLLVHQLKRLSTS-NVLIVNHDAQFFPNLKINTKDASSQEDLKFDRILCDVPCS 256

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQF 392
           G G   +    ++N  +N                       +N +  L      L + QF
Sbjct: 257 GDGTMRK----NVNVWKN-----------------------WNTQNAL-----GLHNVQF 284

Query: 393 QVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV-----------A 440
            ++   ++      K+VYSTCS++  ENE         + +++WG KV            
Sbjct: 285 NILDRGLTLLKETGKLVYSTCSLNPIENE-----AVVAAVLRKWGDKVRLVCCDDKLKGL 339

Query: 441 AKESVIPTWPRRGKIEEFEEVFR---DD-------PAKCQALA----DGCIRALPRDDGG 486
            +   + TWP   +  + EEV R   DD       P   + ++    D C+R  P     
Sbjct: 340 IRSKGLTTWPVINR--DMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNT 397

Query: 487 IGFFAVCFER 496
            GFF   FE+
Sbjct: 398 GGFFITMFEK 407

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 71/308 (23%), Positives = 116/308 (37%), Gaps = 75/308 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +    + ++P   + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALH--MEDDEPSGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD--------FTKAATPDKFKDVTGF---IVDPS 330
            D +R+ +L   +K    S N+ V   D          + AT  + KDV  F   + D  
Sbjct: 203 ADAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHEDAT--QKKDVLRFDRVLCDVP 259

Query: 331 CSGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSF 390
           CSG G   +    ++N  R+                       +N +  L      L + 
Sbjct: 260 CSGDGTMRK----NVNVWRD-----------------------WNTQSGLG-----LHTV 287

Query: 391 QFQVIKHAMSFPTAK-KIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV---------- 439
           Q  ++   +     K ++VYSTCS++  ENE         + +++WG K+          
Sbjct: 288 QLNILNRGLHLLKPKGRLVYSTCSMNPIENE-----AVVAAALRKWGDKIRLVNCDDKLP 342

Query: 440 -AAKESVIPTWP---------RRGKIEEFEEVFRDDPAKCQAL-ADGCIRALPRDDGGIG 488
              +   I TWP         ++G     E  F   P + +      CIR  P      G
Sbjct: 343 GLVRSKGISTWPVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGG 402

Query: 489 FFAVCFER 496
           FF   FE+
Sbjct: 403 FFITVFEK 410

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/270 (22%), Positives = 105/270 (38%), Gaps = 61/270 (22%)

Query: 156 IRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITS 215
           IR N L+  + RD+   L   G    + +  W  +  G   +D  +P          I +
Sbjct: 288 IRTNTLKTRR-RDLAQALVNKGVNL-QPIGAWTKV--GLQIFDSQVP----------IGA 333

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHV 275
              Y  G+ I+Q  +S  P   L+P +++ ++D  AAPG KTT++++ M           
Sbjct: 334 TSEYLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALMKNTG------- 386

Query: 276 QIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSG 335
            ++A + +  R K L   I   GC+  I   V ++     P         ++D  CSG+G
Sbjct: 387 CVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTG 443

Query: 336 IFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVI 395
           + G+      +R   +                                  ++   Q Q++
Sbjct: 444 VIGKDQSVKSSRTEKD--------------------------------FIQIPHLQKQLL 471

Query: 396 KHAM-----SFPTAKKIVYSTCSIHAEENE 420
             A+     +  T   IVYSTCS+  EE+E
Sbjct: 472 LSAIDSVDANSKTGGVIVYSTCSVAVEEDE 501

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 116/306 (37%), Gaps = 74/306 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P ++L       ++D CAAPG+KT  +   +  +  +  P   + A +
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPE--PSGFVVAND 203

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKAATPDKFKDVTGF---IVDPSCSGSG 335
            D  R+ +L   +K    S N+ V   D   F +  T +  KD   F   + D  CSG G
Sbjct: 204 ADYRRSHMLVHQLKRLN-SANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDG 262

Query: 336 IFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLSSFQFQV 394
              RK +                                N  +D  T     L + Q  +
Sbjct: 263 TM-RKNI--------------------------------NVWKDWGTGSGLGLHTVQLNI 289

Query: 395 IKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV-----------AAK 442
           +   ++      ++VYSTCS++  ENE         + +++WG K+             +
Sbjct: 290 LNRGLTLLKNGGRLVYSTCSLNPIENE-----AVVAAALRKWGAKIKLVNCDDQLLGLVR 344

Query: 443 ESVIPTWPRRGKIEEFEEVFRDD---------PAKCQALA---DGCIRALPRDDGGIGFF 490
            + I +WP   K   +EE  + D         P++ +A     + CIR  P      GFF
Sbjct: 345 STGISSWPVLDK--NYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFF 402

