Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G006502.285ON68968936230.0
NCAS0G038002.285ON72667831080.0
YNL021W (HDA1)2.285ON70666729410.0
Smik_14.3102.285ON70668829390.0
ZYRO0A01870g2.285ON70766929370.0
Skud_14.3082.285ON70666729350.0
Suva_14.3262.285ON70666729310.0
CAGL0J03454g2.285ON69368128960.0
TDEL0G021602.285ON71466728790.0
KNAG0H020102.285ON69366928670.0
SAKL0E07700g2.285ON71268128550.0
KAFR0H033202.285ON70270228260.0
KLTH0G10340g2.285ON70866928150.0
Kwal_27.115372.285ON70866927960.0
Ecym_33242.285ON70668027410.0
KLLA0E08383g2.285ON70467327000.0
Kpol_1039.322.285ON65965626880.0
ADL216C2.285ON70569326450.0
TPHA0C033902.285ON70166725670.0
TBLA0B069502.285ON79546120340.0
Kpol_1003.372.285ON57832413660.0
NDAI0B027108.153ON4533233613e-36
KAFR0C029208.153ON4533573614e-36
SAKL0H25124g8.153ON4483333596e-36
TPHA0H003208.153ON4503583571e-35
TDEL0B045808.153ON4463563552e-35
KLTH0E06446g8.153ON4493523562e-35
NCAS0B054808.153ON4513563543e-35
Skud_7.798.153ON4523223525e-35
YGL194C (HOS2)8.153ON4523233491e-34
CAGL0A03322g8.153ON4503593491e-34
Smik_7.798.153ON4523233473e-34
TBLA0D021408.153ON4563313463e-34
Kpol_246.58.153ON4533563455e-34
AFR172C8.153ON4493263438e-34
ZYRO0G19316g8.153ON4483283438e-34
Kwal_55.207908.153ON4493253411e-33
Suva_7.718.153ON4523283402e-33
KNAG0G013508.153ON4513283392e-33
KLLA0F09119g8.153ON4523263376e-33
KLTH0F19668g3.8ON4323383322e-32
Ecym_23468.153ON4853303323e-32
Kwal_55.221423.8ON4323393285e-32
NCAS0C043203.8ON4343243261e-31
TBLA0I005603.8ON4333243261e-31
AGR395W3.8ON4333233251e-31
Kpol_1038.113.8ON4333233251e-31
Ecym_20103.8ON4333233251e-31
ZYRO0C03498g3.8ON4333463251e-31
SAKL0C13706g3.8ON4333233242e-31
NDAI0G037403.8ON4333233242e-31
KNAG0A011603.8ON4333243232e-31
Suva_14.113.8ON4333243233e-31
Skud_14.113.8ON4333243223e-31
CAGL0B01441g3.8ON4333233215e-31
KLLA0E01981g3.8ON4323783206e-31
KAFR0A086303.8ON4333243199e-31
Smik_14.23.8ON4333243162e-30
YNL330C (RPD3)3.8ON4333243153e-30
TPHA0A003003.8ON4333243153e-30
TDEL0A002703.8ON4333233126e-30
Suva_16.3963.362ON4771771876e-14
ADL339W3.362ON4372571831e-13
TBLA0B023903.362ON5791761851e-13
Skud_16.3533.362ON4711771832e-13
TDEL0C050403.362ON4541771822e-13
KLTH0F10582g3.362ON4742221813e-13
Kwal_23.37243.362ON4732731805e-13
NDAI0A051203.362ON5082391795e-13
NCAS0A111803.362ON4902051796e-13
YPR068C (HOS1)3.362ON4702161778e-13
CAGL0D01430g3.362ON4452771761e-12
Smik_16.3093.362ON4701771761e-12
KAFR0H008903.362ON4742081761e-12
Kpol_376.153.362ON5181771725e-12
SAKL0B07854g3.362ON4891771708e-12
ADL265W8.607ON6942931691e-11
TPHA0M015903.362ON4942881672e-11
KNAG0H006303.362ON4562311662e-11
ZYRO0C16390g3.362ON4362281652e-11
TDEL0A055208.607ON6743231663e-11
KLLA0B09394g3.362ON4411741618e-11
Ecym_82908.607ON7093311611e-10
KAFR0H027908.607ON7171171611e-10
Kpol_479.68.607ON6883341602e-10
Ecym_34653.362ON4452351555e-10
TBLA0E040808.607ON6942371557e-10
Smik_6.3158.607ON6971351512e-09
KLLA0F00858g8.607ON715651503e-09
Suva_16.1948.607ON6991351493e-09
SAKL0H08338g8.607ON6901371475e-09
KLTH0D09592g8.607ON7051381476e-09
TPHA0A011208.607ON698991476e-09
NDAI0E024808.607ON684991467e-09
YPL116W (HOS3)8.607ON6971351451e-08
NCAS0C017608.607ON7001381451e-08
Skud_16.1648.607ON697991432e-08
ZYRO0F10780g8.607ON6681371413e-08
Kwal_26.85058.607ON708581395e-08
KNAG0J013008.607ON6771061378e-08
CAGL0J06974g8.607ON6781381352e-07
KNAG0L004507.71ON45239742.4
AFR493C4.133ON32495714.9
Skud_15.4917.71ON45648715.5
YDR285W (ZIP1)5.296ON87549716.4
CAGL0I01210g5.419ON55160707.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00650
         (689 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1400   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1201   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1137   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1136   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1135   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1135   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1133   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1120   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1113   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1108   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1104   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1093   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1088   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1081   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1060   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1044   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...  1040   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1023   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   993   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   788   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   530   0.0  
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    143   3e-36
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   143   4e-36
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   142   6e-36
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   142   1e-35
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   141   2e-35
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   141   2e-35
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   140   3e-35
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   140   5e-35
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   139   1e-34
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   139   1e-34
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   138   3e-34
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   137   3e-34
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   137   5e-34
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   136   8e-34
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   136   8e-34
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   135   1e-33
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   135   2e-33
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   135   2e-33
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   134   6e-33
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   132   2e-32
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   132   3e-32
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   130   5e-32
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      130   1e-31
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   130   1e-31
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   129   1e-31
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   129   1e-31
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   129   1e-31
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   129   1e-31
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   129   2e-31
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   129   2e-31
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   129   2e-31
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   129   3e-31
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   128   3e-31
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   128   5e-31
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   127   6e-31
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   127   9e-31
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   126   2e-30
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   125   3e-30
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   125   3e-30
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   124   6e-30
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    77   6e-14
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    75   1e-13
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    76   1e-13
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    75   2e-13
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    75   2e-13
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    74   3e-13
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    74   5e-13
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    74   5e-13
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    74   6e-13
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    73   8e-13
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    72   1e-12
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    72   1e-12
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    72   1e-12
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    71   5e-12
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    70   8e-12
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    70   1e-11
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    69   2e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    69   2e-11
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    68   2e-11
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    69   3e-11
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    67   8e-11
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    67   1e-10
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    67   1e-10
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    66   2e-10
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    64   5e-10
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    64   7e-10
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    63   2e-09
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    62   3e-09
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    62   3e-09
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    61   5e-09
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    61   6e-09
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    61   6e-09
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    61   7e-09
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    60   1e-08
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    60   1e-08
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    60   2e-08
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    59   3e-08
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    58   5e-08
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    57   8e-08
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    57   2e-07
KNAG0L00450 Chr12 (67282..68640) [1359 bp, 452 aa] {ON} Anc_7.71...    33   2.4  
AFR493C Chr6 complement(1325927..1326901) [975 bp, 324 aa] {ON} ...    32   4.9  
Skud_15.491 Chr15 complement(861268..862638) [1371 bp, 456 aa] {...    32   5.5  
YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}  ZIP1Tran...    32   6.4  
CAGL0I01210g Chr9 (99925..101580) [1656 bp, 551 aa] {ON} weakly ...    32   7.7  

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1400 bits (3623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/689 (97%), Positives = 675/689 (97%)

Query: 1   MNGGETTSNNDTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYF 60
           MNGGETTSNNDTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYF
Sbjct: 1   MNGGETTSNNDTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYF 60

Query: 61  EYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSK 120
           EYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSK
Sbjct: 61  EYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSK 120

Query: 121 EHLDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNAL 180
           EHLDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNAL
Sbjct: 121 EHLDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNAL 180

Query: 181 AVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFY 240
           AVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFY
Sbjct: 181 AVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFY 240

Query: 241 DDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ 300
           DDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ
Sbjct: 241 DDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ 300

Query: 301 IVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGG 360
           IVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGG
Sbjct: 301 IVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGG 360

Query: 361 YNLDSIAISALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGN 420
           YNLDSIAISALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGN
Sbjct: 361 YNLDSIAISALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGN 420

Query: 421 AGCDFQEQINNSIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIY 480
           AGCDFQEQINNSIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIY
Sbjct: 421 AGCDFQEQINNSIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIY 480

Query: 481 ESNTIIICVHDTPEIWAKRDAIQGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNL 540
           ESNTIIICVHDTPEIWAKRDAIQGT              MIKWAIERKYGVIDINIPQNL
Sbjct: 481 ESNTIIICVHDTPEIWAKRDAIQGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNL 540

Query: 541 LEQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKA 600
           LEQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKA
Sbjct: 541 LEQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKA 600

Query: 601 VINFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDT 660
           VINFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDT
Sbjct: 601 VINFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDT 660

Query: 661 DGISNIMEERFEEATDFILDSFEEWSDSE 689
           DGISNIMEERFEEATDFILDSFEEWSDSE
Sbjct: 661 DGISNIMEERFEEATDFILDSFEEWSDSE 689

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1201 bits (3108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/678 (81%), Positives = 622/678 (91%), Gaps = 1/678 (0%)

Query: 13  IKKRKI-DPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPR 71
           +KK+KI D   R +IVPPRDA++ YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPR
Sbjct: 49  LKKQKITDVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPR 108

Query: 72  RIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSK 131
           RIYRIYKILAENGLIKDPTLSGI+DIGDLMLKIPVR+AT EEILEVHSKEH DFIE TS 
Sbjct: 109 RIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTST 168

Query: 132 MNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAE 191
           MNRE+LLKATE GDSVYFN+DS+ASAKLPVGG+IEACKAVVEGRVKN+LAVVRPPGHHAE
Sbjct: 169 MNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAE 228

Query: 192 PEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLH 251
           P+AAGGFCLFSNVAIAAKNILKNYPESVR+I+ILDWDIHHGNGTQKAFYDDDR+LY+SLH
Sbjct: 229 PQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLH 288

Query: 252 RFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQP 311
           RF++GKYYPGTI+G+YDQTGEGKGEGFNCNITWPVGGVGDAEY+WAFEQ+VMPM REFQP
Sbjct: 289 RFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQP 348

Query: 312 DLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISAL 371
           DLVIIS+GFDAADGD+IGQCHVTPSCYGHMTHMLKSLA+GN+ VVLEGGYNLD+IA SAL
Sbjct: 349 DLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSAL 408

Query: 372 SVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINN 431
           SVAKILIGEPPDELPD  RDPKPE IE+IDKV+R+QSKYWKCFK ++GNAGC+F+++IN 
Sbjct: 409 SVAKILIGEPPDELPDPLRDPKPEAIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINE 468

Query: 432 SIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHD 491
           S+ +KNFPLQ AIR+QQ+  LS++F F+ LP+ K ELP+DT+LCS N+Y+S T+IIC HD
Sbjct: 469 SLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHD 528

Query: 492 TPEIWAKRDAIQGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIIT 551
           TPEIWAKRD IQGT               IKWA E+KYGVIDINIPQNL EQENY +I+T
Sbjct: 529 TPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVT 588

Query: 552 AQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLK 611
           +QEVL  +WDNYLKYFPNV K+AF+GIGDAYSGIVHLLGHRDTRSVVK+VINF+ QKQL+
Sbjct: 589 SQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLR 648

Query: 612 PLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERF 671
            LVPLVDESL +WYFKNSLVFS+K+H YWGDKENKKPRKKYGR+LRC+TDGI+NI+EERF
Sbjct: 649 ALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKKPRKKYGRLLRCETDGINNIVEERF 708

Query: 672 EEATDFILDSFEEWSDSE 689
           EEATDFILDSFEEWSDSE
Sbjct: 709 EEATDFILDSFEEWSDSE 726

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1137 bits (2941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/667 (79%), Positives = 593/667 (88%)

Query: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82
           RQ+IVP    +IHY+PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 40  RQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 99

Query: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142
           NGLI DPTLSG+DD+GDLMLKIPVR ATSEEILEVH+KEHL+FIEST KM+RE+LLK TE
Sbjct: 100 NGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKETE 159

Query: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202
            GDSVYFN+DSYASA+LP GGAIEACKAVVEGRVKN+LAVVRPPGHHAEP+AAGGFCLFS
Sbjct: 160 KGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFS 219

Query: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262
           NVA+AAKNILKNYPESVR+I+ILDWDIHHGNGTQK+FY DD++LYVSLHRF+MGKYYPGT
Sbjct: 220 NVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGT 279

Query: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322
           I G+YDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ+VMPMGREF+PDLVIIS+GFDA
Sbjct: 280 IQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDA 339

Query: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382
           ADGDTIGQCHVTPSCYGHMTHMLKSLARGN+ VVLEGGYNLD+IA SALSVAK+LIGEPP
Sbjct: 340 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPP 399

Query: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442
           DELPD   DPKPEVIEMIDKV+R+QSKYW CF+ +  N+GC+F E IN+SI +KNFPLQ 
Sbjct: 400 DELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQK 459

Query: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502
           AIRQQQ   LS EFNF  LP+   +LP++T+LC+ NI ESNTIII VHDT +IWAKR+ I
Sbjct: 460 AIRQQQQHYLSDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVI 519

Query: 503 QGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562
            GT               IKW ++RKYG+ID+NIP  L E +NY  +IT+QEVLI LWDN
Sbjct: 520 SGTIDLSSSVIIDNSLDFIKWGLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWDN 579

Query: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622
           Y+KYFP+V KIAF+GIGD+YSGIVHLLGHRDTR+V K VINF+G KQLKPLVPLVDE+L 
Sbjct: 580 YIKYFPSVAKIAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLS 639

Query: 623 EWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSF 682
           EWYFKNSL+FSN +H  W + E++KPRKK+GRVLRCDTDG++NI+EERFEEATDFILDSF
Sbjct: 640 EWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSF 699

Query: 683 EEWSDSE 689
           EEWSD E
Sbjct: 700 EEWSDEE 706

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1136 bits (2939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/688 (76%), Positives = 597/688 (86%), Gaps = 11/688 (1%)

Query: 2   NGGETTSNNDTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFE 61
           N   TTSNN            RQ+IVP    +IHY+PLKTGLCYDVRMRYHAKIFTSYFE
Sbjct: 30  NSLSTTSNN-----------KRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFE 78

Query: 62  YIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKE 121
           YIDPHPEDPRRIYRIYKILAENGLI DPTLSG+DD+GDLMLKIPVR ATSEEILEVH+KE
Sbjct: 79  YIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKE 138

Query: 122 HLDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALA 181
           HL+FIEST KM+REQLLK TE GDSVYFN+DSYASA+LP GGAIEACKAVVEGRVKN+LA
Sbjct: 139 HLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLA 198

Query: 182 VVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYD 241
           VVRPPGHHAEP+AAGGFCLFSNVA+AAKNILKNYPESVR+I+ILDWDIHHGNGTQK+FY 
Sbjct: 199 VVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQ 258

Query: 242 DDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQI 301
           DD++LYVSLHRF+MGKYYPGTI G+YDQ GEGKGEGFNCNITWPVGGVGDAEYMWAFEQ+
Sbjct: 259 DDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQV 318

Query: 302 VMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGY 361
           VMPMGREF+PDLVIIS+GFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGN+ VVLEGGY
Sbjct: 319 VMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGY 378

Query: 362 NLDSIAISALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNA 421
           NLD+IA SALSVAK+LIGEPPDELPD + DPKPEVIEMIDKV+R+QSKYW CF+ +  N+
Sbjct: 379 NLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANS 438

Query: 422 GCDFQEQINNSIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYE 481
           GC+F E IN+SI +KNFPLQ AIRQQQ   LS EFN   LP+   +LP++T+LC+ N+YE
Sbjct: 439 GCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTPNVYE 498

Query: 482 SNTIIICVHDTPEIWAKRDAIQGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLL 541
           S T+++ VHDT +IWAKR+ I GT               IKW ++RKYG+ID+NIP +L 
Sbjct: 499 STTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIPLSLF 558

Query: 542 EQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAV 601
           E +NY  +IT+QEVLI LWDNY+KYFP V KIAFVGIGD+YSGIVHLLGHRDTR+V K V
Sbjct: 559 EPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTRAVTKTV 618

Query: 602 INFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTD 661
           INF+G KQLKPLVPLVDE+L EWYFKNSL+FSN +H  W + E++KPRKK+GRVLRCDTD
Sbjct: 619 INFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTD 678

Query: 662 GISNIMEERFEEATDFILDSFEEWSDSE 689
           G++N +EERFEEATDFILDSFEEWSD E
Sbjct: 679 GLNNTIEERFEEATDFILDSFEEWSDEE 706

