Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G006402.284ON62162129570.0
NCAS0G038102.284ON66143214360.0
KAFR0H033302.284ON36931213181e-178
TDEL0G021502.284ON66134713451e-178
Suva_9.1042.284ON80531513521e-177
YIL095W (PRK1)2.284ON81031513321e-174
Smik_9.842.284ON80831513261e-173
SAKL0E07722g2.284ON79131513201e-173
NCAS0B062602.284ON72331513121e-172
Skud_14.3092.284ON63930912941e-171
Kwal_27.115422.284ON79131513071e-171
Skud_9.782.284ON80931513061e-170
KAFR0J013702.284ON78031613011e-170
YNL020C (ARK1)2.284ON63830912831e-169
KLTH0G10318g2.284ON79031512911e-168
TPHA0C033802.284ON69731912801e-168
Smik_14.3112.284ON63730912651e-166
Suva_14.3272.284ON63230812641e-166
NDAI0B035602.284ON75631312691e-165
Kpol_1003.352.284ON71331512611e-165
KLLA0E08405g2.284ON77731512571e-163
CAGL0G02607g2.284ON68831512461e-163
KNAG0H020202.284ON59231212301e-162
ADL217W2.284ON75031312211e-158
TBLA0B059302.284ON71731412021e-156
ZYRO0A01848g2.284ON70431511911e-154
Ecym_33232.284ON74835111811e-152
Kpol_1039.332.284ON70133311771e-152
CAGL0J03432g2.284ON62231111381e-148
KNAG0A054302.284ON78831711151e-142
TBLA0B069402.284ON144332111461e-141
TPHA0D015402.284ON70730710731e-137
KNAG0J008203.273ON10913197852e-91
Kpol_251.43.273ON8383117583e-89
KAFR0A010403.273ON9123257535e-88
SAKL0D03234g3.273ON8583087497e-88
KNAG0H012203.273ON9133247466e-87
Kpol_1052.223.273ON11013227492e-86
CAGL0H10208g3.273ON10273217453e-86
Skud_2.1793.273ON10903217466e-86
Suva_4.2973.273ON11073197451e-85
NCAS0A105903.273ON10953207441e-85
TPHA0M011203.273ON7883147292e-85
YBR059C (AKL1)3.273ON11083217396e-85
Smik_2.1913.273ON11083217397e-85
KLLA0F18612g3.273ON8143177222e-84
NDAI0A057003.273ON11573257363e-84
TPHA0A040303.273ON10543537298e-84
TBLA0E025903.273ON10613197291e-83
TBLA0I019303.273ON13613167361e-83
ZYRO0E06864g3.273ON11153197292e-83
KAFR0C004303.273ON9493197205e-83
CAGL0K11990g3.273ON9913227215e-83
KLTH0C07260g3.273ON9013087176e-83
Ecym_26503.273ON8943097151e-82
TDEL0D035203.273ON10493177201e-82
Kwal_27.109453.273ON9353087116e-82
AGR027C3.273ON9613097082e-81
SAKL0A03344g6.262ON3643502361e-20
Kpol_1023.266.31ON7392712386e-20
Kpol_1037.206.31ON7042742332e-19
Kpol_2002.241.24ON4873092303e-19
YPL236C (ENV7)6.262ON3643312253e-19
KAFR0A050906.31ON6682442304e-19
Kwal_56.242746.262ON3463392235e-19
KNAG0F001701.24ON5432962286e-19
Smik_13.1596.31ON7052852297e-19
KNAG0E008506.31ON7112742288e-19
TDEL0A067506.262ON3723012211e-18
KLTH0H03080g6.262ON3463372192e-18
CAGL0J11638g6.31ON7462752262e-18
YMR001C (CDC5)6.31ON7052852252e-18
NDAI0F045201.24ON4892962222e-18
Skud_13.1546.31ON7052852242e-18