Query: 491 AVCFER 496
              FE+
Sbjct: 403 ISVFEK 408

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 80/184 (43%), Gaps = 24/184 (13%)

Query: 156 IRINPLRCYQGRDVNAVLEELGKKFPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITS 215
           IR N L+  + RD+   L   G    + +  W  +  G   +D  +P   G  P+     
Sbjct: 274 IRTNTLKTRR-RDLAQTLVNRGVNL-QPIGPWTKV--GLQIFDSQVP--IGATPE----- 322

Query: 216 HELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHV 275
              Y  G  I+Q  +S  P   L+P +++ I+D  AAPG KTT++++ M           
Sbjct: 323 ---YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTG------- 372

Query: 276 QIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSG 335
            ++A + +  R K L   I   GC+  I   V ++     P         ++D  CSG+G
Sbjct: 373 CVFANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTG 429

Query: 336 IFGR 339
           + G+
Sbjct: 430 VIGK 433

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 82/207 (39%), Gaps = 47/207 (22%)

Query: 219 YKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIY 278
           Y  G+ I+Q  +S  P   L+P  ++ ++D  AAPG KTT++++ M            ++
Sbjct: 317 YLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALMKNTG-------CVF 369

Query: 279 AFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFG 338
           A + +  R K L   I   GC+  I   V ++     P         ++D  CSG+G+ G
Sbjct: 370 ANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIG 426

Query: 339 RKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQVIKHA 398
           +     ++R   +                                  ++   Q Q++  A
Sbjct: 427 KDQSVKVSRTEKD--------------------------------FIQIPHLQKQLLLSA 454

Query: 399 MSFPTAKK-----IVYSTCSIHAEENE 420
           +    A       IVYSTCS+  EE+E
Sbjct: 455 IDSVDANSKTGGFIVYSTCSVAVEEDE 481

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 114/307 (37%), Gaps = 73/307 (23%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +  D   ++P   + A +
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDT--DEPTGFVVAND 203

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTK---AATPDKFKDVTGF---IVDPSCS 332
            D  R+ +L   +K    S N+ V   D   F +   +   DK KD+  F   + D  CS
Sbjct: 204 ADSRRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCS 262

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQF 392
           G G   RK V+                              +N +  L      L + Q+
Sbjct: 263 GDGTM-RKNVN--------------------------VWKDWNTQSGL-----GLHTVQY 290

Query: 393 QVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKVA----------- 440
            ++   ++   +  ++VYSTCS++  ENE           ++ WG K+            
Sbjct: 291 NILNRGLNLLKSGGRLVYSTCSLNPIENE-----AVVAQALRTWGDKIKLVNCGDKLPGL 345

Query: 441 AKESVIPTWP---------RRGKIEEFEEVF--RDDPAKCQALADGCIRALPRDDGGIGF 489
            +   I  WP          +G     E  F   ++ AK   L + CIR  P      GF
Sbjct: 346 VRSQGISQWPVIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHL-ENCIRVYPHQQNTGGF 404

Query: 490 FAVCFER 496
           F    E+
Sbjct: 405 FITVIEK 411

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 107/306 (34%), Gaps = 71/306 (23%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +  D   ++P   + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDT--DEPTGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---------FTKAATPDKFKDVTGFIVDPSCS 332
            D +R+ +L   +K    S N+ V   D          T A    +       + D  CS
Sbjct: 203 ADAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCS 261

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQF 392
           G G   RK V+                              +N +  L      L + Q 
Sbjct: 262 GDGTM-RKNVNVWK--------------------------DWNTQGGL-----GLHTVQL 289

Query: 393 QVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV-----------A 440
            ++   ++   +  ++VYSTCS++  ENE           +++WG K+            
Sbjct: 290 NILNRGLNLLKSGGRLVYSTCSMNPIENE-----AVVAEALRKWGSKIKLVNCDDKLVGL 344

Query: 441 AKESVIPTWP---------RRGKIEEFEEVFRDDPAKCQAL-ADGCIRALPRDDGGIGFF 490
            +   I  WP          +G     E  F     + +    D CIR  P      GFF
Sbjct: 345 VRSKGISNWPVLDRNMAVKNKGDEGTIESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFF 404

Query: 491 AVCFER 496
              FE+
Sbjct: 405 ITVFEK 410

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 116/309 (37%), Gaps = 77/309 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +  D   ++P   + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKDT--DEPTGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKAATPD---KFKDVTGF---IVDPSCS 332
            D  R+ +L   +K    S N+ V   D   F +    D   K +D+  F   + D  CS
Sbjct: 203 ADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPCS 261

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQF 392
           G G   RK V+                              +N +  L      L + Q+
Sbjct: 262 GDGTM-RKNVNVW--------------------------KDWNAQGAL-----GLHTVQW 289