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1135 bits (2937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/669 (78%), Positives = 603/669 (90%), Gaps = 1/669 (0%)

Query: 21  ESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKIL 80
           + RQIIVP  + +IHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKIL
Sbjct: 40  QKRQIIVPACEPKIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKIL 99

Query: 81  AENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKA 140
           AENGLI DPTLSG DDIG+LMLKIPVREAT EE+L+VH+KEHL+FIE TS+MNRE+LLK 
Sbjct: 100 AENGLINDPTLSGEDDIGELMLKIPVREATVEELLQVHTKEHLEFIEKTSQMNREELLKE 159

Query: 141 TESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCL 200
           TE+GDSVYFNSDSY++AKLP GGAIEACKAVVEGRVKNALAV+RPPGHHAEPE AGGFCL
Sbjct: 160 TETGDSVYFNSDSYSAAKLPCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEMAGGFCL 219

Query: 201 FSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYP 260
           FSNVA+AA+NILKNYPESVR+ILILDWDIHHGNGTQKAFY+DDR+LY+SLHRF++GKYYP
Sbjct: 220 FSNVAVAAQNILKNYPESVRRILILDWDIHHGNGTQKAFYNDDRVLYISLHRFELGKYYP 279

Query: 261 GTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGF 320
           GTIHG+YDQTGEGKGEGFNCNITWPVGGVGDAEYM AFEQIVMPM RE++PDLVIIS+GF
Sbjct: 280 GTIHGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREYRPDLVIISSGF 339

Query: 321 DAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGE 380
           DAADGDTIGQCHV+PSCYGHMTHMLKSLARGN+ V LEGGYNLD+IA SALSVAKILIGE
Sbjct: 340 DAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVALEGGYNLDAIATSALSVAKILIGE 399

Query: 381 PPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPL 440
           PP+ELPD +++PK E IEMIDKV+ +QSKYWKCF+ + GN+GC+F+E +  S+ TKNFPL
Sbjct: 400 PPEELPDPSKNPKLEAIEMIDKVIHVQSKYWKCFR-RLGNSGCNFKEPVTESLITKNFPL 458

Query: 441 QSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRD 500
           Q AIRQ+Q   L KE+ F  LP+ K ELPEDT+LCS ++++ +T+II VHDTPEIWAKRD
Sbjct: 459 QKAIRQEQFHQLEKEYGFVTLPVPKLELPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRD 518

Query: 501 AIQGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLW 560
            I G                IKW++ RKYGVID+NIPQ+L EQ+NY ++IT+QEVLI LW
Sbjct: 519 VITGMIDPSTSITVDSPLDFIKWSLARKYGVIDVNIPQSLFEQDNYSAMITSQEVLIYLW 578

Query: 561 DNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDES 620
           DN++KYFP+++K+AFVG+GDAYSGIVHLLGHRDTRSVVKAVINFVG+KQLKPLVPLVDES
Sbjct: 579 DNFVKYFPSLSKVAFVGVGDAYSGIVHLLGHRDTRSVVKAVINFVGRKQLKPLVPLVDES 638

Query: 621 LGEWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILD 680
           LG+WYFKNSLVFS++N+  W D ENKKPR+K+GRVLRC++DGI+N MEERF+EATDFILD
Sbjct: 639 LGDWYFKNSLVFSDRNNPCWVDNENKKPRRKFGRVLRCESDGINNNMEERFDEATDFILD 698

Query: 681 SFEEWSDSE 689
           SFEEWSDSE
Sbjct: 699 SFEEWSDSE 707

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1135 bits (2935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/667 (78%), Positives = 592/667 (88%)

Query: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82
           RQ+IVP    +IHY+PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 40  RQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 99

Query: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142
           NGLI DPTLSG+DDIGDLMLKIPVR ATSEEILEVH+KEHL+FIEST KM+REQLLK TE
Sbjct: 100 NGLINDPTLSGVDDIGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETE 159

Query: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202
            GDSVYFN+DSYASA+LP GGAIEACKAVVEGRVKN+LAVVRPPGHHAEP+AAGGFCLFS
Sbjct: 160 KGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFS 219

Query: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262
           NVA+AAKNILKNYPESVR+I+ILDWDIHHGNGTQK+FY DD++LYVSLHRF+MGKYYPGT
Sbjct: 220 NVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGT 279

Query: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322
           I G+YDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ+VMPMGREF+PDLVIIS+GFDA
Sbjct: 280 IQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDA 339

Query: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382
           ADGDTIGQCHV+PSCYGHMTHMLKSLARGN+ VVLEGGYNLD+IA SALSVAK+LIGEPP
Sbjct: 340 ADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPP 399

Query: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442
           DELPD   DPKPEVIEMIDKV+R+QSKYW CF+ +  N+GC+F E IN+SI +KNFPLQ 
Sbjct: 400 DELPDSLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQK 459

Query: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502
           AIRQQQ++ LS EF+F  LP+    LP++T LC+ N++ESN +++ VHDT ++WAKR+ I
Sbjct: 460 AIRQQQLQYLSNEFSFVTLPLINMGLPDNTALCTPNVFESNALLVVVHDTSDVWAKRNVI 519

Query: 503 QGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562
            GT               IKW ++RKYG+ID+NIP  L E +NY  +IT+QEVLI LWDN
Sbjct: 520 SGTIDLSSSVIIDNCIDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDN 579

Query: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622
           Y+KYFPNV KIAF+GIGD++SGIVHLLGHRDTR+V K VINF+G KQLKPLVPLVDE+L 
Sbjct: 580 YIKYFPNVAKIAFIGIGDSHSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLS 639

Query: 623 EWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSF 682
           EWYFKNSL+FSN +H  W + E++KPRKK+GRVLRCDTDG+SN +EERFEEATDFILDSF
Sbjct: 640 EWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSF 699

Query: 683 EEWSDSE 689
           EEWSD E
Sbjct: 700 EEWSDDE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1133 bits (2931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/667 (77%), Positives = 592/667 (88%)

Query: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82
           RQ+IVP    ++HYTPL+TGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 40  RQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 99

Query: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142
           NGLI DPTLSG+DD+GDLMLKIPVR ATSEEILEVH+KEHL+FIEST KM+REQLLK TE
Sbjct: 100 NGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETE 159

Query: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202
            GDSVYFN+DSYASA+LP GGAIEACKAVVEGRVKN+LAVVRPPGHHAEP+AAGGFCLFS
Sbjct: 160 KGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFS 219

Query: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262
           NVA+AAKNILKNYPESVR+I+ILDWDIHHGNGTQK+FY DD++LY+SLHRF++GKYYPGT
Sbjct: 220 NVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGT 279

Query: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322
           I G+YDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ+VMPMGREF+PDLVIIS+GFDA
Sbjct: 280 IQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDA 339

Query: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382
           ADGDTIGQCHVTPSCYGHMTHMLKSLARGN+ VVLEGGYNLD+IAISALSVAK+LIGEPP
Sbjct: 340 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGEPP 399

Query: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442
           DELPD   DPKPEVIEMIDKV+R+QSKYW CF+ +  N+GC+F E IN+SI +KNFPLQ 
Sbjct: 400 DELPDPLSDPKPEVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQK 459

Query: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502
           AIRQQQ+  LS EFNF  LP+   ELP++ +LC+ N+ ES+T+++ VHDT ++WAKR+ I
Sbjct: 460 AIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVI 519

Query: 503 QGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562
            GT               IKW ++RKYG+ID+NIP  L E +NY  +IT+QEVLI LWDN
Sbjct: 520 SGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDN 579

Query: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622
           Y+KYFP V KIA++GIGD+YSGIVHLLGHRDTR+V K VINF+G KQLKPLVPLVDE+L 
Sbjct: 580 YIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLT 639

Query: 623 EWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSF 682
           EWYFKNSLVF+N +H  W + E++KPRKK+GRVLRCDTDG+SN +EERFEEATDFILDSF
Sbjct: 640 EWYFKNSLVFTNNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSF 699

Query: 683 EEWSDSE 689
           EEWSD E
Sbjct: 700 EEWSDEE 706

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1120 bits (2896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/681 (74%), Positives = 599/681 (87%), Gaps = 6/681 (0%)

Query: 15  KRKIDPE------SRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPE 68
           KRK++ +       R +IVP R AQIHYTPLKTG+CYDVRMRYHAKIFTSYFEYIDPHPE
Sbjct: 13  KRKLEDDVASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPE 72

Query: 69  DPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIES 128
           DPRRIYRIYKILAENGLI DPTLSG++DIGDLMLKIP+R AT+EEILEVHSKEHL+FIE 
Sbjct: 73  DPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEK 132

Query: 129 TSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGH 188
           T KMNRE+LLK TE GDSVYFN+DSYA+++LP GGAIEACKAVVEGRVKN+LAVVRPPGH
Sbjct: 133 TEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGH 192

Query: 189 HAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYV 248
           HAEPEAAGGFCLFSNVA+AAKNILKNYPESVR+ILILDWD+HHGNGTQKAFYDDDR+LY+
Sbjct: 193 HAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYI 252

Query: 249 SLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGRE 308
           SLHRF++GKYYPGTI G+YDQ GEGKG+GFNCNITWPVGGVGDAEYMWAFEQ+VMPMGRE
Sbjct: 253 SLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGRE 312

Query: 309 FQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAI 368
           FQPDLVIIS+GFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGN+ VVLEGGYNLD+IAI
Sbjct: 313 FQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAI 372

Query: 369 SALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQ 428
           SALSVAKILIGEPPDELPD  R+PK E +E+IDKV+ +QSKYWKCF  ++GN G   +  
Sbjct: 373 SALSVAKILIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENV 432

Query: 429 INNSIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIIC 488
           +   + +K+FPLQ+AIRQ+Q   LS++F F  LP+   E+P+D+++CS N++   TI++ 
Sbjct: 433 VKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVV 492

Query: 489 VHDTPEIWAKRDAIQGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYS 548
           VHDTPEIWAKR+ I GT               IKW +ERKYG++DINIPQ+L EQENY +
Sbjct: 493 VHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTA 552

Query: 549 IITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQK 608
           ++T+QE+LI +WDNYLK+FP++ K+AF+GIGDA +GIVHLLGHRDTRSVVK+V++F+G+K
Sbjct: 553 VLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKK 612

Query: 609 QLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIME 668
            LKPLVPLV+ESLG+WYFKNSLVF++ +H  WGD EN+KPRKK+GRVLRCD +G++NI+E
Sbjct: 613 SLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIE 672

Query: 669 ERFEEATDFILDSFEEWSDSE 689
           ER EE+TDFILDSFEEWSDSE
Sbjct: 673 ERLEESTDFILDSFEEWSDSE 693

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1113 bits (2879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/667 (76%), Positives = 586/667 (87%)

Query: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82
           +++IVP     +HYTPLKT LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAE
Sbjct: 48  KRVIVPACAPNLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAE 107

Query: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142
           NGLI DPTLSGID+IGDLMLKIPVREAT EEILEVHSKE+L+F+E +S+M RE+LLK TE
Sbjct: 108 NGLINDPTLSGIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETE 167

Query: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202
            GDSVYFN+DSY SAKL  GG I+ACKAVVEGRVKNALAVVRPPGHHAEPEA GGFCLFS
Sbjct: 168 KGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFS 227

Query: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262
           NVA+AA+NILK YPESVR+ILILDWDIHHGNGTQKAFY+D R+LY+SLHRF+MGKYYPGT
Sbjct: 228 NVAVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGT 287

Query: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322
           I+GRYDQTGEGKGEGFNCNITWPVGGVGDAEYM AFEQIVMPM REFQPDLVIIS+GFDA
Sbjct: 288 INGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDA 347

Query: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382
           ADGDTIGQCHVTPSCYG MTHMLKSLARGN+ V LEGGYNLD+IAISALSVAK+LIGEPP
Sbjct: 348 ADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPP 407

Query: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442
           DELPD T+DPK E IEMID V+  QSKYWKCF+ KFGNAGC+F E +  ++ +K+FPLQ+
Sbjct: 408 DELPDPTKDPKLEAIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQT 467

Query: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502
           AIRQ+Q R LSKE+ F  LPI K E+P+D++LCS  +++ +TI+I VHDTPEIWAKRD I
Sbjct: 468 AIRQEQFRQLSKEYGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVI 527

Query: 503 QGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562
            G                 KW + RKYGVID+NIPQ+L EQ+NY ++IT+QEVL+ +WDN
Sbjct: 528 TGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDN 587

Query: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622
           Y+KYFP++ K+AFVG GDAY+GIVHLLGHRDTR+ VKAV++F+G+KQLKPLVPLVDESL 
Sbjct: 588 YIKYFPSLAKVAFVGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLS 647

Query: 623 EWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSF 682
           +WYFKNSL+F++KNH  W D E+KKPRKK+GRVLRCDTDG+++ MEERFEEATDFILD F
Sbjct: 648 DWYFKNSLIFTDKNHPCWADNESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLF 707

Query: 683 EEWSDSE 689
           EEWSDSE
Sbjct: 708 EEWSDSE 714

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1108 bits (2867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/669 (75%), Positives = 592/669 (88%), Gaps = 2/669 (0%)

Query: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82
           RQ+IV P   ++ YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 25  RQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 84

Query: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142
           NGLI DP LSGIDDIGDLMLKIPVREATS+E+LEVHSKEHL+FIES +KM+ ++LLK+TE
Sbjct: 85  NGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKSTE 144

Query: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202
           +GDSVYFN+DS +SAKL  GGAIEACKAVVEGRVKNA AVVRPPGHH+EPE+AGGFCLFS
Sbjct: 145 TGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFS 204

Query: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262
           NVA+A+KNIL+NYPESVR+I+ILDWDIHHGNGTQKAFYDDDR+LY+SLHRF++GKYYPGT
Sbjct: 205 NVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGT 264

Query: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322
             G YD+TGEGKGEGFNCNITWPVGGVGDAEYMWAFEQ+VMPM REF+PDLVIISAGFDA
Sbjct: 265 AQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDA 324

Query: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382
           ADGDTIGQCHV+PSCYGHMTHMLKSLA GN+ VVLEGGYNLD+IA SALSVAK+LIGEPP
Sbjct: 325 ADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEPP 384

Query: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442
           +EL D  +DPKPE IE+I+KV+R+QSKYWKCF+ + GN+GC F++ +  SI+T NFPLQS
Sbjct: 385 EELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQS 444

Query: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502
           AIRQQQ   LSKEF F + P+++ +L +DT++CS  +Y  +TIII V DTPEIWAKRD I
Sbjct: 445 AIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVI 504

Query: 503 QGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562
           QGT               IKWA+ER YGVID+NIPQ+L EQ+NY ++ITAQEV+  +WDN
Sbjct: 505 QGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDN 564

Query: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622
           Y+++F + +KIAFVG+GDA SGIVHLLGHRDTRS VK+VINF+ QK LKPL+PLVDE+LG
Sbjct: 565 YIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLG 624

Query: 623 EWYFKNSLVFSNKNHIYWGD--KENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILD 680
           +WYFKNSLVFS+KNH  WGD   ENKKPRKK+GRVLRC++DG++NI+EERFEEATDF+LD
Sbjct: 625 DWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLD 684

Query: 681 SFEEWSDSE 689
           SFEEWS+S+
Sbjct: 685 SFEEWSESD 693

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1104 bits (2855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/681 (74%), Positives = 591/681 (86%), Gaps = 2/681 (0%)

Query: 11  DTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDP 70
           D ++ RK    +  +IVP    +IHYT LKTGLCYDVRMRYHAKI+TSYFEYIDPHPEDP
Sbjct: 32  DEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDP 91

Query: 71  RRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTS 130
           RRIYRIYKILAENGLI+DPTLSG+D+IG+LMLKIPVREAT+EEIL+VH+KEHL F+E T 
Sbjct: 92  RRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTP 151

Query: 131 KMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHA 190
           KM REQLLK TE+GDSVYFN+DS  SAKL  GGAIEACKAVVEGRVKNALAV+RPPGHHA
Sbjct: 152 KMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHA 211

Query: 191 EPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSL 250
           EPE AGGFCLFSNVA+AA+NILKNYPESVR+I+ILDWDIHHGNGTQKAFY D+R+LYVSL
Sbjct: 212 EPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSL 271

Query: 251 HRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQ 310
           HR+++GKYYPGT+HG Y+QTGEGKGEGFNCNI WP GG+GDAEYMWAF+Q+VMPMGREFQ
Sbjct: 272 HRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQ 331

Query: 311 PDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISA 370
           PDLVIIS+GFDAADGDTIGQCHV+PSCYGHMTHMLKSLARGN+ VVLEGGYNLDSIA SA
Sbjct: 332 PDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSA 391

Query: 371 LSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQIN 430
           L VAKILIGEPPDELP  T+ PKPE IE I+ V+R QSKYW CFKS   N GC+F+E++ 
Sbjct: 392 LGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVT 451

Query: 431 NSIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVH 490
            S  +KNFPLQ AIRQ+Q++ LS++F F  LP+   E+P+DT++CS NIY++ T+++CVH
Sbjct: 452 ESTISKNFPLQQAIRQEQLQQLSEKFGFVTLPLLNMEVPQDTVICSPNIYDAETVVVCVH 511

Query: 491 DTPEIWAKRDAIQGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSII 550
           DTPEIWA+R+ I GT              +IKW+++RKY VID+NIPQ+L EQ+NY ++I
Sbjct: 512 DTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMI 571

Query: 551 TAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQL 610
           T+QEVL+ +WDNYLKYFP++ K+AF+G+GDAYSGIVHLLGHRDTRSVVKA ++FV  K L
Sbjct: 572 TSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPL 631

Query: 611 KPLVPLVDESLGEWYFKNSLVFSNKNHIYWGD--KENKKPRKKYGRVLRCDTDGISNIME 668
           K LVPLVDESLG WYFKNSLVF++KNH  WG    ENKKPRK++GRVL+CDT G++NI+E
Sbjct: 632 KSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVE 691

Query: 669 ERFEEATDFILDSFEEWSDSE 689
           ERF+EATDFILDSFEEWSDSE
Sbjct: 692 ERFQEATDFILDSFEEWSDSE 712

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1093 bits (2826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/702 (73%), Positives = 590/702 (84%), Gaps = 13/702 (1%)

Query: 1   MNGGETTSNNDTIKKRKIDPES---------RQIIVPPRDAQIHYTPLKTGLCYDVRMRY 51
           M    T+S  +   KRK + E+         RQ+IVP +  Q+HY PLKTGLCYDVRMRY
Sbjct: 1   MQSNMTSSAMEGSTKRKQEEENLESLNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRY 60

Query: 52  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATS 111
           HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI D  LSG+DDIGD+MLKIPVREAT+
Sbjct: 61  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATA 120

Query: 112 EEILEVHSKEHLDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAV 171
           +EILEVHS+EHL+F+EST+ MNRE LLK TE GDSVYFN+DSY SAKL  GGAIEACKAV
Sbjct: 121 DEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAV 180

Query: 172 VEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHH 231
           VEG+VKNALAVVRPPGHH+EPE++GGFCLFSNVA+AAKNILKNYPESVRKI+ILDWDIHH
Sbjct: 181 VEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHH 240

Query: 232 GNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGD 291
           GNGTQKAFY D+R+LYVSLHRF+ GKYYPGT+ G+YDQ GEGKGEGFNCNITWP GGVGD
Sbjct: 241 GNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGD 300

Query: 292 AEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARG 351
           AEYMWAFEQIVMPMGREFQPDLVIIS+GFDAADGD IGQCHVTPSCYGHMTHMLKSLARG
Sbjct: 301 AEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARG 360

Query: 352 NMAVVLEGGYNLDSIAISALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYW 411
           N+ VVLEGGYNLDSIAISALSVAK LIGEPPDELPD  +DPKPE +EMI KV++IQSKYW
Sbjct: 361 NLVVVLEGGYNLDSIAISALSVAKTLIGEPPDELPDPLKDPKPEALEMIYKVIKIQSKYW 420

Query: 412 KCFKSKFGNAGCDFQEQINNSIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPED 471
           KCFK + GN   +F E  ++++ATK FPLQ+AIRQQQ  NL KE++F + P    +LP+D
Sbjct: 421 KCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDD 480

Query: 472 TILCSSNIYESNTIIICVHDTPEIWAKRDAIQGTXXXXXXXXXXXXXXMIKWAIERKYGV 531
            ILCS NI+ + T+II VHDTP+IW ++D I  T               +KWA  RKYG+
Sbjct: 481 LILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGI 540

Query: 532 IDINIPQNLL----EQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVH 587
           ID+NIPQ+L+      +NY S+I AQE+L+ LWDN++K+   VNKIAF+G+GD+ SG+VH
Sbjct: 541 IDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVH 600

Query: 588 LLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKK 647
           LLGHRDT+  VKAVINF+  KQLKPLVPLVDESL +WYFKNSLVFSN+ H  WGDKENKK
Sbjct: 601 LLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKK 660

Query: 648 PRKKYGRVLRCDTDGISNIMEERFEEATDFILDSFEEWSDSE 689
           PRKKYGRVLRCDTDG+++ +EERF+EATDFILDSFEEWSDSE
Sbjct: 661 PRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1088 bits (2815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/669 (74%), Positives = 579/669 (86%), Gaps = 3/669 (0%)

Query: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82
           R  IVP    ++HYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 41  RPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 100

Query: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142
           NGLI DPTLSG+D IGDLMLKIPVREAT EEIL+VH+KEHL+FI  T+ M R+QLLK TE
Sbjct: 101 NGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETE 160

Query: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202
            GDSVYFN+DSY SAKL  GGAIEACKAVVEGRVKNALAVVRPPGHHAEPE AGGFCLFS
Sbjct: 161 KGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFS 220

Query: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262
           NVA+AA+NILKNYPESVRKI++LDWD+HHGNGTQKAFYDDDR+LY+SLHR ++GKYYPGT
Sbjct: 221 NVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGT 280

Query: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322
           IHG  D+ GEGKGEGFNCNI WP  GVGD+EY+WAFEQ++MPMGREF+PDLVIIS+GFDA
Sbjct: 281 IHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDA 340

Query: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382
           ADGDT+GQCHVTPSCYGHMTHMLKSLARGN+  VLEGGY+LDSIA SAL+VAK+LIGEPP
Sbjct: 341 ADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPP 400

Query: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442
           DELP V + PK E +E+ID V++ QSKYWKCFKS  GN GC F+EQ  ++   KNFPLQ+
Sbjct: 401 DELP-VVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQN 459

Query: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502
           AIRQQQ+R L+ EF F  LP++K ELP+DT +CS NIY+++ II+CVHDTP IWA+R   
Sbjct: 460 AIRQQQMRLLANEFRFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRA 519

Query: 503 QGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562
            GT              +IKWA  R YGVIDINIPQ+L EQ+NY ++ITAQEVL+++WDN
Sbjct: 520 TGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDN 579

Query: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622
           YLKYFP++N++AFV IGDA+SG+VHLLGHRDTRSVVK+ ++FV Q+ L+PL+PLVDE+L 
Sbjct: 580 YLKYFPSLNRVAFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLA 639

Query: 623 EWYFKNSLVFSNKNHIYWGD--KENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILD 680
           +WYFKNSLVF++  H  WG+   ENKKPRKK+GRVL+CD+DGI+NI+EERFEEATDFILD
Sbjct: 640 DWYFKNSLVFASAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILD 699

Query: 681 SFEEWSDSE 689
           +FEEWSDSE
Sbjct: 700 TFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1081 bits (2796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/669 (74%), Positives = 580/669 (86%), Gaps = 3/669 (0%)

Query: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82
           R +IVP   A++HYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 41  RPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 100

Query: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142
           NGLI DPTLSG+DDIGDLMLKIP REAT EEIL+VH+ EHL+F+  T+ M REQLLK TE
Sbjct: 101 NGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETE 160

Query: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202
            GDSVYFN+DSY SAKL  GGAIEAC+AVVEGRVKNALAVVRPPGHHAEP+ AGGFCLFS
Sbjct: 161 KGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFS 220

Query: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262
           NVA+AA+NILKNYPESV+KI+ILDWD+HHGNGTQKAFY+DDR+LYVSLHR ++GKYYPGT
Sbjct: 221 NVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGT 280

Query: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322
           IHG  D+ GEGKGEGFNCNI WP  GVGDAEY+WAFEQ+V+PMGREFQPDLVIIS+GFDA
Sbjct: 281 IHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDA 340

Query: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382
           ADGDT+GQCHVTPSCYGHMTHMLKSLARGN+  VLEGGY+LDSIA SAL VAK+LIGEPP
Sbjct: 341 ADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPP 400

Query: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442
           DELP V + PKPE +E+ID V+++QS+YW+CFKS   N GC F+E +  ++  +NFPLQ+
Sbjct: 401 DELP-VVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQT 459

Query: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502
           AIRQQQVR L+ E+NF  LP+ K ELP+DT LCS NIY+S +II+CVHDTPEIWA+R   
Sbjct: 460 AIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRA 519

Query: 503 QGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562
            GT              +IKWA +R YGVIDINIPQ+L EQ+NY +++TAQEVL+ +WD+
Sbjct: 520 TGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDS 579

Query: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622
           YLKYF +++K+AFV IGDAYSG+VHLLGHRDTR+VVKA I+F+ Q+ L+PLVPLVDESL 
Sbjct: 580 YLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLA 639

Query: 623 EWYFKNSLVFSNKNHIYWGD--KENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILD 680
           +WYFKNSLVF++  H  WG+   ENKKPRKK+GRVL+C++DG++NI+EERFEEATDFILD
Sbjct: 640 DWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILD 699

Query: 681 SFEEWSDSE 689
           +FEEWSDSE
Sbjct: 700 TFEEWSDSE 708

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1060 bits (2741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/680 (71%), Positives = 580/680 (85%), Gaps = 2/680 (0%)

Query: 12  TIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPR 71
            + K  +  + R IIVP    +IHY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPR
Sbjct: 27  AVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPR 86

Query: 72  RIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSK 131
           RIYRIYKILAENGLI+DPTLSG+DDIG+LMLKIP+REAT +EIL VHSKEH++F+++T+ 
Sbjct: 87  RIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNT 146

Query: 132 MNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAE 191
           M+REQLLK TE+GDSVY+N+DS  SAKL  GGAIEACKAVVEGRVKNALAVVRPPGHHAE
Sbjct: 147 MSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAE 206

Query: 192 PEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLH 251
           PE AGGFCLFSNVA+AA+NILKNYPESVRK++ILDWDIHHGNGTQ+AFY+D+R+LYVSLH
Sbjct: 207 PEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLH 266

Query: 252 RFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQP 311
           R+++G+YYPGT +G Y+Q+GEGKGEGFNCNI W  GGVGDAEYMWAFEQIV+PMGREFQP
Sbjct: 267 RYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQP 326

Query: 312 DLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISAL 371
           DLVIIS+GFDAADGDTIGQCHV+P+CYGHMTHMLKSLA+GNM VVLEGGYNLDSIA SAL
Sbjct: 327 DLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSAL 386

Query: 372 SVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINN 431
            V K+LIGEPPDELPD  + PKPE I  I+ V+R Q+KYW CFKSK GN G +++E ++ 
Sbjct: 387 GVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDE 446

Query: 432 SIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHD 491
           S+  KNFPLQSA+RQ+Q R LSKE+ F  LP+   EL  DTI+CS NI+E++T+IICVHD
Sbjct: 447 SLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHD 506

Query: 492 TPEIWAKRDAIQGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIIT 551
           TPE+WAKR+ + G               +  WA+ R YG+IDINIPQ+L E +NY +++T
Sbjct: 507 TPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELDNYSAVLT 566

Query: 552 AQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLK 611
           +QEVL  LWD+YLK+F  + ++AFVGIGDAYSG VHLLGHRDTRS+VK  I+F  +KQL+
Sbjct: 567 SQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLR 626

Query: 612 PLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKEN--KKPRKKYGRVLRCDTDGISNIMEE 669
           PLVPLVDES+ +WYFKNSL+F++K H  WG + N  KKPRKK+GRVL+C++DG++NI+EE
Sbjct: 627 PLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEE 686

Query: 670 RFEEATDFILDSFEEWSDSE 689
           RFEEATDFILDSFEEWSDSE
Sbjct: 687 RFEEATDFILDSFEEWSDSE 706

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1044 bits (2700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/673 (70%), Positives = 564/673 (83%), Gaps = 2/673 (0%)

Query: 19  DPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYK 78
           D   R +IVPP   +I Y+ LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YK
Sbjct: 32  DESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYK 91

Query: 79  ILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLL 138
           ILAENGLI+DPTLSG D IGDLM+K+PVREA  EEIL+VHS++HLDFI  T ++ RE LL
Sbjct: 92  ILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLL 151

Query: 139 KATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGF 198
           K TE GDSVYFN+DSY SAKL  GGAIEACKAVVEGRVKN++AVVRPPGHHAEPE AGGF
Sbjct: 152 KETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGF 211

Query: 199 CLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKY 258
           CLFSNVA+AA N+LK+YPESVRKI+I+DWDIHHGNGTQKAFYDDDR+LYVSLHR+++GKY
Sbjct: 212 CLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKY 271

Query: 259 YPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISA 318
           YPGTIHG YDQTGEGKGEGFNCNITWP GGVGDAEYMWAFEQ++MPMGREF+PDLV+IS+
Sbjct: 272 YPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISS 331

Query: 319 GFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILI 378
           GFDAADGDTIGQCHVTP+CYGHMTHML SLA+GN+ VVLEGGYNLDSIA SAL V K+L+
Sbjct: 332 GFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLV 391

Query: 379 GEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNF 438
           GEPPDELP   + P PE  +MI+ V+R QSKYW CFK++ GN G +F++ I +++ T+NF
Sbjct: 392 GEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNF 451

Query: 439 PLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAK 498
           PLQ+AIR+ QV  LS +FNF +LPI    LP +T+LC+S I +S T+++ VHDTPEIW++
Sbjct: 452 PLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSE 511

Query: 499 RDAIQGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLIN 558
           RD   G               MI WA++R+YG+IDINIPQ L E  NY  + ++QE+LI 
Sbjct: 512 RDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIY 571

Query: 559 LWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVD 618
           LWDNYLK+F N+ K+AF+GIGDAY GIVHLLGHRDTRSVVK  I+F+ +K LK +VPL+D
Sbjct: 572 LWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLID 631

Query: 619 ESLGEWYFKNSLVFSNKNHIYWGD--KENKKPRKKYGRVLRCDTDGISNIMEERFEEATD 676
           E+LG+WYFKNSLVF++  H  WG    ENKK RKKYGRVL+ D DG++NI +ERFEEATD
Sbjct: 632 ETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEATD 691

Query: 677 FILDSFEEWSDSE 689
           FILDSFEEWS+SE
Sbjct: 692 FILDSFEEWSESE 704

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score = 1040 bits (2688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/656 (71%), Positives = 565/656 (86%)

Query: 32  AQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTL 91
           + + YTPLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI+DP L
Sbjct: 3   SSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPAL 62

Query: 92  SGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATESGDSVYFNS 151
           SGIDDIGDLM KIPVREATSEEILEVH KE L+++E T  +NR++LL  TE GDSVYFN+
Sbjct: 63  SGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNN 122

Query: 152 DSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNI 211
           DSY SAKL  GGAIEACKA+V+G+VKN+LA+VRPPGHH+EPE AGGFCLFSNVA+A KNI
Sbjct: 123 DSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNI 182

Query: 212 LKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTG 271
           LKNYP+ V+K++I+DWDIHHGNGTQKAFY+DDR+LYVSLHRF++GKYYPGTIHG+YDQ G
Sbjct: 183 LKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVG 242

Query: 272 EGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQC 331
           EGKGEGFNCNI W VGG+GDAEY+WAFEQIVMPMGREF+PDLVI+S+GFDAADGDTIG+C
Sbjct: 243 EGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKC 302

Query: 332 HVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPPDELPDVTRD 391
           HVTPSCYGHMTHMLKSLA G + VVLEGGYNLD+IA SAL+VAK+LIGEPPDELP   +D
Sbjct: 303 HVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKD 362

Query: 392 PKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQSAIRQQQVRN 451
           PKPE IEMID+V+ ++SKYWKCFK +  N+ C+++  I+ S   K FP+Q AIR QQ++ 
Sbjct: 363 PKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQY 422

Query: 452 LSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAIQGTXXXXXX 511
           L+ ++N   LP+  S LPEDT++CS++I +SN  II VHDTPEIW+KRDAI G       
Sbjct: 423 LTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSAS 482

Query: 512 XXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDNYLKYFPNVN 571
                      WA++R YG+ID+NIPQ L EQ+NY + +TAQEVLI LWDN LKYFPNVN
Sbjct: 483 LYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVN 542

Query: 572 KIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLGEWYFKNSLV 631
           KIA++G+G+AYSG+VHLLGHRDTRSVVK+VI FVG+K LK LVPLV+ESL +WYFK SL+
Sbjct: 543 KIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLL 602

Query: 632 FSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSFEEWSD 687
           F++KNH  WG+ ++KKPRK+YGRVLRCD+DGI +++EERFEEATDFI+DS +EW++
Sbjct: 603 FADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1023 bits (2645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/693 (69%), Positives = 571/693 (82%), Gaps = 13/693 (1%)

Query: 2   NGGETTSNNDTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFE 61
           NGG+ +        RK   + R +IVPP   +I Y PLKTGLCYDVRMRYHAKIFTSYFE
Sbjct: 21  NGGQAS--------RKAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRMRYHAKIFTSYFE 72

Query: 62  YIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKE 121
           YIDPHPEDPRRIYRIYKILAENGLI+DPTLSGID+IG+LM KIPVREAT EEIL VHSKE
Sbjct: 73  YIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREATEEEILTVHSKE 132

Query: 122 HLDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALA 181
           H++F+++T+ M+REQLLK TE+GDSVY+N+DS  SA+L  GGAIEACKAVVEGRVKNA+A
Sbjct: 133 HVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKNAMA 192

Query: 182 VVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYD 241
           VVRPPGHHAEP  AGGFCLFSNVA+AA+NILKNYPESVR+++ILDWDIHHGNGTQKAFY 
Sbjct: 193 VVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYG 252