TPHA0J004206.31ON7072742243e-18
Suva_13.1636.31ON7052852225e-18
NCAS0D021006.31ON7262902217e-18
NCAS0C041008.141ON9053312209e-18
TDEL0G043806.31ON7222742191e-17
Ecym_10301.24ON4402772151e-17
KAFR0G026906.31ON7132742181e-17
Skud_16.426.262ON3643332131e-17
Kpol_1072.198.668ON8962952182e-17
Ecym_30356.31ON7402742172e-17
TPHA0F024306.31ON7982742172e-17
ACL006W6.31ON7082742162e-17
TPHA0E038501.24ON4821942142e-17
Suva_16.706.262ON3643392112e-17
NDAI0C026806.31ON7502902136e-17
ZYRO0D05500g7.86ON12621792137e-17
KLTH0F16676g5.406ON8782722128e-17
Ecym_21536.262ON3633522079e-17
Kwal_56.224766.31ON6972742119e-17
KLTH0C10912g6.31ON6972742101e-16
Smik_6.4416.262ON3643332042e-16
ZYRO0C07480g6.31ON7742742092e-16
TBLA0A074601.24ON5162682072e-16
AFR724C1.24ON4402782052e-16
KAFR0G012001.24ON5072872053e-16
TBLA0A047207.86ON12621842074e-16
CAGL0F00913g7.86ON12061832074e-16
ZYRO0F18062g1.24ON4711992035e-16
NCAS0A002801.24ON5352822045e-16
KLLA0C06138g6.31ON7082852056e-16
Kwal_33.131121.24ON5052922037e-16
SAKL0C00946g1.24ON5642482037e-16
SAKL0H06754g8.668ON8842102047e-16
Kwal_26.71547.86ON12131792058e-16
KLLA0C01650g1.52ON11122092048e-16
Kwal_55.215455.406ON8652932048e-16
TPHA0E036401.52ON11372342041e-15
KNAG0D048107.86ON14401762031e-15
TDEL0C067801.24ON4683122001e-15
KLLA0F07623g7.86ON12291922031e-15
KNAG0F002901.52ON11253002031e-15
NDAI0G034508.141ON9483242022e-15
AFL101C6.222ON3672751952e-15
CAGL0K02673g2.496ON9152482002e-15
CAGL0K05709g1.52ON11032352003e-15
YOL045W (PSK2)7.86ON11011832003e-15
SAKL0E01584g6.31ON6952741993e-15
Ecym_10581.52ON11642362003e-15
YDR523C (SPS1)1.24ON4901981973e-15
KNAG0L005207.86ON3681791943e-15
Skud_4.7971.24ON4851981964e-15
AFR696C1.52ON11422091994e-15
Suva_2.7031.24ON4851981964e-15
KAFR0D033902.496ON7982751984e-15
SAKL0C01716g1.52ON12152331985e-15
ZYRO0F07194g8.668ON9382971975e-15
Smik_4.8031.24ON4901981956e-15
TDEL0H036407.86ON12371831976e-15
ZYRO0E07876g6.262ON3693411926e-15
KAFR0D012207.86ON10551911967e-15
Smik_3.541.52ON10322571968e-15
TBLA0B004906.31ON7872901958e-15
KLLA0F14190g1.271ON13382241968e-15
NCAS0G012106.262ON3673481901e-14
KLTH0D02486g7.86ON12231791951e-14
Kwal_26.78612.496ON9552701941e-14
YCL024W (KCC4)1.52ON10372551941e-14
Suva_16.1608.668ON9182951941e-14
SAKL0F11110g7.335ON4612701911e-14
KLTH0F00946g1.24ON5122071921e-14
NDAI0A019707.335ON6381941922e-14
YDR507C (GIN4)1.52ON11422351932e-14
TPHA0G032902.496ON9732891932e-14
Kwal_26.87518.668ON8482011922e-14
CAGL0K08514g2.479ON14892131932e-14
Suva_2.6871.52ON11282271922e-14
Skud_3.1656.371ON7161961912e-14
Smik_4.7891.52ON11362351923e-14