Query: 393 QVIKHAMSF--PTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV----------- 439
            ++   +    P   ++VYSTCS++  ENE           +++WG K+           
Sbjct: 290 NILNRGLHLLKPNG-RLVYSTCSLNPIENE-----AVVAQALRKWGNKIRLVNCDEKLPG 343

Query: 440 AAKESVIPTWPRRGKIEEFEEVFRDD---------PAKCQAL---ADGCIRALPRDDGGI 487
             +   I  WP   +  + E   ++D         P++ +A     D CIR  P      
Sbjct: 344 LVRSKGISQWPVLNR--DLETKNKNDEGVLESWFPPSEEEASLFNLDACIRVYPHQQNTG 401

Query: 488 GFFAVCFER 496
           GFF   FE+
Sbjct: 402 GFFITVFEK 410

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 109/309 (35%), Gaps = 79/309 (25%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L    +  ++D CAAPG+KT  +   +  D   ++P   I A +
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDT--DEPTGIIVAND 216

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKAATPDKFKDVTG----FIVDPSCSGS 334
            D  R+ +L   +K    S NI V   D   F    T     ++T      + D  CSG 
Sbjct: 217 SDMRRSYLLVHQLKRLN-SSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGD 275

Query: 335 GIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQFQV 394
           G   RK ++  N  R                               +  L  L   Q  +
Sbjct: 276 GTL-RKNINIWNDWR------------------------------FQNALG-LHRLQNNI 303

Query: 395 IKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKVAA-----------K 442
           +   +       ++VYSTCS++  ENE         + ++ W  +V+            +
Sbjct: 304 LNRGLQLLRNGGRLVYSTCSMNPIENE-----AVIANALRNWAGEVSLVNFDDELPGLIR 358

Query: 443 ESVIPTWP---RRGKIEEFEEVFRDDPAKCQAL------------ADGCIRALPRDDGGI 487
              I +WP   R G++ E     R DP    +              + CIR  P      
Sbjct: 359 SRGISSWPVIDRNGEMRE-----RGDPETLDSWFPPTADEQKTFNLEKCIRVYPHQQDTG 413

Query: 488 GFFAVCFER 496
            FF   FE+
Sbjct: 414 AFFIAVFEK 422

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 112/306 (36%), Gaps = 74/306 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +   + +++P   + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALH--SSEDEPTGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKAAT---PDKFKDVTGFIVDPSCSGSG 335
            D  R+ +L   +K    S N+ V   D   F +  T    ++F      + D  CSG G
Sbjct: 203 ADARRSHMLVHQLKRLN-SANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDG 261

Query: 336 IFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLSSFQFQV 394
              RK V                                N  +D  T     L + Q  +
Sbjct: 262 TM-RKNV--------------------------------NVWKDWGTASGLGLHTVQLNI 288

Query: 395 IKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKVA-----------AK 442
           +K  ++      ++VYSTCS++  ENE         + ++QWG K+             +
Sbjct: 289 LKRGLNLLKKGGRLVYSTCSMNPIENE-----AVVAAALRQWGDKIKLVDCSDKLPGLVR 343

Query: 443 ESVIPTWPRRGKIEEFEEVFRDD--------PAKCQALA----DGCIRALPRDDGGIGFF 490
              I  WP   K   FE+  + D        P   +  A    D CIR  P      GFF
Sbjct: 344 SKGISNWPVIDKA--FEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFF 401

Query: 491 AVCFER 496
               E+
Sbjct: 402 ITVIEK 407

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 113/307 (36%), Gaps = 73/307 (23%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +  D   ++P   + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDT--DEPTGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKAAT---PDKFKDVTGF---IVDPSCS 332
            D  R+ +L   +K    S N+ V   D   F +  T    +K  D+  F   + D  CS
Sbjct: 203 ADNRRSHMLVHQLKRLN-SANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCS 261

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLSSFQ 391
           G G   RK V                                N   D  T+ A  L   Q
Sbjct: 262 GDGTM-RKNV--------------------------------NVWRDWNTQNALGLHQVQ 288

Query: 392 FQVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV----------- 439
             ++   +       ++VYSTCS++  ENE           +++WG KV           
Sbjct: 289 ANILNRGLHLLKKGGRLVYSTCSMNPIENE-----AVVAQALRKWGDKVRLVNCDDKLPG 343

Query: 440 AAKESVIPTWPRRGK-IEEFE---EVFRDD---PAKCQA---LADGCIRALPRDDGGIGF 489
             +   I  WP   + +EE E   E   D    P + +A     + CIR  P      GF
Sbjct: 344 LVRNKGISKWPTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGF 403

Query: 490 FAVCFER 496
           F   FE+
Sbjct: 404 FITVFEK 410

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 68/306 (22%), Positives = 112/306 (36%), Gaps = 74/306 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L    +  ++D CAAPG+KT  +   +   A++++P   + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALH--AQEDEPTGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKAATPDKFKDVTGF---IVDPSCSGSG 335
            D +R+ +L   +K    S N+ V   D   F +  +    K+   F   + D  CSG G
Sbjct: 203 ADAKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDG 261