Query: 242 DDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQI 301
           D+R+LYVSLHR+++GKYYPGT +G YDQ G+GKGEGFNCNI W   GVGDAEYMWAFEQ+
Sbjct: 253 DNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQV 312

Query: 302 VMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGY 361
           V+PMGREFQPDLVIIS+GFDAADGDTIGQCHV+P+CYGH+THMLKSLARGNM VVLEGGY
Sbjct: 313 VIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVLEGGY 372

Query: 362 NLDSIAISALSVAKILIGEPPDELPDVTRDPKPEVIEMIDK-VLRIQSKYWKCFKSKFGN 420
           NLDSIA SAL VAK+LIGEPPDELP   + PKPE I  ID  +++ QSKYW CFK + GN
Sbjct: 373 NLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQSKYWNCFKGRHGN 432

Query: 421 AGCDFQE-QINNSIATKNFPLQSAIR-QQQVRNLSKEFNFSELPIYKSELPEDTILCSSN 478
            G +++E  +N+S+ +KNFPLQ       Q R L+KE+ F  LP+   ELP DTI+CS N
Sbjct: 433 DGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNMELPSDTIICSPN 492

Query: 479 IYESNTIIICVHDTPEIWAKRDAIQGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQ 538
           I+ ++ IIICVHDTPEIWA+RD++ G               +I WA+ R YGVIDINIPQ
Sbjct: 493 IHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGRNYGVIDINIPQ 552

Query: 539 NLLEQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVV 598
           +L EQ+NY +++++QEV+  LWD+YLK FP++ ++AFVGIGDAYSG VHLLGHRDTRSVV
Sbjct: 553 SLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVHLLGHRDTRSVV 612

Query: 599 KAVINFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKEN--KKPRKKYGRVL 656
           K  I F  +KQL+PLVPLVDESLG+WYFKNSLVF++  H  WG   N  KKPRKK+GRVL
Sbjct: 613 KCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKPRKKFGRVL 672

Query: 657 RCDTDGISNIMEERFEEATDFILDSFEEWSDSE 689
           R   DG++NI+EER EEATDFILDSFEEWS+SE
Sbjct: 673 RWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  993 bits (2567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/667 (68%), Positives = 553/667 (82%), Gaps = 2/667 (0%)

Query: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82
           R +IVP +   +HYTPLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 35  RPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 94

Query: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142
           NGLI DP+L+G+ DIGDLMLKIPVREAT EEIL+VH++EH+ F+EST KM RE+LL  TE
Sbjct: 95  NGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTE 154

Query: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202
            GDSVY N+DSY SA+L  GGAIEACKAVVEGRVKNALA+VRPPGHHAEP+AAGGFCLFS
Sbjct: 155 KGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFS 214

Query: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262
           NV++AAK+ILK YPESVRKILI+DWDIHHGNGTQKAFY+DD +LY+SLHRF++GK+YPG 
Sbjct: 215 NVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGF 274

Query: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322
             G YD+ G+GKG+GFNCNITWPV GVGD EY+WAFEQIV+PM REF+PDLVI+S+GFDA
Sbjct: 275 PEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDA 334

Query: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382
           A GDTIGQCHVTP+CYG+MTHMLKSLARGN+ VVLEGGYNLDSI+ SAL+VAKILIGEPP
Sbjct: 335 AHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPP 394

Query: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442
           DE+P+  RDPKP V+EMI+KV+R+QSKYWKCF+ KFGN G +++  I + I  K FPLQ 
Sbjct: 395 DEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAIESQIP-KMFPLQD 453

Query: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502
           AIR  Q+ +   +F    L +    LP+++I+CSSN +++ ++ + +HDTPE+W  RD I
Sbjct: 454 AIRNAQLSHYYDDFGMISLSLPNLNLPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDII 513

Query: 503 QGTXXXXXXXXXXXXXXMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562
            G                I WAIER+  VIDINIP++  E +NY S + +Q+V+I+LWDN
Sbjct: 514 TGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDN 573

Query: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622
           + KY  ++ K+ F+GIG+A SGIVHLLG RDTR+V KA INFVG   LKP+VP +DESLG
Sbjct: 574 HFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLG 633

Query: 623 EWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSF 682
           +WYFKNSLVF++  H  W + + KKPRKKYGRVLRCDTDGI NI+EERFEEATDFILD+F
Sbjct: 634 DWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAF 692

Query: 683 EEWSDSE 689
           +EWSD+E
Sbjct: 693 DEWSDTE 699

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/461 (78%), Positives = 410/461 (88%), Gaps = 1/461 (0%)

Query: 3   GGETTSNNDTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEY 62
           G +  S N+ + K   + + +QIIVP +  +IHY PLKTGLCYDVRMRYHAKIFTSYFEY
Sbjct: 22  GTKNVSTNNILNKNPPNYK-KQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEY 80

Query: 63  IDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEH 122
           IDPHPEDPRRIYRIYKILAENGLI DPTLSG+D+IGDLMLK+P+REAT  EILEVHS EH
Sbjct: 81  IDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEH 140

Query: 123 LDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAV 182
             ++E TS  NREQLLK TE+GDSVYFN+DS+ SAKL  GGAIEACKAVVEGRVKNA+AV
Sbjct: 141 FKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAV 200

Query: 183 VRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDD 242
           VRPPGHH+EPE+AGGFCLFSNVA+A KNILKNYPESVRK+LILDWDIHHGNGTQKAFY+D
Sbjct: 201 VRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYND 260

Query: 243 DRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIV 302
           D +LY+SLHRF++GKYYPGTI G+YDQTGEGKGEGFNCNITWP+G VGDAEYMWAFEQ+V
Sbjct: 261 DNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVV 320

Query: 303 MPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYN 362
           MPM REFQPDLVIIS+GFDAADGDTIGQCHV+PSCYGHMTHMLKSLARGN+ VVLEGGYN
Sbjct: 321 MPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYN 380

Query: 363 LDSIAISALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAG 422
           LD+IA SALSV+KILIGEPPDELPD  +DPKPEVIEMIDK++R+QSKYWKCF+ + GN G
Sbjct: 381 LDAIARSALSVSKILIGEPPDELPDPLKDPKPEVIEMIDKIIRLQSKYWKCFRRRHGNLG 440

Query: 423 CDFQEQINNSIATKNFPLQSAIRQQQVRNLSKEFNFSELPI 463
           C+F+E IN+S+ +KNFPLQ+AIR  Q + L  E NF  LPI
Sbjct: 441 CNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPI 481

 Score =  316 bits (810), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 175/224 (78%)

Query: 466 SELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAIQGTXXXXXXXXXXXXXXMIKWAI 525
           S L E+TILCS  I  S T+++ VHD+P++W KRD   G                IKW++
Sbjct: 572 SPLNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSL 631

Query: 526 ERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGI 585
           +R YGVIDINIPQ L EQ+NY SI+ AQE L++ WDNYLKYFP + KI F+G GDA++GI
Sbjct: 632 DRNYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGI 691

Query: 586 VHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKEN 645
           VHLLGHRDTRSVVK+VINF+G+K LK LVPLVDE+L +WYFKNSLVF++KNH +W D EN
Sbjct: 692 VHLLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNEN 751

Query: 646 KKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSFEEWSDSE 689
           KKPRKK+GRVLR   DGI+N++EERF+EATDFILDSFEEWSD E
Sbjct: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/324 (75%), Positives = 281/324 (86%), Gaps = 9/324 (2%)

Query: 1   MNGGETT-----SNNDTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKI 55
           +NGG+ T     S ND  KK       RQ+IVP R  ++HYTPLKTGLCYDVRMRYHAKI
Sbjct: 30  VNGGKETIMNGNSKNDHFKKMP----KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKI 85

Query: 56  FTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEIL 115
           FTS FEYIDPHPEDPRR+YRIYKILAENGLIKD  LSG+DDIGD+MLKIPVR AT EEIL
Sbjct: 86  FTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEIL 145

Query: 116 EVHSKEHLDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGR 175
            VH++EHLDFIE+    +RE+L+K TE  DSVY+N+DSY SAKL  GG IEAC+AVVEGR
Sbjct: 146 AVHTREHLDFIENIESQSREELIKLTEKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGR 205

Query: 176 VKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGT 235
           VKN+LA+VRPPGHHAEP+AAGGFCLFSNV++AA++IL+ YPESVRKILILDWDIHHGNGT
Sbjct: 206 VKNSLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGT 265

Query: 236 QKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYM 295
           QKAFY+D+ +LY+SLHR++   +YPGTIHGRYDQ GEGKGEGFNCNITWPVGGVGDAEYM
Sbjct: 266 QKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYM 325

Query: 296 WAFEQIVMPMGREFQPDLVIISAG 319
           WAFE +VMP+GREF+PDLVI+S+G
Sbjct: 326 WAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  249 bits (635), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 154/220 (70%)

Query: 470 EDTILCSSNIYESNTIIICVHDTPEIWAKRDAIQGTXXXXXXXXXXXXXXMIKWAIERKY 529
           E  +L S  I+++ T++I VHDTPE+W  RD I G                IKWA +R Y
Sbjct: 357 EKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNY 416

Query: 530 GVIDINIPQNLLEQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLL 589
            ++DINIP++ LE+E + S   A E++++LWDN+L+Y   + KI F+GIG++Y GIVHL+
Sbjct: 417 SILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLI 476

Query: 590 GHRDTRSVVKAVINFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKENKKPR 649
           G RD R + KAVINFVG   LK L    DE++ +WYFKNSLVF+N +H  W + E K+PR
Sbjct: 477 GERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPR 536

Query: 650 KKYGRVLRCDTDGISNIMEERFEEATDFILDSFEEWSDSE 689
           KK+GRVL+ D+DGI +I+ ERF+EATDFILD+FEEWSD E
Sbjct: 537 KKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  143 bits (361), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 97/323 (30%), Positives = 165/323 (51%), Gaps = 30/323 (9%)

Query: 45  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKI 104
           Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M   
Sbjct: 28  YTPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDLY 75

Query: 105 PVREATSEEILEVHSKEHLDFI-----ESTSKMNREQLLKATESGDSVYFNSDSYASAKL 159
             R AT+EE+++ HS+++LDF+     E+ SKM R  L K     D   F  + Y  + L
Sbjct: 76  ETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTLEKFNIGDDCPIF-QNLYDYSTL 134

Query: 160 PVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPES 218
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 135 YTGASLDATRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP-- 190

Query: 219 VRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGF 278
             ++L +D D+HHG+G Q+AFY  DR+  +S H+F  G+++PGT  G YD+TG  KG+ F
Sbjct: 191 --RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDYDETGCAKGKHF 245

Query: 279 NCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCY 338
             N+     G+ D  Y+  F+ I+ P+   ++P +++   G D+   D +G  ++    +
Sbjct: 246 AMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIKGH 304

Query: 339 GHMTHMLKSLARGNMAVVLEGGY 361
           G     +KS     M VV  GGY
Sbjct: 305 GECVKFIKSFGIP-MLVVGGGGY 326

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  143 bits (361), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 104/357 (29%), Positives = 176/357 (49%), Gaps = 37/357 (10%)

Query: 42  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLM 101
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGLHK------------IM 70

Query: 102 LKIPVREATSEEILEVHSKEHLDFIESTS-----KMNREQLLKATESGDSVYFNSDSYAS 156
                REAT EE+ + HS ++LDF+E  S     K+ R  L K     D   F  + Y  
Sbjct: 71  DLYETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIF-ENIYDY 129

Query: 157 AKLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNY 215
           + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 130 STLYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYH 187

Query: 216 PESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKG 275
           P    ++L +D D+HHG+G Q+AFY  DR+  +S H++  G+++PGT  G YD+ G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGG 240

Query: 276 EGFNCNITWPVG-GVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVT 334
           + F  N+  P+  G+ D  Y+  F+ I+ P+   +QP ++I   G D+   D +G  ++ 
Sbjct: 241 KHFAMNV--PLNDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLN 298

Query: 335 PSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAI-----SALSVAKILIGEPPDELP 386
              +G     + S     M VV  GGY   +++      + +    +L  E P+ELP
Sbjct: 299 IKAHGECVKFVSSFGIP-MLVVGGGGYTPRNVSRLWAYETGILNNVLLPKELPEELP 354

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  142 bits (359), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 97/333 (29%), Positives = 166/333 (49%), Gaps = 30/333 (9%)

Query: 36  YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGID 95
           Y P + G  Y   + YH     S + Y   HP  P R+     +++  GL K        
Sbjct: 14  YLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGLHK-------- 65

Query: 96  DIGDLMLKIPVREATSEEILEVHSKEHLDFI-----ESTSKMNREQLLKATESGDSVYFN 150
               +M     REAT +E+LE HS ++++F+     ++ SKM R  L K     D   F 
Sbjct: 66  ----IMDLYETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDDCPIFQ 121

Query: 151 SDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAK 209
              +  + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  
Sbjct: 122 G-IFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDIVLAIL 178

Query: 210 NILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQ 269
           N+L+ +P    ++L +D D+HHG+G Q+AFY  DR+  VS H++  G+++PGT  G +D+
Sbjct: 179 NLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDFDE 231

Query: 270 TGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIG 329
            G  +G+ F  N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G
Sbjct: 232 IGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRLG 290

Query: 330 QCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYN 362
             ++    +G     +KS     M VV  GGY 
Sbjct: 291 CFNLNIRAHGECVKFVKSFGI-PMLVVGGGGYT 322

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  142 bits (357), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 101/358 (28%), Positives = 179/358 (50%), Gaps = 39/358 (10%)

Query: 42  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLS--GIDDIGD 99
           G  Y  R+ YH     S + Y   HP  P R            ++ D  +S  G+ +I D
Sbjct: 22  GSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRF-----------MLTDHLVSSYGLHNIMD 70

Query: 100 LMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT----ESGDSVYFNSDSYA 155
           L      REAT EE+L+ HS+++++F+   S  N  ++ + T      GD      + Y 
Sbjct: 71  LY---ETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQNIYE 127

Query: 156 SAKLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKN 214
             KL  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ 
Sbjct: 128 YCKLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRY 185

Query: 215 YPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGK 274
           +P    ++L +D D+HHG+G Q+AFY  DR+  VS H++  G+++PGT  G YD+ G  +
Sbjct: 186 HP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGCAE 238

Query: 275 GEGFNCNITWPVG-GVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHV 333
           G+ F  N+  P+  G+ D  Y+  F+ ++ P+   F+P  +I   G D+   D +G  ++
Sbjct: 239 GKHFAMNV--PLNDGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNL 296

Query: 334 TPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAI-----SALSVAKILIGEPPDELP 386
               +G     ++S     M VV  GGY   +++      + +    +L  E P+++P
Sbjct: 297 NIKAHGECVKFIRSFGIP-MVVVGGGGYTPRNVSRLYAYETGILNNVLLQSELPEDMP 353

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  141 bits (355), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 106/356 (29%), Positives = 176/356 (49%), Gaps = 35/356 (9%)

Query: 42  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLM 101
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 21  GSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRLLLTDHLVSSYGLHK------------IM 68

Query: 102 LKIPVREATSEEILEVHSKEHLDFI-----ESTSKMNREQLLKATESGDSVYFNSDSYAS 156
                R ATSEEI E H+++++DF+     E+ SKM R  L K     D   F  + +  
Sbjct: 69  DLYETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIF-QNLFNY 127

Query: 157 AKLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNY 215
            KL  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 128 CKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 216 PESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKG 275
           P    ++L +D D+HHG+G Q+AFY  DR+  VS H++  G+++PGT  G +D+ G   G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCANG 238

Query: 276 EGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTP 335
           + F  N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D IG  ++T 
Sbjct: 239 KHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLTI 297

Query: 336 SCYGHMTHMLKSLARGNMAVVLEGGY---NLDSIAISALSVAK--ILIGEPPDELP 386
             +G     ++S     M VV  GGY   N+  +      V    +L  E P+E+P
Sbjct: 298 KGHGECVKFIRSFGIP-MLVVGGGGYTPRNVSRLWAYETGVLNNVLLSKELPEEIP 352

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  141 bits (356), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/352 (27%), Positives = 172/352 (48%), Gaps = 29/352 (8%)

Query: 42  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLM 101
           G  Y+  + YH     S F Y   HP  P R+     +++  GL K            +M
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGLHK------------IM 68

Query: 102 LKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT----ESGDSVYFNSDSYASA 157
                R AT EE+ E H+ ++++F+   S  N  +L + T      GD        Y  +
Sbjct: 69  DLYETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 158 KLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYP 216
            L  G +++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 217 ESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGE 276
               ++L +D D+HHG+G Q+AFY  DR+  VS H++  G+++PGT  G  D+TG  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGCSRGK 239

Query: 277 GFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPS 336
            F  N+     G+ D  Y+  F+ I+ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 337 CYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIG-EPPDELPD 387
            +G     +KS     M V+  GGY   +++        +L G   P E+P+
Sbjct: 299 AHGECVRFVKSFGIP-MLVLGGGGYTPRNVSRLWTYETALLNGVSVPQEIPE 349

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  140 bits (354), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 103/356 (28%), Positives = 176/356 (49%), Gaps = 35/356 (9%)

Query: 42  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLM 101
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGLHK------------IM 70

Query: 102 LKIPVREATSEEILEVHSKEHLDFI-----ESTSKMNREQLLKATESGDSVYFNSDSYAS 156
                REAT EE+ + HS+++++F+     E+ SKM R  L K     D   F  + Y  
Sbjct: 71  DLYETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQ-NIYDY 129

Query: 157 AKLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNY 215
           + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 130 STLYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVNDIVLSILNLLRYH 187

Query: 216 PESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKG 275
           P    ++L +D D+HHG+G Q+AFY  DR+  +S H+F  G+++PGT  G +D+ G  KG
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDFDEIGCAKG 240

Query: 276 EGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTP 335
           + F  N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G  ++  
Sbjct: 241 KHFAMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 336 SCYGHMTHMLKSLARGNMAVVLEGGY---NLDSIAISALSVAK--ILIGEPPDELP 386
             +G     +KS     M VV  GGY   N+  +      V    +L  E P+E+P
Sbjct: 300 KAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLLPSEIPEEIP 354

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  140 bits (352), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 93/322 (28%), Positives = 160/322 (49%), Gaps = 28/322 (8%)

Query: 45  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKI 104
           Y  R+ YH     S++ Y   HP  P R+     +++  GL K            +M   
Sbjct: 24  YSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDLY 71

Query: 105 PVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT----ESGDSVYFNSDSYASAKLP 160
             R AT +E+LE HS+++++F+   S  N  +L + T      GD      + Y    L 
Sbjct: 72  ETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 161 VGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESV 219
            G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 220 RKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFN 279
            +IL +D D+HHG+G Q+AFY  DR+  +S H++  G+++PGT  G   + G  KG+ F 
Sbjct: 187 -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 280 CNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYG 339
            N+     G+ D  Y+  F+ IV P+   F+P L++   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 340 HMTHMLKSLARGNMAVVLEGGY 361
                +KS     M VV  GGY
Sbjct: 302 ECVKFVKSFGLP-MLVVGGGGY 322

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  139 bits (349), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 92/323 (28%), Positives = 160/323 (49%), Gaps = 28/323 (8%)

Query: 44  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLK 103
            Y  R+ YH     S++ Y   HP  P R+     +++  GL K            +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDL 70

Query: 104 IPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT----ESGDSVYFNSDSYASAKL 159
              R AT +E+L+ HS+++++F+   S  N  +L + T      GD      + Y    L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 160 PVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPES 218
             G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 219 VRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGF 278
             +IL +D D+HHG+G Q+AFY  DR+  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 279 NCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCY 338
             N+     G+ D  Y+  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 339 GHMTHMLKSLARGNMAVVLEGGY 361
           G     +KS     M VV  GGY
Sbjct: 301 GECVKFVKSFGLP-MLVVGGGGY 322

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  139 bits (349), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/359 (27%), Positives = 180/359 (50%), Gaps = 30/359 (8%)

Query: 36  YTPL-KTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGI 94
           + PL + G  Y  R+ YH     S++ Y   HP  P R+     +++  GL K       
Sbjct: 14  FQPLYEFGSNYAPRVSYHINPEVSHYHYGVRHPMKPFRLMLTDHLVSGYGLHK------- 66

Query: 95  DDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT----ESGDSVYFN 150
                +M     R+AT+EE+ E HS+++++F+   +  N  +L + T      GD     
Sbjct: 67  -----IMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIF 121

Query: 151 SDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAK 209
            + +  + L  G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ +A  
Sbjct: 122 PNIFQYSSLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAIL 179

Query: 210 NILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQ 269
           N+L+ +P    ++L +D D+HHG+G Q+AFY  DR+  +S H++  G+++PGT  G+ D+
Sbjct: 180 NLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDE 232

Query: 270 TGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIG 329
           TG   G+ F  N+     G+ D  Y+  F+ I+ P+   F+P +++   G D+   D +G
Sbjct: 233 TGCADGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLG 291

Query: 330 QCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGE-PPDELPD 387
             ++    +G     ++S     M VV  GGY   +++        IL     P+ELPD
Sbjct: 292 CFNLNIKAHGECVKFVRSFGIP-MLVVGGGGYTPRNVSRLWTYETGILNNVLLPEELPD 349

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  138 bits (347), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 92/323 (28%), Positives = 160/323 (49%), Gaps = 28/323 (8%)

Query: 44  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLK 103
            Y  R+ YH     S++ Y   HP  P R+     +++  GL K            +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDL 70

Query: 104 IPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT----ESGDSVYFNSDSYASAKL 159
              R AT +E+L+ HS+++++F+   S  N  +L + T      GD      + Y    L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 160 PVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPES 218
             G +++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 219 VRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGF 278
             +IL +D D+HHG+G Q+AFY  DR+  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 279 NCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCY 338
             N+     G+ D  Y+  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 339 GHMTHMLKSLARGNMAVVLEGGY 361
           G     +KS     M VV  GGY
Sbjct: 301 GECVKFVKSFGLP-MLVVGGGGY 322

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  137 bits (346), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 90/331 (27%), Positives = 167/331 (50%), Gaps = 28/331 (8%)

Query: 42  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLM 101
           G  Y  R+ YH     S + +   HP  P R+     +++  GL K            +M
Sbjct: 23  GSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRLMLTDHLVSGYGLHK------------IM 70

Query: 102 LKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT----ESGDSVYFNSDSYASA 157
                R+A+ +E+LE H+ ++++F++  +  N  ++ + T      GD      + Y  +
Sbjct: 71  DLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDCPIFHNLYEYS 130

Query: 158 KLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYP 216
            L  G +++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P
Sbjct: 131 SLYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDIVLSILNLLRFHP 188

Query: 217 ESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGE 276
               ++L +D D+HHG+G Q+AFY  DR+  VS H++  G+++PGT  G YD+TG   G+
Sbjct: 189 ----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNYDETGCSNGK 241

Query: 277 GFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPS 336
            F  N+     G+ D  Y+  F+ I+ P+   + P ++I   G D+   D +G  ++   
Sbjct: 242 HFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGHDRLGCFNLNIK 300

Query: 337 CYGHMTHMLKSLARGNMAVVLEGGYNLDSIA 367
            +G     +KS     M VV  GGY   +++
Sbjct: 301 AHGECVKFVKSFGIP-MLVVGGGGYTPKNVS 330

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  137 bits (345), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 100/356 (28%), Positives = 174/356 (48%), Gaps = 35/356 (9%)

Query: 42  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLM 101
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IM 72

Query: 102 LKIPVREATSEEILEVHSKEHLDFI-----ESTSKMNREQLLKATESGDSVYFNSDSYAS 156
                R AT +E+L+ HS +++ F+     E+ SKM R  L K     D   F  + Y  
Sbjct: 73  DLYETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIF-QNLYDY 131

Query: 157 AKLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNY 215
           + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 132 SALYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYH 189

Query: 216 PESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKG 275
           P    ++L +D D+HHG+G Q+AFY  DR+  +S H++  G+++PGT  G YD+ G  +G
Sbjct: 190 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCAQG 242

Query: 276 EGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTP 335
           + F  N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G  ++  
Sbjct: 243 KHFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLNI 301

Query: 336 SCYGHMTHMLKSLARGNMAVVLEGGY---NLDSIAISALSVAK--ILIGEPPDELP 386
             +G     ++S     M VV  GGY   N+  +      V    +L  E P+++P
Sbjct: 302 KAHGECVKFIRSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLLPAELPEDIP 356

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  136 bits (343), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 162/326 (49%), Gaps = 30/326 (9%)

Query: 42  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLM 101
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGLHK------------VM 68

Query: 102 LKIPVREATSEEILEVHSKEHLDFIESTSKMNREQL----LKATESGDSVYFNSDSYASA 157
                R AT EE+L  H+++++DF+   +  N  +L    L+    GD        +  +
Sbjct: 69  DLYETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQGLFEYS 128

Query: 158 KLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYP 216
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 129 MLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYHP 186

Query: 217 ESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGE 276
               ++L +D D+HHG+G Q+AFY  DR+  VS H++  G+++PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 239

Query: 277 GFNCNITWPVG-GVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTP 335
            F+ N+  P+  G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G  ++  
Sbjct: 240 HFSLNV--PLNDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLNI 297

Query: 336 SCYGHMTHMLKSLARGNMAVVLEGGY 361
             +G     +KS     M  V  GGY
Sbjct: 298 RAHGECVKFVKSFGIP-MLCVGGGGY 322

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  136 bits (343), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 91/328 (27%), Positives = 163/328 (49%), Gaps = 28/328 (8%)

Query: 39  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIG 98
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL K           
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGLHK----------- 65

Query: 99  DLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT----ESGDSVYFNSDSY 154
            +M     R AT EE+   HS+E++DF++  +  N  +L + T      GD      + Y
Sbjct: 66  -IMDLYETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPNLY 124

Query: 155 ASAKLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILK 213
             + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+
Sbjct: 125 DYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLR 182

Query: 214 NYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEG 273
            +P    ++L +D D+HHG+G Q+AFY  DR+  VS H++  G+++PGT  G +D+ G  
Sbjct: 183 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCA 235

Query: 274 KGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHV 333
           +G+ F  N+     G+ D  Y+  F+ I+ P+   ++P +++   G D+   D +G  ++
Sbjct: 236 RGKHFALNVPLQ-DGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFNL 294

Query: 334 TPSCYGHMTHMLKSLARGNMAVVLEGGY 361
               +G   + ++S     M VV  GGY
Sbjct: 295 NVKAHGECVNFVRSFGLP-MLVVGGGGY 321

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  135 bits (341), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/325 (28%), Positives = 159/325 (48%), Gaps = 28/325 (8%)

Query: 42  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLM 101
           G  +   + YH     S F Y   HP  P R+     +++  GL K            +M
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IM 68

Query: 102 LKIPVREATSEEILEVHSKEHLDFIESTSKMNREQL----LKATESGDSVYFNSDSYASA 157
                R AT EE+ E HS+++++F+   S  N  +L    L+    GD        Y  +
Sbjct: 69  DLYETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLYQYS 128

Query: 158 KLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYP 216
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYHP 186

Query: 217 ESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGE 276
               ++L +D D+HHG+G Q+AFY  DR+  VS H++  G+++PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRGK 239

Query: 277 GFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPS 336
            F  N+     G+ D  Y+  F+ I+ P+   F+P ++I   G D+   D +G  ++   
Sbjct: 240 HFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 337 CYGHMTHMLKSLARGNMAVVLEGGY 361
            +G     +KS     M VV  GGY
Sbjct: 299 AHGECVKYVKSFGL-PMLVVGGGGY 322

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/328 (27%), Positives = 161/328 (49%), Gaps = 28/328 (8%)

Query: 45  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKI 104
           Y  R+ YH     S++ Y   HP  P R+     +++  GL K            +M   
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGLHK------------IMDLY 71

Query: 105 PVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT----ESGDSVYFNSDSYASAKLP 160
             R AT +E+ E H++++++F+   S  N  +L + T      GD      + Y    L 
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 161 VGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESV 219
            G  ++A + ++    ++ +A+    G HHA+  +  GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 220 RKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFN 279
            ++L +D D+HHG+G Q+AFY  DR+  +S H++  G+++PGT  G   + G  KG+ F 
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 280 CNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYG 339
            N+     G+ D  Y+  F+ IV P+   F+P +++   G D+   D +G  ++    +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 340 HMTHMLKSLARGNMAVVLEGGYNLDSIA 367
                +KS     M VV  GGY   +++
Sbjct: 302 ECVKFVKSFGLP-MLVVGGGGYTPKNVS 328

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  135 bits (339), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 90/328 (27%), Positives = 163/328 (49%), Gaps = 28/328 (8%)

Query: 39  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIG 98
            + G    +R+ YH     S++ Y   HP  P R+     +++  G+ K           
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSGYGMHK----------- 67

Query: 99  DLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT----ESGDSVYFNSDSY 154
            +M     R AT++E+ E H+++++ F++  S  N  +L + T      GD      + Y
Sbjct: 68  -VMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLY 126

Query: 155 ASAKLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILK 213
             A L  G +++A + ++ G  ++ +A+    G HHA+  +  GFC  +++ ++  N+L+
Sbjct: 127 DYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLR 184

Query: 214 NYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEG 273
            +P    ++L +D D+HHG+G Q+AFY  DR+  +S H++  G ++PGT  G  D+TG  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGCD 237

Query: 274 KGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHV 333
            GE F  N+     G+ D  Y+  F+ ++ P+   + P ++I   G D+   D +G  ++
Sbjct: 238 AGERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNL 296

Query: 334 TPSCYGHMTHMLKSLARGNMAVVLEGGY 361
               +G     +KS     M VV  GGY
Sbjct: 297 NIKAHGECVKFVKSFGI-PMLVVGGGGY 323

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  134 bits (337), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 162/326 (49%), Gaps = 30/326 (9%)

Query: 42  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLM 101
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL K            +M
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRLMLTDHLVSAYGLHK------------VM 71

Query: 102 LKIPVREATSEEILEVHSKEHLDFI-----ESTSKMNREQLLKATESGDSVYFNSDSYAS 156
                R AT +E+ + HS+++++F+     ++ +K+ R  L K     D   F    +  
Sbjct: 72  DLYETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQG-MFDY 130

Query: 157 AKLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNY 215
           A L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 131 AALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYH 188

Query: 216 PESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKG 275
           P    ++L +D D+HHG+G Q+AFY  DR+  VS H++  G+++PGT  G  D+ G  +G
Sbjct: 189 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRG 241

Query: 276 EGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTP 335
           + F  N+     G+ D  Y+  F+ I+ P+   F+P ++I   G D+   D +G  ++  
Sbjct: 242 KHFALNVPLQ-DGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNI 300

Query: 336 SCYGHMTHMLKSLARGNMAVVLEGGY 361
             +G     +KS     M VV  GGY
Sbjct: 301 KAHGECVRFVKSFGV-PMLVVGGGGY 325

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  132 bits (332), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 91/338 (26%), Positives = 158/338 (46%), Gaps = 26/338 (7%)

Query: 33  QIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLS 92
           Q+ +  LK       R+ Y      S + Y   HP  P RI   + ++   GL K     
Sbjct: 5   QLPFDDLKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK---- 60

Query: 93  GIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYF 149
                   M     + AT +E+ + HS E++DF+   +  N E   K +     GD    
Sbjct: 61  --------MEIYRAKPATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 150 NSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAK 209
               Y    +  GG++E    +  G+   A+       HHA+   A GFC  +++ +   
Sbjct: 113 FDGLYEYCSISGGGSMEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGII 171

Query: 210 NILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQ 269
            +L+ +P    ++L +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G    
Sbjct: 172 ELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRD 223

Query: 270 TGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIG 329
           TG GKG+ ++ N+     G+ D  Y   FE ++  +   +QP  V++  G D+  GD +G
Sbjct: 224 TGVGKGKYYSVNVPLR-DGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLG 282

Query: 330 QCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIA 367
             +++   + +  + +KS     M VV  GGY + ++A
Sbjct: 283 CFNLSMRGHANCVNYVKSFGI-PMLVVGGGGYTMRNVA 319

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  132 bits (332), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 90/330 (27%), Positives = 162/330 (49%), Gaps = 28/330 (8%)

Query: 38  PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDI 97
           P + G  Y  ++ YH     S + Y   HP  P R+     +++  GL K          
Sbjct: 53  PFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKPFRLMLTDHLVSCYGLHK---------- 102

Query: 98  GDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQL----LKATESGDSVYFNSDS 153
             +M     REAT EE+LE H+ ++++F+   +  N  +L    L+    GD        
Sbjct: 103 --IMDLYETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDCPIFQGM 160

Query: 154 YASAKLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNIL 212
           +  + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  ++L
Sbjct: 161 FDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISLL 218

Query: 213 KNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGE 272
           + +P    ++L +D D+HHG+G Q+AFY  DR+  VS H++  G+++PGT  G  D+ G 
Sbjct: 219 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGC 271

Query: 273 GKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCH 332
            KG+ F+ N+     G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G  +
Sbjct: 272 SKGKKFSLNVPLQ-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFN 330

Query: 333 VTPSCYGHMTHMLKSLARGNMAVVLEGGYN 362
           +    +G     +KS     + V   GGY 
Sbjct: 331 LNIKAHGECVKFVKSFGIPILCVG-GGGYT 359

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  130 bits (328), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 91/339 (26%), Positives = 160/339 (47%), Gaps = 28/339 (8%)

Query: 33  QIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLS 92
           Q+ +  LK       R+ Y      S + Y   HP  P RI   + ++   GL K     
Sbjct: 5   QLPFDELKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK---- 60

Query: 93  GIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYF 149
                   M     + AT +E+ + H+ E++DF+   +  N E   K +     GD    
Sbjct: 61  --------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPV 112

Query: 150 NSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAA 208
               Y    +  GG++E    +  G+    +A+    G HHA+   A GFC  +++ +  
Sbjct: 113 FDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGI 170

Query: 209 KNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYD 268
             +L+ +P    ++L +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G   
Sbjct: 171 IELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELR 222