Query: 336 IFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLSSFQFQV 394
              RK V                                N   D  T     L + Q  +
Sbjct: 262 TM-RKNV--------------------------------NVWRDWGTASGLGLHTVQLNI 288

Query: 395 IKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV-----------AAK 442
           +   ++      ++VYSTCS++  ENE         + +++WG K+             +
Sbjct: 289 LNRGLNLLKDGGRLVYSTCSLNPIENE-----SVIAAALRKWGDKIRLVNCDEKLPGLVR 343

Query: 443 ESVIPTWP------------RRGKIEEFEEVFRDDPAKCQALADGCIRALPRDDGGIGFF 490
              I  WP              G IE +     ++  +     + CIR  P      GFF
Sbjct: 344 SKGITQWPVYDKNFALKEKGDEGVIETWFPPTEEEATRFH--LENCIRVYPHQQNTGGFF 401

Query: 491 AVCFER 496
              FE+
Sbjct: 402 ITVFEK 407

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 69/309 (22%), Positives = 109/309 (35%), Gaps = 77/309 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +  D   ++P   + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDT--DEPSGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKA---ATPDKFKDVTGF---IVDPSCS 332
            D  R+ +L   +K    S N+ V   D   F +       +K  DV  F   + D  CS
Sbjct: 203 ADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCS 261

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLSSFQ 391
           G G   RK V                                N  +D  T+    L + Q
Sbjct: 262 GDGTM-RKNV--------------------------------NVWKDWNTQAGLGLHTVQ 288

Query: 392 FQVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV----------- 439
             ++   +       ++VYSTCS++  ENE           +++WG K+           
Sbjct: 289 LNILNRGLHLLKDGGRLVYSTCSLNPIENE-----AVIAEALRKWGDKIRLVNCDDKLSG 343

Query: 440 AAKESVIPTWP------------RRGKIEEFEEVFRDDPAKCQALADGCIRALPRDDGGI 487
             +   +  WP              G +E F     ++ +K       C+R  P      
Sbjct: 344 LVRSKGVSKWPVYDRNLTEKTKGDEGTLESFFAPSEEEASKFN--LQNCMRVYPHQQNTG 401

Query: 488 GFFAVCFER 496
           GFF   FE+
Sbjct: 402 GFFITVFEK 410

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 116/307 (37%), Gaps = 72/307 (23%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +  D   ++P   + A +
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDT--DEPTGFVVAND 200

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGDF-------TKAATPDKFKDVTGF---IVDPSC 331
            D +R+ +L   +K    S N+ V   D        + AA      +V  F   + D  C
Sbjct: 201 ADSKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRVLCDVPC 259

Query: 332 SGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQ 391
           SG G   +    ++N  R+                       +  +  L      L + Q
Sbjct: 260 SGDGTMRK----NVNVWRD-----------------------WTPQGGL-----GLHTVQ 287

Query: 392 FQVIKHAMSFPTAK-KIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV--AAKESVIPT 448
           F ++   +     K ++VYSTCS++  ENE           +++WG K+   + E  +P 
Sbjct: 288 FNILNRGLHLLKNKGRLVYSTCSMNPIENE-----AVVAEALRKWGDKIRLVSCEDKLPG 342

Query: 449 WPRRGKIEEFEEVFRD----------------DPAKCQALA---DGCIRALPRDDGGIGF 489
             R   + ++  + R+                 P + +A     + CIR  P      GF
Sbjct: 343 LVRSKGVSQWPVIDRNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGF 402

Query: 490 FAVCFER 496
           F   FE+
Sbjct: 403 FITVFEK 409

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 111/306 (36%), Gaps = 74/306 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +   AK  +P   + A +
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALH--AKGPEPSGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKAATPDKFKDVTGF---IVDPSCSGSG 335
            D  R+ +L   +K    S N+ V   D   F +  T +  KD   F   + D  CSG G
Sbjct: 203 ADYRRSHMLVHQLKRLN-SANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDG 261

Query: 336 IFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLSSFQFQV 394
              RK +                                N  +D  T     L + Q  +
Sbjct: 262 TM-RKNI--------------------------------NVWKDWATASGLGLHTVQVNI 288

Query: 395 IKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKVAAKE---------- 443
           +   ++      ++VYSTCS++  ENE         + +++WG K+   E          
Sbjct: 289 LNRGLNLLKDGGRLVYSTCSLNPIENE-----AVVAAALRKWGDKIKLVECGDKLPGLIR 343

Query: 444 -SVIPTWPRRGKIEEFEEVFRDD--------PAKCQALA----DGCIRALPRDDGGIGFF 490
              I  WP   K   F    R D        P   + ++    + C+R  P      GFF
Sbjct: 344 SQGISQWPVYDK--GFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFF 401