Query: 269 QTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTI 328
            TG GKG+ +  N+     G+ D+ Y   FE ++  +   +QP  V++  G D+  GD +
Sbjct: 223 DTGVGKGKYYAVNVPLR-DGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRL 281

Query: 329 GQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIA 367
           G  +++   + +  + +KS     M VV  GGY + ++A
Sbjct: 282 GCFNLSMRGHANCVNYVKSFGI-PMLVVGGGGYTMRNVA 319

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 154/324 (47%), Gaps = 28/324 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N E   K +     GD        Y    +  GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 165 IEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKIL 223
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 129 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 224 ILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNIT 283
            +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G    TG GKG+ +  N+ 
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 284 WPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTH 343
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 239 LR-DGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 297

Query: 344 MLKSLARGNMAVVLEGGYNLDSIA 367
            +KS     M VV  GGY + ++A
Sbjct: 298 YVKSFGI-PMMVVGGGGYTMRNVA 320

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 154/324 (47%), Gaps = 28/324 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K+            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N +   K +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKIL 223
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 224 ILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNIT 283
            +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G    TG G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 284 WPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTH 343
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 344 MLKSLARGNMAVVLEGGYNLDSIA 367
            +KS     M VV  GGY + ++A
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVA 319

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  129 bits (325), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 153/323 (47%), Gaps = 26/323 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N +   K +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILI 224
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    ++L 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 225 LDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITW 284
           +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G    TG GKG+ ++ N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 285 PVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHM 344
              G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 R-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNY 297

Query: 345 LKSLARGNMAVVLEGGYNLDSIA 367
           +KS     M VV  GGY + ++A
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVA 319

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  129 bits (325), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 152/323 (47%), Gaps = 26/323 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N +   K +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILI 224
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    ++L 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 225 LDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITW 284
           +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G    TG GKG+ +  N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVPL 238

Query: 285 PVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHM 344
              G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 R-DGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNF 297

Query: 345 LKSLARGNMAVVLEGGYNLDSIA 367
           +KS     M VV  GGY + ++A
Sbjct: 298 VKSFGIPLM-VVGGGGYTMRNVA 319

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  129 bits (325), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 153/323 (47%), Gaps = 26/323 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N +   K +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILI 224
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    ++L 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 225 LDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITW 284
           +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G    TG GKG+ ++ N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 285 PVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHM 344
              G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 R-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNY 297

Query: 345 LKSLARGNMAVVLEGGYNLDSIA 367
           +KS     M VV  GGY + ++A
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVA 319

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  129 bits (325), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 91/346 (26%), Positives = 158/346 (45%), Gaps = 40/346 (11%)

Query: 25  IIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENG 84
           I V PRD +              R+ Y        + Y   HP  P RI   + ++   G
Sbjct: 11  ITVNPRDKK--------------RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYG 56

Query: 85  LIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKAT--- 141
           L K             M     + AT +E+ + H+ E++DF+   +  N +   K +   
Sbjct: 57  LYKK------------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKF 104

Query: 142 ESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLF 201
             GD        Y    +  GG++E    +  G+   A+       HHA+   A GFC  
Sbjct: 105 NVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAINYAGGL-HHAKKTEASGFCYL 163

Query: 202 SNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPG 261
           +++ +    +L+ +P    ++L +D D+HHG+G ++AFY  DR++  S H++  G+++PG
Sbjct: 164 NDIVLGIIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG 217

Query: 262 TIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFD 321
           T  G    TG GKG+ +  N+     G+ DA Y   FE +V  +   +QP  V++  G D
Sbjct: 218 T--GELRDTGVGKGKYYAVNVPL-RDGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGD 274

Query: 322 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIA 367
           +  GD +G  +++   + +  + +KS     M +V  GGY + ++A
Sbjct: 275 SLSGDRLGCFNLSIRGHANCVNFVKSFGL-PMMIVGGGGYTMRNVA 319

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 152/323 (47%), Gaps = 26/323 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N     K +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILI 224
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    ++L 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 225 LDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITW 284
           +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G    TG GKG+ ++ N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 285 PVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHM 344
              G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 R-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVNY 297

Query: 345 LKSLARGNMAVVLEGGYNLDSIA 367
           +KS     M VV  GGY + ++A
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVA 319

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/323 (26%), Positives = 151/323 (46%), Gaps = 26/323 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N E   K +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILI 224
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    ++L 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 225 LDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITW 284
           +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G     G GKG+ +  N+  
Sbjct: 183 IDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVPL 238

Query: 285 PVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHM 344
              G+ DA Y   FE +V  +   +QP  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 R-DGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVNY 297

Query: 345 LKSLARGNMAVVLEGGYNLDSIA 367
           +KS     M VV  GGY + ++A
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVA 319

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  129 bits (323), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 153/324 (47%), Gaps = 28/324 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N E   K +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKIL 223
           +E+   +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MESAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 224 ILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNIT 283
            +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 284 WPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTH 343
               G+ DA Y   FE +V  +   +QP  V++  G D+  GD +G  +++   +    +
Sbjct: 238 L-RDGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 344 MLKSLARGNMAVVLEGGYNLDSIA 367
            +KS     M VV  GGY + ++A
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVA 319

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  129 bits (323), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 154/324 (47%), Gaps = 28/324 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N E   + +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKIL 223
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 224 ILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNIT 283
            +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G     G GKG+ ++ N+ 
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 284 WPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTH 343
               G+ DA Y   FE +V  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 344 MLKSLARGNMAVVLEGGYNLDSIA 367
            +KS     M VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  128 bits (322), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 153/324 (47%), Gaps = 28/324 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N E   + +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKIL 223
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 224 ILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNIT 283
            +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G     G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 284 WPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTH 343
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   +G+  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 344 MLKSLARGNMAVVLEGGYNLDSIA 367
            +KS     M VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  128 bits (321), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 151/323 (46%), Gaps = 26/323 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N E   K +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILI 224
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    ++L 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 225 LDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITW 284
           +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G     G GKG+ +  N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVPL 238

Query: 285 PVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHM 344
              G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 R-DGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNY 297

Query: 345 LKSLARGNMAVVLEGGYNLDSIA 367
           +KS     M VV  GGY + ++A
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVA 319

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  127 bits (320), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 99/378 (26%), Positives = 171/378 (45%), Gaps = 45/378 (11%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N +   K +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKIL 223
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 224 ILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNIT 283
            +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G    TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 284 WPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTH 343
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 344 MLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPPDEL-----------PDVTRDP 392
            +KS     M +V  GGY + ++A +      IL     DE            PD   D 
Sbjct: 297 YMKSFGVPLM-IVGGGGYTMRNVARTWAFETGILNNVILDEELPYNDYYEYYGPDYKLDV 355

Query: 393 KPEVI------EMIDKVL 404
           +P  +      E +DKVL
Sbjct: 356 RPSNMYNVNTPEYLDKVL 373

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  127 bits (319), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 153/324 (47%), Gaps = 28/324 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N +   K +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKIL 223
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 224 ILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNIT 283
            +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 284 WPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTH 343
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 344 MLKSLARGNMAVVLEGGYNLDSIA 367
            +KS     M VV  GGY + ++A
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVA 319

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  126 bits (316), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 152/324 (46%), Gaps = 28/324 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N E   + +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKIL 223
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 224 ILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNIT 283
            +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G     G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 284 WPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTH 343
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 344 MLKSLARGNMAVVLEGGYNLDSIA 367
            +KS     M VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  125 bits (315), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/324 (26%), Positives = 152/324 (46%), Gaps = 28/324 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N E   + +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKIL 223
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 224 ILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNIT 283
            +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G     G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 284 WPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTH 343
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 344 MLKSLARGNMAVVLEGGYNLDSIA 367
            +KS     M VV  GGY + ++A
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVA 319

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  125 bits (315), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 153/324 (47%), Gaps = 28/324 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        + Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N +   K +     GD        +    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKIL 223
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 224 ILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNIT 283
            +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 284 WPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTH 343
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 LR-DGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 344 MLKSLARGNMAVVLEGGYNLDSIA 367
            +KS     M VV  GGY + ++A
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVA 319

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  124 bits (312), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 150/323 (46%), Gaps = 26/323 (8%)

Query: 48  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVR 107
           R+ Y        F Y   HP  P RI   + ++   GL K             M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 108 EATSEEILEVHSKEHLDFIESTSKMNREQLLKAT---ESGDSVYFNSDSYASAKLPVGGA 164
            AT +E+ + H+ E++DF+   +  N E   K +     GD        Y    +  GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 165 IEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILI 224
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    ++L 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKAEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 225 LDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITW 284
           +D D+HHG+G ++AFY  DR++  S H++  G+++PGT  G     G G G+ +  N+  
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVPL 238

Query: 285 PVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHM 344
              G+ DA +   FE +V  +   +QP  V++  G D+  GD +G  +++   + +  + 
Sbjct: 239 R-DGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNY 297

Query: 345 LKSLARGNMAVVLEGGYNLDSIA 367
           +KS     M VV  GGY + ++A
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVA 319

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 91/177 (51%), Gaps = 13/177 (7%)

Query: 188 HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILY 247
           HHA  + A GFC  ++V +  + + K     + K+  LD+D+HHG+G +KAF    +I  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 248 VSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYM-WAFEQIVMPMG 306
           +S+H ++ G ++PGT  G  + +  GK       +  P+    D  Y+     +I+ P+ 
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI-----VNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 307 REFQPDLVIISAGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNMAVVLEGGYN 362
           +   P+++I+  G D   GD   +  +T       + +++KS  + ++ ++  GGYN
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 118/257 (45%), Gaps = 34/257 (13%)

Query: 161 VGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESV 219
           V GA  A    +     +ALAV    G HHA    A GFC  +++A+  + + +   +  
Sbjct: 165 VAGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QGF 221

Query: 220 RKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFN 279
            ++  +D+D+HHG+G + AF     +   SLH F+ G ++PG        TG  K    N
Sbjct: 222 LRVSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPG--------TGACKNCTDN 272

Query: 280 CNITWP-VGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCY 338
             +  P + GV D+      + IV P  +   P+++II  G D   GD  G+  +  S +
Sbjct: 273 SVLNVPLLHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQL--SIH 330

Query: 339 GHMTHMLKSLAR---GNMAVVLEGGYN----------LDSIAISALSVAKILIGEPPDEL 385
           G   ++LK +       +A++  GGYN          L S+ ++        IG+  DEL
Sbjct: 331 GLTRNILKLVQAHKFKKIALLGGGGYNGRLQSRFYAYLTSMLLAQCKGIPTEIGDDEDEL 390

Query: 386 PDVTRDPKPEVIEMIDK 402
               RD   E+IEM ++
Sbjct: 391 ---IRD--HELIEMYEQ 402

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 92/176 (52%), Gaps = 11/176 (6%)

Query: 188 HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILY 247
           HH+  + A GFC  +++ +    I K   +  RKI  LD+D+HHG+G +K+F     I  
Sbjct: 299 HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 248 VSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGR 307
           +S+H F+ G ++P T  G  ++T      GFN      + G+ D    +   ++++P+ +
Sbjct: 356 ISVHLFEPG-FFPCT--GSLEET----KHGFNIVNIPTLHGLDDNYLTYLLNRVIIPLIK 408

Query: 308 EFQPDLVIISAGFDAADGDTIGQCHVTPS-CYGHMTHMLKSLARGNMAVVLEGGYN 362
           + +P+ +++  G D   GD   +  +T S    ++  +L++    ++ ++  GGYN
Sbjct: 409 KHKPECLVVQCGGDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYN 464

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 90/177 (50%), Gaps = 13/177 (7%)

Query: 188 HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILY 247
           HHA  + A GFC  ++V +  + + K     + KI  +D+D+HHG+G ++AF    +I  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---MKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 248 VSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYM-WAFEQIVMPMG 306
           +S+H ++ G ++PGT  G  +   +GK       +  P+    D  Y+     +I+ P+ 
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV-----VNIPLKHGCDDSYLDLVASKIISPLI 320

Query: 307 REFQPDLVIISAGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNMAVVLEGGYN 362
           +   PD++II  G D   GD   +  +T       + +++K   R ++ ++  GGYN
Sbjct: 321 KRHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN 377

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 91/177 (51%), Gaps = 11/177 (6%)

Query: 188 HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILY 247
           HHA  + A GFC  +++ +  + + +   +  +KI  +D+D+HHG+G +KAF     +  
Sbjct: 206 HHAFKQKASGFCYVNDIVLLIQKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 248 VSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGR 307
           +SLH F++G ++PGT  G   ++ + +      NI   + G+ D       EQIV P+  
Sbjct: 263 ISLHLFEVG-FFPGT--GNLSESDKRRNV---VNIPL-LHGLDDTSLEQLIEQIVKPVIE 315

Query: 308 EFQPDLVIISAGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNMAVVLEGGYNL 363
             +PD+++I  G D   GD   +  ++       +T ++ +     + ++  GGYN+
Sbjct: 316 RHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNV 372

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 105/222 (47%), Gaps = 19/222 (8%)

Query: 149 FNSDSYASAKLP-----VGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFS 202
            + D Y  A LP     + GA  +       R + A+++    G HHA    A GFC  +
Sbjct: 176 LSHDCYLFAYLPLYCQVIAGATLSLVRAACLRHERAISINWDGGRHHASRSRASGFCYIN 235

Query: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262
           ++A+  + + +     +R+I  +D+D+HH +G ++AF     +  +S+H  + G ++PGT
Sbjct: 236 DIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQTISVHLHEPG-FFPGT 291

Query: 263 IHGRYDQTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFD 321
             G   +   GK       +  PV  G+ D       ++++MP  R   P++++I  G D
Sbjct: 292 --GSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIMPCIRSHNPEVLVIQCGGD 344

Query: 322 AADGDTIGQCHVT-PSCYGHMTHMLKSLARGNMAVVLEGGYN 362
              GD   +  +T      ++ ++++     N+ ++  GGYN
Sbjct: 345 GLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYN 386

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 118/273 (43%), Gaps = 25/273 (9%)

Query: 152 DSYASAKLP-----VGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVA 205
           D +  A LP     V GA          R +  ++V    G HHA    A GFC  +++A
Sbjct: 182 DCHPFAYLPMYCQVVTGATIKLARYASSRQQRTISVNWDGGRHHAFKSKASGFCYVNDIA 241

Query: 206 IAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHG 265
           I  + + +     + KI  LD+D+HHG+G ++AF     +  +S+H ++ G ++PGT  G
Sbjct: 242 ILIQKLRR---RGIHKISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPGT--G 295

Query: 266 RYDQTGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAAD 324
                  G+       +  PV  G+ D        ++V+P      P++VII  G D   
Sbjct: 296 TLKDASSGRNI-----VNIPVLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGDGLI 350

Query: 325 GDTIGQCHVT-PSCYGHMTHMLKSLARGNMAVVLEGGYN--LDSIAISALS---VAKILI 378
           GD   +  +T       +  +++     N+ ++  GGYN  L S   + L+   V+K   
Sbjct: 351 GDKYKEWQLTLKGLTDTIMKVVEDFPSSNIVLLGGGGYNEKLMSRFYTYLTWRIVSKYSE 410

Query: 379 GEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYW 411
             P D   D   D  P+  E ID       K+W
Sbjct: 411 NAPTDNPFDRHDDVIPDH-EFIDSYKDEFYKFW 442

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 113/239 (47%), Gaps = 20/239 (8%)

Query: 127 ESTSKMNREQLLKATESGDSVYFNSDSY--ASAKLPVGGAIEACKAVVEGRVKNALAVVR 184
           ++  +M RE+L      GD   F   SY     ++ VG  +   K +     +  +AV  
Sbjct: 172 DNEKEMIREKLKGYNLEGDCPIF---SYLPVYCQVIVGATLSLAKHITAVANERTIAVNW 228

Query: 185 PPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDD 243
             G HHA    A GFC  +++ +  + +  N     ++I  +D+D+HHG+G Q++F    
Sbjct: 229 DGGRHHALRNKASGFCYINDIVLLIQQLRSN---GYKRITYIDFDLHHGDGVQRSFQYST 285

Query: 244 RILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVM 303
            +  +S H F+ G ++P T  G   ++  GK      NI   + GV D       E++++
Sbjct: 286 SVQTISAHMFEPG-FFPCT--GSLKESKMGKNI---VNIPL-LHGVDDMLMNEIVEKVMI 338

Query: 304 PMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLA--RGNMAVVLEGG 360
           P  + + P++++I  G D   GD   +  +T   +G + ++LK L    G   V+L GG
Sbjct: 339 PCVKRYDPEILVIQCGGDGLIGDGYAEWQLT--IHGLVNNILKLLRIFPGCPVVLLGGG 395

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 98/205 (47%), Gaps = 14/205 (6%)

Query: 161 VGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYPESV 219
           V GA  +    ++   + ++A+    G HHA    A GFC  +++ +  + I KN     
Sbjct: 187 VTGATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GF 243

Query: 220 RKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFN 279
           + I  +D+D+HHG+G QKAF     +  VSLH F+ G ++P T         E K     
Sbjct: 244 KNISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCT-----GSLQEAKAGSSI 297

Query: 280 CNITWPVGGVGDAEYMWAFEQ-IVMPMGREFQPDLVIISAGFDAADGDTIGQCHVT-PSC 337
            NI  P+    D  ++    + I++P+  + +P++++I  G D   GD   +  +T    
Sbjct: 298 VNI--PLLHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDL 355

Query: 338 YGHMTHMLKSLARGNMAVVLEGGYN 362
            G +  ++ +    ++ ++  GGYN
Sbjct: 356 SGAIMKLINTFPSCSVVLLGGGGYN 380

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 99/216 (45%), Gaps = 24/216 (11%)

Query: 160 PVGGAIEACKAVVEGRVKNALAVVRPP-----------GHHAEPEAAGGFCLFSNVAIAA 208
           P+   +     V+ G   N L  + P             HHA  + A GFC  ++V +  
Sbjct: 171 PIFSYLPMYCQVITGATLNLLDHLSPTERLIGINWDGGRHHAFKQRASGFCYINDVVLLI 230

Query: 209 KNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYD 268
           + + K     + KI  +D+D+HHG+G +KAF    +I  +S+H ++ G ++PGT  G   
Sbjct: 231 QRLRK---AKLNKITYVDFDLHHGDGVEKAFQYSKQIQTISVHLYEPG-FFPGT--GSLS 284

Query: 269 QTGEGKGEGFNCNITWPVGGVGDAEYMWAF-EQIVMPMGREFQPDLVIISAGFDAADGDT 327
            + + K       +  P+    D  Y+     +IV P+    +P+ +II  G D   GD 
Sbjct: 285 DSRKDKNV-----VNIPLKHGCDDNYLELIASKIVNPLIERHEPEALIIECGGDGLLGDR 339

Query: 328 IGQCHVTPSCYGH-MTHMLKSLARGNMAVVLEGGYN 362
             +  +T       + +++KS  R ++ ++  GGYN
Sbjct: 340 FNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 129/277 (46%), Gaps = 31/277 (11%)

Query: 110 TSEEILEVHSKEHLDFIESTSKMNR-EQLLKATESGDSVY-------FN--SDSYASAKL 159
           T  E+L  + ++H++  E   K    E  L   ESGD V        FN   D      L
Sbjct: 110 TYSELLHYY-RDHIEVSEHNKKRTALEAELSDVESGDEVTRRSTLAKFNLLDDCPIFPYL 168

Query: 160 PV------GGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNIL 212
           P+      G  +   + ++EG  +  +A+    G HH+    A GFC  +++A+    + 
Sbjct: 169 PLYCYVSTGATLSLAQYILEGS-ERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLR 227

Query: 213 KNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGE 272
           +     V +I  +D+D+HHG+G +KAF    ++  +SLH ++ G ++P +  G  +    
Sbjct: 228 RG---GVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPCS--GSLEDNSS 281

Query: 273 GKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCH 332
           GK      NI   + G+ D+      ++I++P   + QP++++I  G D   GD   +  
Sbjct: 282 GKSI---VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQ 337

Query: 333 VTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAIS 369
           +  S  G  + +   + + N  +VL GG   +++ +S
Sbjct: 338 L--SIKGLTSTITSLIEQFNCHIVLLGGGGYNNLLMS 372

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 90/177 (50%), Gaps = 13/177 (7%)

Query: 188 HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILY 247
           HHA  + A GFC  ++V +  + + K     + KI  LD+D+HHG+G +KAF    +I  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 248 VSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQIVMPMG 306
           +S+H ++ G ++PGT  G  D +  GK       +  P+  G  D+       +I+ P+ 
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV-----VNIPLKHGCDDSYLNLIASKIINPLI 318

Query: 307 REFQPDLVIISAGFDAADGDTIGQCHVTPSCYGH-MTHMLKSLARGNMAVVLEGGYN 362
            +  P+++II  G D   GD   +  +T       + + +K  ++ ++ ++  GGYN
Sbjct: 319 DKHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 93/208 (44%), Gaps = 15/208 (7%)

Query: 158 KLPVGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEAAGGFCLFSNVAIAAKNILKNYP 216
           ++  G  +   K +V       + +    G HHA  + A GFC  +++ +  + + KN  
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 217 ESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGE 276
              +KI  LD+D+HHG+G +KAF     I  +SLH F+ G ++PG        TG    +
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPG--------TGGLSNK 295

Query: 277 GFNCNITWPVG-GVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTP 335
           G    I  P+  G+ D       +QI++P       + +++  G D   GD   +  +T 
Sbjct: 296 GSRDLIDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTI 355

Query: 336 SCYGH-MTHMLKSLARGNMAVVLEGGYN 362
                 +  ++   +   + ++  GGYN
Sbjct: 356 KGLTQCIIDVIGKFSDCQIVLLGGGGYN 383

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 89/177 (50%), Gaps = 13/177 (7%)

Query: 188 HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILY 247
           HHA    A GFC  +++ I  + + K   + + K+  +D+D+HHG+G +KAF     I  
Sbjct: 223 HHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 248 VSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQIVMPMG 306
           +S+H ++ G ++P T  G  + T  GK       +  P+  GV D        +++ P+ 
Sbjct: 280 ISMHMYEPG-FFPCT--GSLEDTLNGKNI-----VNVPLYHGVDDNYMTEIVNELIKPLI 331

Query: 307 REFQPDLVIISAGFDAADGDTIGQCHVTPS-CYGHMTHMLKSLARGNMAVVLEGGYN 362
               P++++I  G D   GD   +  +T S    ++ ++++   + ++ ++  GGYN
Sbjct: 332 ERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGGGYN 388

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 87/177 (49%), Gaps = 14/177 (7%)

Query: 188 HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILY 247
           HH+    A GFC  +++ +A + + +N+      I  +D+D+HHG+G ++AF     +  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFS----NISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 248 VSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQIVMPMG 306
           +SLH  + G ++PGT  G  + + +G        I  P+  G  D   M   E +V+P  
Sbjct: 298 ISLHNHEPG-FFPGT--GSMESSQDGHS-----IINIPLRHGADDDCLMKITESVVIPCI 349

Query: 307 REFQPDLVIISAGFDAADGDTIGQCHVT-PSCYGHMTHMLKSLARGNMAVVLEGGYN 362
           ++  P +++I  G D   GD   +  +T       +  +L SL   ++ ++  GGYN
Sbjct: 350 QKHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYN 406

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 116/293 (39%), Gaps = 65/293 (22%)

Query: 179 ALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQ-- 236
           A   +RPPGHH+      GFCL +N  IA +     Y   V    ILD+D+HHG+GTQ  
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 237 ---------------KAFYDD--------DRILYVSLHRFKMGKYYPGTIHGRYDQ---- 269
                           A YDD         ++ Y SLH         G  H    +    
Sbjct: 242 CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDINSFPTEQGYAHKTSIKDASV 301

Query: 270 ---------------TGEGKGEGFN--CNITWPVGGVGDAEYMWAFEQIVMPMGREFQPD 312
                          T     E FN      +        E++   ++ +   G+ ++  
Sbjct: 302 CIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKNYK-G 360

Query: 313 LVIISAGFDAADGDTIGQ----CHVTPSCYGHMTHMLKSLA----RGNMAVVLEGGYNLD 364
           L+IISAGFDA++ + +       HV  S Y   T     LA    +G +  +LEGGY+ D
Sbjct: 361 LIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGYS-D 419

Query: 365 SIAISALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSK 417
           +  +S   V   LIG     + +    P+    ++I +V R     WK +K+K
Sbjct: 420 AALVSG--VFSHLIG-----MQNQNWIPEWGSAQVIKEVCRGCRPNWKAYKTK 465

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 129/288 (44%), Gaps = 41/288 (14%)

Query: 188 HHAEPEAAGGFCLFSNVAIAAKNILKNYPESV---RKILILDWDIHHGNGTQKAFYDDDR 244
           HHA    A GFC  +++ ++  N L+  P      RK+  +D D+HHG+G + AF     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 245 ILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQIVM 303
           I  +S+H F+ G +YP T   ++     GK +  N  I  PV  G+ ++        I++
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNI-INLPVKHGLSNSNMFELVTNIII 317

Query: 304 PMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLAR----------GNM 353
           P+    Q D ++I  G D  + D   +  +T    G    ++K +A            N+
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQLT--IIGLTRCIIKIIAAFVGPHQPGSCKNV 375

Query: 354 AVVLEGGYN--LDSIAISALSVAKI-LIGEPP-------DELPDVTRDPKPEVI-----E 398
            ++  GGYN  L S   + L+   + L G  P        E+P  T D K + +     E
Sbjct: 376 VLLGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHE 435

Query: 399 MIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQSAIRQ 446
            ID+  +   KYW C++ + G  G  F+ QIN +  TK  P    I +
Sbjct: 436 HIDEYEKEYYKYW-CYEIENGLDGLSFKRQINYN-DTKQKPFTKYIAE 481

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 108/231 (46%), Gaps = 24/231 (10%)

Query: 188 HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILY 247
           HHA    A GFC  +++ +  + + K   +   K+  LD+D+HHG+G ++AF    ++  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 248 VSLHRFKMGKYYP--GTIHGRYDQTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQIVMP 304
           +SLH ++ G ++P  G++ G           GF+  +  P+  G+ D+      +Q+V P
Sbjct: 263 ISLHLYEPG-FFPCTGSLEG---------SSGFD-TVNLPLQHGLTDSFLQGLVDQVVNP 311

Query: 305 MGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMA-VVLEGGYNL 363
           + +   P++++I  G D   GDT  +  +  S  G    +L  ++    A V+L GG   
Sbjct: 312 LIQRHGPEVIVIQCGGDGLLGDTFHEWQL--SIRGLTKCILDVMSHSTQAHVILLGGGGY 369

Query: 364 DSIAISALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCF 414
           +   +S       L G    +  +   DP P +    ++ L    KY +C+
Sbjct: 370 NPTLMSRFYT--YLTGRILHQFKNT--DPFPGMNGAQEESLIRDHKYIECY 416

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 106/228 (46%), Gaps = 21/228 (9%)

Query: 188 HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILY 247
           HHA  + A GFC  +++ +    I K   +  +++  +D+D+HHG+G ++AF     +  
Sbjct: 195 HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 248 VSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVG-GVGDAEYMWAFEQIVMPMG 306
           +S+H F+ G ++P +  G  +   +GK      NI  P+  G+ D        Q+V+P+ 
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NI--PLAHGLNDEYLNEIVTQVVIPLT 303

Query: 307 REFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLAR-GNMAVVLEGGYNLDS 365
               P ++II  G D   GD   +  +T    G   ++LK + R  N ++VL GG   + 
Sbjct: 304 DRHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYNP 361

Query: 366 IAISALSVAKILIGEPPDELPDVTRDPKPEVIE--MIDKVLRIQSKYW 411
             +S       L G+  D  P+  +D    + E   ID       K+W
Sbjct: 362 TVMSRFYT--YLTGKLID--PNFLQDEDTIIPEHKFIDAYHDEHYKFW 405

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 82/323 (25%), Positives = 131/323 (40%), Gaps = 70/323 (21%)

Query: 111 SEEILEVHSKEHLDFIESTSKMNREQLLKAT-------ESGDSVYFNSDSYASAKLPVGG 163
           S  +L+VH ++    +    K   E+L K          SGD +Y +S +  + +  +G 
Sbjct: 105 SPHVLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDSWNSGD-IYLSSKTIEALQGSIGA 163

Query: 164 AIEACKAVVEG----RVKN-ALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPES 218
                 ++ EG     V N A  V+RPPGHH       GFCL +N  ++ +     Y   
Sbjct: 164 LETGVDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--G 221

Query: 219 VRKILILDWDIHHGNGTQ-------------------------KAFYDDDRILYVSLH-- 251
           +   ++LD+D+HHG+GTQ                         K F +  R+ Y S+H  
Sbjct: 222 ITHAVVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMHDI 281

Query: 252 -RFKMGKYYPGTIHGRYDQTGEGKGEGFNC-NI---TWPV----GGVGDAEYMWAFEQI- 301
             F     Y    + +   T    G   N  N+    W        +  ++Y   F +  
Sbjct: 282 NSFPTESGYATKDNIKSASTCIMNGHDLNIWNVHLSAWETEEDFNKLYQSKYRTLFAKAD 341

Query: 302 ---------VMPMGREFQPDLVIISAGFDAADGDTIG-QCH---VTPSCYGHMTHMLKSL 348
                    +   G++F+  LV+ISAGFDA++ + +  Q H   V  + Y   T     L
Sbjct: 342 EFFKNAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKL 400

Query: 349 AR----GNMAVVLEGGYNLDSIA 367
           A+    G +  VLEGGY+  +I 
Sbjct: 401 AQMHSEGKVLSVLEGGYSDKAIT 423

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 82/174 (47%), Gaps = 12/174 (6%)

Query: 188 HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILY 247
           HHA    A GFC  +++ +  +++ +   +  +++  +D+D+H+G+G  KAF   + +  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 248 VSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPV-GGVGDAEYMWAFEQIVMPMG 306
           +S+H ++ G ++PGT  G  ++T   K       +  PV  G+ D   +     ++ P+ 
Sbjct: 250 ISVHLYEPG-FFPGT--GSLEETRNSKQM-----VNLPVLHGMDDKYLLELISSVITPLI 301

Query: 307 REFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGG 360
             F  + ++I  G D   GD   +  ++     H    +  + R     +L GG
Sbjct: 302 ETFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGG 355

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 80/331 (24%), Positives = 133/331 (40%), Gaps = 76/331 (22%)

Query: 111 SEEILEVHS----KEHLDFIE-STSKMNREQLLKATE--SGDSVYFNSDSYASAKLPVGG 163
           S  +L+VH     KE L     +  K+ R+Q+    E   GD +Y   ++  + +  +G 
Sbjct: 105 SSHVLKVHGSDWPKELLRLCRGAKEKIGRKQVEVPDEWNVGD-IYLCEETVYALRGSIGA 163

Query: 164 AIEACKAVVEGRVKN-----ALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPES 218
                 ++ +G V       A   +RPPGHH+      GFCL +N  IA +     Y   
Sbjct: 164 VEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGFCLLNNAHIAVEYAADTY--G 221

Query: 219 VRKILILDWDIHHGNGTQ-------------------------KAFYDDDRILYVSLHRF 253
           V   +ILD+D+HHG+GTQ                         K F +  ++ Y S+H  
Sbjct: 222 VTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYNEFDKKFAEFPKVGYFSMHDI 281

Query: 254 KMGKYYPGTI-HGRYDQTGEGKG---EGFNCNITWPV-----------GGVGDAEYMWAF 298
                +P  + +   D+  +      +  + NI W +             +    Y   F
Sbjct: 282 NS---FPTELNYASKDKVKDASTCIMDAHDVNI-WNIHLLPYETEEEFNKLYQTRYRTLF 337

Query: 299 EQ-------IVMPMGREFQP--DLVIISAGFDAADGDTIGQ----CHVTPSCYGHMTHML 345
            +         + M ++ +P   LV++SAGFDA++ + +       +V  S Y   T   
Sbjct: 338 AKADEFFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQVSMQRHGVNVPTSFYSTFTKDA 397

Query: 346 KSLAR----GNMAVVLEGGYNLDSIAISALS 372
             LA+    G +  +LEGGY+  +IA    S
Sbjct: 398 LKLAQMHTNGKIISLLEGGYSDAAIASGVFS 428

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 10/117 (8%)

Query: 127 ESTSKMNREQLLKATESGDS--VYFNSDSYASAKLPVGGAIEACKAVVEGR-----VKNA 179
           E+ SK+ RE  L+  ES ++  +Y NSD+  + K  +G       ++  G         A
Sbjct: 127 EADSKL-REGKLEVPESWNAGDIYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRA 185

Query: 180 LAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQ 236
              +RPPGHH       GFCL +N  I  +     Y   V  +++LD+D+HHG+GTQ
Sbjct: 186 FVAIRPPGHHCHVGMPSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 79/334 (23%), Positives = 129/334 (38%), Gaps = 71/334 (21%)

Query: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEG----RVKN-ALAVVRPPGHHAEPEAAGG 197
           +GD +Y +S +  + +  +G       ++  G     + N A   +RPPGHH   +   G
Sbjct: 145 AGD-IYLSSRTIEALQGSIGALETGVDSIFSGPSPDHISNRAFVAIRPPGHHCHVDTPSG 203

Query: 198 FCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQ--------------------- 236
           FCL +N  IA +     Y   +   +ILD+D+HHG+GTQ                     
Sbjct: 204 FCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDICWKRAGFRTEAEPETTEGY 261

Query: 237 ----KAFYDDDRILYVSLH---RFKMGKYYPGTIHGRYDQTGEGKGEGFNC-NI---TWP 285
               K F +  ++ Y S+H    F     Y    + R   T        N  NI    W 
Sbjct: 262 DEFGKKFAEFPKVGYFSMHDINSFPTESQYATKENIRNASTCVMNAHDVNIWNIHLSPWE 321

Query: 286 VGGVGDAEYMWAFEQIVM--------------PMGREFQPDLVIISAGFDAADGDTIGQC 331
                D  Y   +  +                 +G+ FQ  LV+ISAGFDA++ +     
Sbjct: 322 TEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQ-GLVVISAGFDASEFEQTSMQ 380