Query: 491 AVCFER 496
              FE+
Sbjct: 402 IAVFEK 407

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/310 (21%), Positives = 108/310 (34%), Gaps = 79/310 (25%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +    +  +P   + A +
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALH--MENAEPTGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSK------------NIQVTVGDFTKAATPDKFKDVTGFIVDP 329
            D  R+ +L   +K    +              I+++VGD  KA    KF  +   + D 
Sbjct: 203 SDYRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGD-NKAKDALKFDRI---LCDV 258

Query: 330 SCSGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLS 388
            CSG G   RK V                                N  +D  T+    L 
Sbjct: 259 PCSGDGTM-RKNV--------------------------------NVWKDWNTQAGLGLH 285

Query: 389 SFQFQVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV-------- 439
           + Q+ ++   +    T  ++VYSTCS++  ENE           ++ WG K+        
Sbjct: 286 TIQYNILNRGLHLLKTGGRLVYSTCSLNPIENE-----AVVARALRTWGSKIKIINCDDK 340

Query: 440 ---AAKESVIPTWP---------RRGKIEEFEEVFRDDPAKCQAL-ADGCIRALPRDDGG 486
                + + +  WP          +G     E  F     +  A     C+R  P     
Sbjct: 341 LPGLIRSNGVTQWPVFDRNMESKNKGDEGTLESWFPPTDEEVTAFNLQNCMRVYPHQQNT 400

Query: 487 IGFFAVCFER 496
            GFF    E+
Sbjct: 401 GGFFITVIEK 410

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 110/309 (35%), Gaps = 77/309 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +  D   ++P   + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDT--DEPSGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKA---ATPDKFKDVTGF---IVDPSCS 332
            D  R+ +L   +K    S N+ V   D   F +       +K  D+  F   + D  CS
Sbjct: 203 ADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCS 261

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLSSFQ 391
           G G   RK V                                N  +D  T+    L + Q
Sbjct: 262 GDGTM-RKNV--------------------------------NVWKDWNTQAGLGLHTVQ 288

Query: 392 FQVIKHAMSFPTAK-KIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV----------- 439
             ++   +    +  ++VYSTCS++  ENE           +++WG K+           
Sbjct: 289 LNILNRGLHLLKSNGRLVYSTCSLNPIENE-----AVIAEALRKWGDKIRLVNCDDKLTG 343

Query: 440 AAKESVIPTWP------------RRGKIEEFEEVFRDDPAKCQALADGCIRALPRDDGGI 487
             +   +  WP              G +E F     ++ +K       C+R  P      
Sbjct: 344 LIRSKGVSKWPVYDRNLTEKNKGDEGTLESFFPPSEEEASKFN--LKNCMRVYPHQQNTG 401

Query: 488 GFFAVCFER 496
           GFF   FE+
Sbjct: 402 GFFISVFEK 410

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/306 (21%), Positives = 111/306 (36%), Gaps = 71/306 (23%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L    +  ++D CAAPG+KT  +   +  +  +++P   + A +
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTN--EDEPTGIVVAND 201

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKAATPDKFKDVTGF------IVDPSCS 332
            D  R+ +L   +K    S N+ V   D   F + A  +   D   F      + D  CS
Sbjct: 202 ADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCS 260

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQF 392
           G G   +    ++N  R+                       +  +  L      L + Q 
Sbjct: 261 GDGTMRK----NVNVWRD-----------------------WTSQGGL-----GLHNIQL 288

Query: 393 QVIKHAMSFPTAK-KIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKVAAK--ESVIPTW 449
            ++   +     K ++VYSTCS++  ENE         + +++WG K+     +  +P  
Sbjct: 289 NILNRGLHLLKPKGRLVYSTCSMNPIENE-----AVIAAALRKWGSKIRVINCDEKLPGL 343

Query: 450 PRRGKIEEFEEVFRD-------------------DPAKCQALADGCIRALPRDDGGIGFF 490
            R   I+ +    RD                   +  K Q     CIR  P       FF
Sbjct: 344 VRSKGIDSWPVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFF 403

Query: 491 AVCFER 496
               E+
Sbjct: 404 ITVIEK 409

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 67/309 (21%), Positives = 107/309 (34%), Gaps = 77/309 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +  D   ++P   + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDT--DEPSGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKA---ATPDKFKDVTGF---IVDPSCS 332
            D  R+ +L   +K    S N+ V   D   F +           DV  F   + D  CS
Sbjct: 203 ADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCS 261

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLSSFQ 391
           G G   RK V                                N  +D  T+    L + Q
Sbjct: 262 GDGTM-RKNV--------------------------------NVWKDWNTQAGLGLHTVQ 288

Query: 392 FQVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV----------- 439
             ++   +       ++VYSTCS++  ENE           +++WG K+           
Sbjct: 289 LNILNRGLHLLKNNGRLVYSTCSLNPIENE-----AVVAEALRKWGDKIRLVNCDDKLPG 343

Query: 440 AAKESVIPTWP------------RRGKIEEFEEVFRDDPAKCQALADGCIRALPRDDGGI 487
             +   +  WP              G +E F     ++ ++       C+R  P      
Sbjct: 344 LIRSKGVSKWPVYDRNLTEKTKGDEGTLESFFSPSEEEASRFN--LQNCMRVYPHQQNTG 401

Query: 488 GFFAVCFER 496
           GFF   FE+
Sbjct: 402 GFFITVFEK 410

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 67/309 (21%), Positives = 108/309 (34%), Gaps = 77/309 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +  D   ++P   + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDT--DEPSGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKA---ATPDKFKDVTGF---IVDPSCS 332
            D  R+ +L   +K    S N+ V   D   F +       +   DV  F   + D  CS
Sbjct: 203 ADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCS 261

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLSSFQ 391
           G G   RK V                                N  +D  T+    L + Q
Sbjct: 262 GDGTM-RKNV--------------------------------NVWKDWNTQAGLGLHAVQ 288

Query: 392 FQVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV----------- 439
             ++   +       ++VYSTCS++  ENE           +++WG K+           
Sbjct: 289 LNILNRGLHLLKNNGRLVYSTCSLNPIENE-----AVVAEALRKWGDKIRLVNCDDKLPG 343

Query: 440 AAKESVIPTWP------------RRGKIEEFEEVFRDDPAKCQALADGCIRALPRDDGGI 487
             +   +  WP              G ++ F     ++ +K       C+R  P      
Sbjct: 344 LIRSKGVSKWPVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFN--LQNCMRVYPHQQNTG 401

Query: 488 GFFAVCFER 496
           GFF   FE+
Sbjct: 402 GFFITVFEK 410

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 69/309 (22%), Positives = 109/309 (35%), Gaps = 77/309 (24%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +  D+ +  P   + A +
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRDSNE--PTGFVVAND 196

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKAATPDKFKDVTGF------IVDPSCS 332
            D  RA +L   +K    S N+ V   D   F K        + +G       + D  CS
Sbjct: 197 SDSRRAYMLVHQLKRLN-SANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPCS 255

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLSSFQ 391
           G G   RK V                                N  +D  T+ A  L + Q
Sbjct: 256 GDGTM-RKNV--------------------------------NVWKDWNTQNALGLHNVQ 282

Query: 392 FQVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV----------- 439
             ++   +       ++VYSTCS++  ENE         + +++WG K+           
Sbjct: 283 LNILNRGLQLLKDNGRLVYSTCSLNPIENE-----AVVAAALRKWGNKIKLVDCQNKLQG 337

Query: 440 AAKESVIPTWPRRGKIEEFEEVFRD------------DPAKCQALADGCIRALPRDDGGI 487
             + + I  W    +  E   + +D            D  K     + C+R  P      
Sbjct: 338 LVRSNGISHWSVYDR--EMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTG 395

Query: 488 GFFAVCFER 496
           GFF   FE+
Sbjct: 396 GFFIAVFEK 404

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 87/229 (37%), Gaps = 52/229 (22%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KTT +   +  D   ++P   + A +
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDT--DEPTGFVVAND 200

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD------FTKAATPDKFKDVTGF---IVDPSCS 332
            D  R+ +L   +K    S N+ V   D         +  P K K    F   + D  CS
Sbjct: 201 ADSRRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCS 259

Query: 333 GSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLA-KLSSFQ 391
           G G   RK V                                N  +D  T+ A  L + Q
Sbjct: 260 GDGTM-RKNV--------------------------------NVWKDWNTQGALGLHTVQ 286

Query: 392 FQVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV 439
             ++   +       ++VYSTCS++  ENE           +++WG KV
Sbjct: 287 LNILDRGLHLLQNNGRLVYSTCSMNPIENE-----AVVAEALRRWGDKV 330

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 89/229 (38%), Gaps = 51/229 (22%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L+      ++D CAAPG+KT  +   +   A+ ++P   + A +
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALH--AESDEPSGFVIAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGDF----------TKAATPDKFKDVTGFIVDPSC 331
            D +R+ +L   +K    S N+ V   D           T+ +   +F      + D  C
Sbjct: 203 ADYKRSHMLVHQLKRLN-SANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPC 261

Query: 332 SGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQ 391
           SG G   RK V+                              +N    L      L   Q
Sbjct: 262 SGDGTM-RKNVNVW--------------------------KDWNTGSGL-----GLHIVQ 289

Query: 392 FQVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKV 439
             +++  ++      K+VYSTCS++  ENE         + +++WG KV
Sbjct: 290 LNILERGLNLLKEGGKLVYSTCSLNPIENE-----AVIAAALRRWGDKV 333