Query: 332 HVTPSCYGHMTHMLKSLA--------RGNMAVVLEGGYNLDSIAISALSVAKILIGEPPD 383
             + +   H   M    A         G +  ++EGGY+  +IA    S    LIG    
Sbjct: 381 RHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSDKAIASGVFSH---LIG---- 433

Query: 384 ELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSK 417
            L +     +    +++ +++R    +WK +K+K
Sbjct: 434 -LQNQNWIKEWGSEQVVKEIVRGCKPHWKPYKTK 466

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 103/235 (43%), Gaps = 30/235 (12%)

Query: 188 HHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILY 247
           HHA    A GFC  +++ +  + + KN      ++  +D+D+HHG+  + AF     +  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 248 VSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVG-----GVGDAEYMWAFEQIV 302
            SLH F+ G ++PGT            G   NC  T  V      G+ D       + I+
Sbjct: 252 CSLHLFEAG-FFPGT------------GSFKNCRETNVVNIPLFHGLDDESLDEIVDNIL 298

Query: 303 MPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSL---ARGNMAVVLEG 359
           +P   +  P++++I  G D   GD   +  +T   +G   ++LK +   +   + ++  G
Sbjct: 299 IPCVNKHDPEVLVIQCGADGLSGDKYKEWQLT--IHGLTRNILKLVDIHSYKKVVLLGGG 356

Query: 360 GYNLDSIAISALSVAKILIGEPPDELPDVTRDPKPEVI---EMIDKVLRIQSKYW 411
           GYN  ++     +   + + +    +P +  D + E I    +ID   +   K+W
Sbjct: 357 GYN-PTLQSRFYTYVTVCLLKYHKGIPSLISDSEDEHIIEHHLIDFYRKEAYKFW 410

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 97/237 (40%), Gaps = 55/237 (23%)

Query: 179 ALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQ-- 236
           A   +RPPGHH +     GFCL +N  I+ +    +Y   +   +ILD+D+HHG+GTQ  
Sbjct: 187 AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDI 244

Query: 237 -----------------------KAFYDDDRILYVSLH---RFKMGKYYPGTIHGRYDQT 270
                                  K F +  ++ Y S+H    F     Y   ++ R   T
Sbjct: 245 CWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMHDINSFPTETGYATKVNIRNAST 304

Query: 271 GEGKGEGFNC-NITW-PVGGVGDAEYMWA-------------FEQIVMPMGREFQP--DL 313
               G   N  NI   P     D + ++              F      M +E +P   L
Sbjct: 305 CIMDGHDLNIWNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFKGL 364

Query: 314 VIISAGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLA----RGNMAVVLEGGYN 362
           V+ISAGFDA++ + T  Q H   V  + Y   T     LA    +G +  +LEGGY+
Sbjct: 365 VVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYS 421

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 65/135 (48%), Gaps = 15/135 (11%)

Query: 114 ILEVHSKEHLDFIESTSKMNREQLLKAT-------ESGDSVYFNSDSYASAKLPVGGAIE 166
           +L+VH       +    +M   +LLK          SGD +Y +S +  + +  +G    
Sbjct: 110 VLKVHGSHWPAELIELCQMADAKLLKGEIEVPDTWNSGD-IYLSSKTIKALQGTIGAIET 168

Query: 167 ACKAVVEG----RVKN-ALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRK 221
              ++ EG     + N A   +RPPGHH       GFCL +N  +A +     Y  +V  
Sbjct: 169 GVDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 222 ILILDWDIHHGNGTQ 236
           +++LD+D+HHG+GTQ
Sbjct: 227 VVVLDFDLHHGDGTQ 241

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 172 VEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHH 231
           VE     A   +RPPGHH+      GFCL +N  IA +   + Y   V   +ILD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 232 GNGTQ 236
           G+GTQ
Sbjct: 234 GDGTQ 238

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 64/135 (47%), Gaps = 15/135 (11%)

Query: 114 ILEVHSKEHLDFIESTSKMNREQLLKAT-------ESGDSVYFNSDSYASAKLPVGGAIE 166
           +L+VH       +    +M   +LLK          SGD +Y +S +  + +  +G    
Sbjct: 110 VLKVHGSHWPTELIELCQMADAKLLKGEIEVPDTWNSGD-IYLSSKTIQALQGTIGAIET 168

Query: 167 ACKAVVEG----RVKN-ALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRK 221
              ++ +G     + N A   +RPPGHH       GFCL +N  +A +     Y   V  
Sbjct: 169 GVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTH 226

Query: 222 ILILDWDIHHGNGTQ 236
           +++LD+D+HHG+GTQ
Sbjct: 227 VVVLDFDLHHGDGTQ 241

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 13/137 (9%)

Query: 111 SEEILEVHSKEHLDFIESTSKMNREQLL-KATESGDS-----VYFNSDSYASAKLPVGGA 164
           S  +L+VH  +    +    K + E+L  K  E  D      +Y +  + A+ +  +G  
Sbjct: 106 SPHVLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGDIYLSQQTIAALEGSIGAL 165

Query: 165 IEACKAVVEGRVK-----NALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESV 219
                ++ +G  +      A   VRPPGHH+      GFCL +N  IA +     +  +V
Sbjct: 166 ETGIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--NV 223

Query: 220 RKILILDWDIHHGNGTQ 236
              ++LD+D+HHG+GTQ
Sbjct: 224 THAVVLDFDLHHGDGTQ 240

 Score = 38.5 bits (88), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 86/193 (44%), Gaps = 24/193 (12%)

Query: 306 GREFQPDLVIISAGFDAADGDTIG-QCH--VTPSCYGHM-THMLKSLAR----GNMAVVL 357
           G++F+  LV+ISAGFDA++ +    Q H    P+C+ +M T     LA+    G +  V+
Sbjct: 355 GKKFK-GLVVISAGFDASEYEQPSMQRHGVNVPTCFYNMFTKDALKLAQMHTSGKVLSVM 413

Query: 358 EGGYNLDSIAISALSVAKILIG----------EPPDELPDVTRDPKPEVIEMIDKVLRIQ 407
           EGGY+  +I+    S    LIG               + ++ R  KP+      K  R  
Sbjct: 414 EGGYSDGAISSGVFS---HLIGLQNQNWINEWGSAQVVKEIIRGCKPQWKPYKTKKARDV 470

Query: 408 SKYWKCFKSKFGNAGC-DFQEQINNSIATKNFP-LQSAIRQQQVRNLSKEFNFSELPIYK 465
            + W     K G +   +F++ +   +  +  P ++   R Q+  N+  + N   LP   
Sbjct: 471 IRIWAEEVIKLGRSMIPEFEDLLFGMVEAQIVPDVKRVTRSQKASNVVAKVNNVALPRSD 530

Query: 466 SELPEDTILCSSN 478
           +  PED  L  +N
Sbjct: 531 TPTPEDRRLARNN 543

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 68/138 (49%), Gaps = 15/138 (10%)

Query: 111 SEEILEVHS----KEHLDFIESTSKMNREQLLKATES---GDSVYFNSDSYASAKLPVGG 163
           S+ +L+VH     +E L   +++ K   +  ++  ES   GD +Y +  + ++ +  +G 
Sbjct: 106 SDHVLKVHGSDWPQELLKLCKNSQKALDQCQVEVPESWNVGD-IYLSRQTISALEGSIGA 164

Query: 164 AIEACKAV-----VEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPES 218
                 ++     VE     A   +RPPGHH+      GFCL +N  IA +     Y   
Sbjct: 165 LETGVDSIFHGPSVEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--G 222

Query: 219 VRKILILDWDIHHGNGTQ 236
           V   ++LD+D+HHG+GTQ
Sbjct: 223 VTHAVVLDFDLHHGDGTQ 240

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 43/83 (51%), Gaps = 9/83 (10%)

Query: 293 EYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIG-QCH---VTPSCYGHMTHMLKSL 348
           EY    +Q +  +G+ F+  LV+ISAGFDA++ +    Q H   V    Y   T     L
Sbjct: 343 EYFRTAKQNMRALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKL 401

Query: 349 AR----GNMAVVLEGGYNLDSIA 367
           A+    G +  VLEGGY+  +I+
Sbjct: 402 AQMHSHGKLLSVLEGGYSDGAIS 424

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (52%), Gaps = 8/99 (8%)

Query: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEG----RVKN-ALAVVRPPGHHAEPEAAGG 197
           SGD +Y +S++  + +  +G       ++  G     + N A   +RPPGHH       G
Sbjct: 146 SGD-IYLSSETIKAIEGSIGALELGLDSIFHGPSAEHISNRAFVAIRPPGHHCHVSTPSG 204

Query: 198 FCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQ 236
           FCL +N  IA +   + Y   V   +ILD+D+HHG+GTQ
Sbjct: 205 FCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQ 241

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 41/79 (51%), Gaps = 9/79 (11%)

Query: 302 VMPMGREFQPDLVIISAGFDAADGD-TIGQCH---VTPSCYGHMTHMLKSLAR----GNM 353
           +  M + F+  LV+ISAGFDA++ + T  Q H   V  S Y   T     LA+    G +
Sbjct: 357 MQEMNKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKV 415

Query: 354 AVVLEGGYNLDSIAISALS 372
             VLEGGY+  +IA    S
Sbjct: 416 LSVLEGGYSDKAIASGVFS 434

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 8/99 (8%)

Query: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEG----RVKN-ALAVVRPPGHHAEPEAAGG 197
           SGD +Y +S +  + +  +G    A  ++ +G     + N A   +RPPGHH       G
Sbjct: 144 SGD-IYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSG 202

Query: 198 FCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQ 236
           FC+ +N  +A +    +Y   V  + +LD+D+HHG+GTQ
Sbjct: 203 FCVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQ 239

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 65/135 (48%), Gaps = 15/135 (11%)

Query: 114 ILEVHSKEHLDFIESTSKMNREQLLKAT-------ESGDSVYFNSDSYASAKLPVGGAIE 166
           +L+VH       +    +M   +LLK          SGD +Y +S +  + +  +G    
Sbjct: 110 VLKVHGSSWPAELIELCQMADAKLLKGEIEVPDTWNSGD-IYLSSKTIKALQGTIGAIET 168

Query: 167 ACKAVVEG----RVKN-ALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRK 221
              ++ +G     + N A   +RPPGHH       GFCL +N  +A +     Y  +V  
Sbjct: 169 GVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 222 ILILDWDIHHGNGTQ 236
           +++LD+D+HHG+GTQ
Sbjct: 227 VVVLDFDLHHGDGTQ 241

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 64/138 (46%), Gaps = 15/138 (10%)

Query: 111 SEEILEVHSKEHLDFIESTSKMNREQLLKAT-------ESGDSVYFNSDSYASAKLPVGG 163
           S  + +VH KE    +    K   E+L K          +GD +Y +S +  + +  +G 
Sbjct: 105 SPHVYKVHGKEWPKEVIQLCKEADEKLAKGEIEVPESWNAGD-IYLSSKTIQALQGTIGA 163

Query: 164 AIEACKAVVEG----RVKN-ALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPES 218
                 ++ +G     + N A   +RPPGHH       GFCL +N  +A +     Y   
Sbjct: 164 LETGVDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTY--G 221

Query: 219 VRKILILDWDIHHGNGTQ 236
           V  + +LD+D+HHG+GTQ
Sbjct: 222 VTHVAVLDFDLHHGDGTQ 239

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 8/99 (8%)

Query: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEG----RVKN-ALAVVRPPGHHAEPEAAGG 197
           SGD +Y +S +  + +  +G       ++ +G     + N A   +RPPGHH       G
Sbjct: 146 SGD-IYLSSKTIKALQGTIGAIETGVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSG 204

Query: 198 FCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQ 236
           FCL +N  +A +     Y  +V  +++LD+D+HHG+GTQ
Sbjct: 205 FCLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHGDGTQ 241

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query: 111 SEEILEVHSKEHLDFI-----ESTSKMNREQL-LKATESGDSVYFNSDSYASAKLPVGGA 164
           S  +L+VH K+    +     E+ +K+  +++ + A+ +   +Y +S +  + +  +G  
Sbjct: 103 SPHVLKVHGKDWPPQLLRLCKEADAKLAAKEVEVPASWNAGDIYLSSKTVEALQGSIGAL 162

Query: 165 IEACKAVVEG----RVKN-ALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESV 219
             A  ++ +G     + N A   +RPPGHH       GFCL +N  +A +     +   V
Sbjct: 163 ETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDRF--GV 220

Query: 220 RKILILDWDIHHGNGTQ 236
               ILD+D+HHG+GTQ
Sbjct: 221 THAAILDFDLHHGDGTQ 237

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 179 ALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQ 236
           A   +RPPGHH+      GFCL +N  IA +     Y  +V   ++LD+D+HHG+GTQ
Sbjct: 187 AFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVTHAVVLDFDLHHGDGTQ 242

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 51/106 (48%), Gaps = 8/106 (7%)

Query: 136 QLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEG----RVKN-ALAVVRPPGHHA 190
           ++ K   +GD +Y +S +  + +  +G        +  G     + N    VVRPPGHH 
Sbjct: 136 EVPKEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVVVRPPGHHC 194

Query: 191 EPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQ 236
                 GFCL +N  I+ +     Y   V    ILD+D+HHG+GTQ
Sbjct: 195 HVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQ 238

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 62/138 (44%), Gaps = 15/138 (10%)

Query: 111 SEEILEVHSKEHLDFIESTSKMNREQLLKAT-------ESGDSVYFNSDSYASAKLPVGG 163
           S  +L+VH  E    +    K +  +L +          +GD +Y  S +  + +  +G 
Sbjct: 103 SPHVLKVHGSEWPRTLLQLCKQSDSKLARGEVEVPDNWNAGD-IYLTSRTIEALQGTIGA 161

Query: 164 AIEACKAVVEG----RVKNALAV-VRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPES 218
                 ++  G     + N + V +RPPGHH       GFCL +N  I  +     Y   
Sbjct: 162 VETGVDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--G 219

Query: 219 VRKILILDWDIHHGNGTQ 236
           V   +ILD+D+HHG+GTQ
Sbjct: 220 VTHAVILDFDLHHGDGTQ 237

>KNAG0L00450 Chr12 (67282..68640) [1359 bp, 452 aa] {ON} Anc_7.71
           YOR323C
          Length = 452

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 115 LEVHSKEHLDFIESTSKMNREQLLKATESGDSVYFNSDS 153
           + +HS +H D I S  K N E+ LKA +S D VY+N+ +
Sbjct: 345 INLHSSKHTDCIVSEDKPNAEKFLKAVDSAD-VYWNAST 382

>AFR493C Chr6 complement(1325927..1326901) [975 bp, 324 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR316C
           (TAD3)
          Length = 324

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 122 HLDFIESTSKMNREQLLK--ATESGDSVYFNSDSYASAKLPVGGAIEACK----AVVEGR 175
           H   +    ++ R++L +  A E G SV   +D+Y      V    E C     A++  R
Sbjct: 209 HHSIMNGIKEVARDELQRREAVERGTSV-GRTDTYLCLDFDVYTTHEPCSMCAMALIHSR 267

Query: 176 VKNALAVVRPPGHHA-EPEAAGGFCLFSNVAIAAK 209
           +K  + +   P   A  PE+  G+C+ S+ A+ +K
Sbjct: 268 IKRCIFIQPMPETGALRPESGDGYCMHSSKALNSK 302

>Skud_15.491 Chr15 complement(861268..862638) [1371 bp, 456 aa] {ON}
           YOR323C (REAL)
          Length = 456

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 4/48 (8%)

Query: 109 ATSEEILE---VHSKEHLDFIESTSKMNREQLLKATESGDSVYFNSDS 153
           A++EE ++    HS  H D I + +KMN E+ +K  +S   VY+N+ +
Sbjct: 340 ASTEEAIQHINTHSSRHTDAIVTENKMNAEKFMKGVDSS-GVYWNAST 386

>YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}
           ZIP1Transverse filament protein of the synaptonemal
           complex; required for normal levels of meiotic
           recombination and pairing between homologous chromosome
           during meiosis; potential Cdc28p substrate
          Length = 875

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query: 629 SLVFSNKNHIYWGDKENKKPRK-----KYGRVLRCDTDGISNIMEERFE 672
           S+  S +NH Y  D E   P+K     +Y R+L+ D   I N  +E FE
Sbjct: 71  SMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIENDTDEDFE 119

>CAGL0I01210g Chr9 (99925..101580) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P38818 Saccharomyces cerevisiae
           YHR109w CTM1 cytochrome c methyltransferase
          Length = 551

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 209 KNILKNYPESVRKILILDWDIHHGNGTQK-AFYDDDR-----ILYVSLHRFKMGKYYPGT 262
           +N + NY  +   + ILD+ ++HG+ T + A+YD DR     ILY+ L     GK  P T
Sbjct: 208 ENYMDNYVVTPSLVPILDY-VNHGDKTSRNAYYDVDRRKGDIILYLDLTVVNPGKLKPNT 266

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,470,930
Number of extensions: 3529286
Number of successful extensions: 9456
Number of sequences better than 10.0: 114
Number of HSP's gapped: 9461
Number of HSP's successfully gapped: 123
Length of query: 689
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 572
Effective length of database: 40,065,477
Effective search space: 22917452844
Effective search space used: 22917452844
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)