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/307 (20%), Positives = 107/307 (34%), Gaps = 72/307 (23%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L+      ++D CAAPG+KT  +   +  D  +  P   + A +
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPE--PSGFVVAND 196

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGDF----------TKAATPDKFKDVTGFIVDPSC 331
            D +R+ +L   +K    S N+ V   D            K     ++      + D  C
Sbjct: 197 SDSKRSHMLVHQLKRLN-SANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPC 255

Query: 332 SGSGIFGRKYVDSLNRQRNNXXXXXXXXXXXXXXXXXXXXXXYNKKEDLKTRLAKLSSFQ 391
           SG G   RK V+                              +N +  L      L + Q
Sbjct: 256 SGDGTI-RKNVN--------------------------IWKDWNTQNSL-----GLHNVQ 283

Query: 392 FQVIKHAMS-FPTAKKIVYSTCSIHAEENERXXXXXXXXSKVKQWGWKVAAKE--SVIPT 448
             ++   +    +  ++VYSTCS+   ENE         + +++WG K+   +   ++P 
Sbjct: 284 LNILNRGIQLLKSGGRLVYSTCSLSPIENE-----AVISATLRKWGNKIKLVDCKEMLPG 338

Query: 449 WPRRGKIEEFEEVFRD----------------DPAKCQA---LADGCIRALPRDDGGIGF 489
                 I ++E   R                  P + +A       CIR  P      GF
Sbjct: 339 LISSPGISKWEVYDRTMSIVSKGAEKSKDTWFQPTEEEANDFNLSHCIRVFPHQQNTGGF 398

Query: 490 FAVCFER 496
           F    E+
Sbjct: 399 FIAVLEK 405

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 10/128 (7%)

Query: 222 GKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFE 281
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   +   A +++P   + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALH--ATEDEPTGFVVAND 202

Query: 282 KDPERAKILEKMIKVAGCSKNIQVTVGD---FTKAAT---PDKFKDVTGFIVDPSCSGSG 335
            D  R+ +L   +K    S N+ V   D   F +       ++F      + D  CSG G
Sbjct: 203 ADARRSHMLVHQLKRLN-SANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDG 261

Query: 336 IFGRKYVD 343
              RK V+
Sbjct: 262 TM-RKNVN 268

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 43/104 (41%), Gaps = 21/104 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQED 272
           I  + L  QG   I D+A   P+        DI+++     GN TT +           +
Sbjct: 38  ILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTTRIL----------E 76

Query: 273 PHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATP 316
              ++ A E DP  A  L K +      K +++ +GDFTK   P
Sbjct: 77  KARKVVAVEFDPRMAAELTKRVHGTAAEKKLEIILGDFTKTELP 120

>Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 42/104 (40%), Gaps = 21/104 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQED 272
           I  + L  QG   I D+A   P+        D++++     GN T  +       AK   
Sbjct: 38  ILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRI----LEQAKN-- 80

Query: 273 PHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATP 316
               + A E DP  A  L K ++     K +++ +GDF K   P
Sbjct: 81  ----VVAVEMDPRMAAELTKRVRGTPVEKKLEILLGDFMKTELP 120

>Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 42/104 (40%), Gaps = 21/104 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQED 272
           I  + L  QG   I D+A   P+        D++++     GN T  +       AK   
Sbjct: 38  ILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRI----LEQAKN-- 80

Query: 273 PHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATP 316
               + A E DP  A  L K ++     K +++ +GDF K   P
Sbjct: 81  ----VVAVEMDPRMAAELTKRVRGTPVEKKLEIMLGDFMKTELP 120

>Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}
           YPL266W (REAL)
          Length = 318

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 42/104 (40%), Gaps = 21/104 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQED 272
           I  + L  QG   I D+A   P+        D++++     GN T  +       AK   
Sbjct: 38  ILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRI----LEQAKS-- 80

Query: 273 PHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATP 316
               + A E DP  A  L K ++     K +++ +GDF K   P
Sbjct: 81  ----VVAVEMDPRMAAELTKRVRGTQVEKKLEIMLGDFMKTELP 120

>YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essential
           18S rRNA dimethylase (dimethyladenosine transferase),
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'-terminal loop of 18S rRNA, part of 90S and 40S
           pre-particles in nucleolus, involved in pre-ribosomal
           RNA processing
          Length = 318

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 42/104 (40%), Gaps = 21/104 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQED 272
           I  + L  QG   I D+A   P+        D++++     GN T  +       AK   
Sbjct: 38  ILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRI----LEQAKN-- 80

Query: 273 PHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATP 316
               + A E DP  A  L K ++     K +++ +GDF K   P
Sbjct: 81  ----VVAVEMDPRMAAELTKRVRGTPVEKKLEIMLGDFMKTELP 120

>Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON}
           complement(42834..43793) [960 nt, 320 aa]
          Length = 319

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 42/104 (40%), Gaps = 21/104 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQED 272
           I  + L  QG   I D+A+  P+        DI+++     GN T  +           +
Sbjct: 39  ILKNPLVAQG---IVDKANIKPS--------DIVLEVGPGTGNLTVRIL----------E 77

Query: 273 PHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATP 316
              ++ A E DP  A  L K +      K +++ +GDF K   P
Sbjct: 78  QARKVVAVEMDPRMAAELTKRVHGTPAEKKLEIMLGDFMKTELP 121

>SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 322

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 41/104 (39%), Gaps = 21/104 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQED 272
           I  + L  QG   I D+A   P+        D++++     GN T  +           +
Sbjct: 39  ILKNPLVAQG---IVDKAQIKPS--------DVVLEVGPGTGNLTVRIL----------E 77

Query: 273 PHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATP 316
              ++ A E DP  A  L K +      K +++ +GDF K   P
Sbjct: 78  QARRVVAVEMDPRMAAELTKRVHGTAAEKKLEILLGDFMKTELP 121

>CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266w DIM1
          Length = 317

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 41/104 (39%), Gaps = 21/104 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQED 272
           I  + L  QG   I D+A   P+        DI+++     GN T  +           +
Sbjct: 38  ILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTVRIL----------E 76

Query: 273 PHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATP 316
              ++ A E DP  A  L K +      K +++ +GDF K   P
Sbjct: 77  QARKVVAVEMDPRMAAELTKRVHGTPAEKKLEIMLGDFMKTELP 120

>KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1
           YPL266W
          Length = 317

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 41/104 (39%), Gaps = 21/104 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQED 272
           I  + L  QG   I D+A   P+        DI+++     GN T  +       AK+  
Sbjct: 38  ILKNPLVAQG---IVDKAHIKPS--------DIVLEVGPGTGNLTVRI----LEKAKK-- 80

Query: 273 PHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATP 316
               + A E DP  A  L K +      K + + +GDF K   P
Sbjct: 81  ----VVAVEMDPRMAAELTKRVHGTPAEKKLDIMLGDFMKTELP 120

>ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 319

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 41/104 (39%), Gaps = 21/104 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQED 272
           I  + L  QG   I D+A   P+        D +++     GN T  +   +        
Sbjct: 39  ILKNPLVAQG---IVDKAQLRPS--------DTVLEVGPGTGNLTVRILEQV-------- 79

Query: 273 PHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATP 316
              + YA E DP  A  L K ++     + +++ +GDF K   P
Sbjct: 80  --RKAYAVEMDPRMAAELTKRVRGTDGERKLEILLGDFIKTDLP 121

>NCAS0D02250 Chr4 (419581..420540) [960 bp, 319 aa] {ON} Anc_6.1
           YPL266W
          Length = 319

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 41/104 (39%), Gaps = 21/104 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQED 272
           I  + L  QG   I D+A   P+        DI+++     GN T  +           +
Sbjct: 39  ILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTVRIL----------E 77

Query: 273 PHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATP 316
              ++ A E DP  A  L K +      K +++ +GDF K   P
Sbjct: 78  QARKVVAVEMDPRMAAELTKRVHGTPSEKKLEILLGDFMKTDLP 121

>ACR026W Chr3 (404011..404970) [960 bp, 319 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL266W (DIM1)
          Length = 319

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 41/104 (39%), Gaps = 21/104 (20%)

Query: 213 ITSHELYKQGKIIIQDRASCFPAHILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQED 272
           I  + L  QG   I D+A   P+        DI+++     GN T  +           +
Sbjct: 38  ILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTVRIL----------E 76

Query: 273 PHVQIYAFEKDPERAKILEKMIKVAGCSKNIQVTVGDFTKAATP 316
              ++ A E DP  A  L K +      K +++ +GDF K   P
Sbjct: 77  QARKVVAVEFDPRMAAELTKRVHGTPAEKKLEIMLGDFMKTELP 120

>TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5.370
           YHR080C
          Length = 1708

 Score = 31.6 bits (70), Expect = 6.5,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 7/49 (14%)

Query: 197 YDEYIPHLYGIHPQDKIT-------SHELYKQGKIIIQDRASCFPAHIL 238
           +  +  ++ GI P +K+        S ++ +QGK+ I DR  CF A+IL
Sbjct: 826 FHSFFKNINGISPDEKLIIDITCALSRDILQQGKMYITDRNICFNANIL 874

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,956,788
Number of extensions: 2142231
Number of successful extensions: 4652
Number of sequences better than 10.0: 79
Number of HSP's gapped: 4614
Number of HSP's successfully gapped: 96
Length of query: 496
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 382
Effective length of database: 40,409,475
Effective search space: 15436419450
Effective search space used: 15436419450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)