KLLA0A07403g3.60ON8792901913e-14
NDAI0K021002.496ON9092711913e-14
Kwal_26.73551.271ON14462581923e-14
Kpol_1072.318.652ON5262531893e-14
KLTH0D11044g8.668ON8492091913e-14
Suva_15.1247.86ON11061801914e-14
TBLA0A071501.52ON13912351914e-14
TDEL0A025502.479ON13692001914e-14
Skud_10.1191.271ON14812611914e-14
KNAG0D008306.262ON3873401864e-14
Kpol_1055.242.496ON9372681904e-14
Skud_4.7831.52ON11352351904e-14
NCAS0B086001.52ON11172351905e-14
NDAI0A006601.52ON10222281895e-14
Skud_16.1328.668ON9242931895e-14
Kwal_47.183075.591ON6212741885e-14
Skud_3.391.52ON10172411895e-14
TPHA0H026307.86ON13671821896e-14
TDEL0A027202.496ON9152711896e-14
Kpol_431.92.479ON15522001896e-14
NCAS0I004707.86ON10823001896e-14
KAFR0B028008.279ON10952241896e-14
Smik_3.1896.371ON7191951886e-14
KAFR0A037108.652ON4932521866e-14
Sklu_YGOB_Anc_2.4962.496ON6192801876e-14
KLTH0F01672g1.52ON11642251887e-14
Kpol_1065.36.222ON3762781847e-14
KLTH0G05214g5.591ON6532831877e-14
NDAI0F013406.262ON4061551847e-14
TBLA0E022907.86ON13001841887e-14
Smik_8.422.496ON9392801887e-14
AER223C3.177ON9021951888e-14
Suva_1.507.86ON13601761888e-14
NCAS0C016708.668ON8962941878e-14
Skud_1.447.86ON13561751889e-14
TBLA0D022308.141ON11543111879e-14
Smik_15.1227.86ON11011811879e-14
YAR019C (CDC15)3.177ON9742841879e-14
YCR091W (KIN82)6.371ON7201971861e-13
KAFR0K007007.86ON13811901871e-13
SAKL0B09856g7.86ON12741791871e-13
CAGL0M02299g8.668ON8932911871e-13
KNAG0B053502.496ON8362731861e-13
NDAI0H024707.86ON14111821871e-13
Kpol_463.81.271ON14473071871e-13
Smik_1.793.177ON9742831861e-13
Smik_10.1471.271ON14782701861e-13
KLTH0D06006g2.496ON9542701851e-13
TPHA0G032002.479ON15342011861e-13
Suva_11.1232.479ON15262351862e-13
Suva_6.1691.271ON14842611852e-13
KAFR0C014403.92ON10952701852e-13
TPHA0I009201.271ON14342591852e-13
ACR281C7.86ON12591761852e-13
KLTH0D03454g1.271ON14332791852e-13
YAL017W (PSK1)7.86ON13561751852e-13
Kpol_1040.207.86ON12971781852e-13
Skud_8.392.496ON9232801842e-13
NCAS0A102903.229ON5092001822e-13
ACL104C5.406ON9472041842e-13
ZYRO0D06776g8.279ON12042221842e-13
Skud_1.723.177ON9742911842e-13
KAFR0F039704.192ON3842271802e-13
Ecym_52513.177ON8931961832e-13
Smik_6.3478.668ON9172951832e-13
Smik_1.507.86ON13571751842e-13
ABL034W2.479ON14252011842e-13
Skud_15.1127.86ON11011811833e-13
ABR014W2.496ON9712251833e-13
Ecym_26407.86ON13251761833e-13
Suva_3.1901.52ON10242571833e-13
KLLA0C08525g6.341ON15512951833e-13
KAFR0H025108.668ON8792981833e-13
YHL007C (STE20)2.496ON9392801823e-13
AER264C6.341ON14832821833e-13
TPHA0L005007.86ON9591811823e-13
ZYRO0B01166g2.496ON9632701824e-13
KAFR0E010403.229ON5022031804e-13
YHR102W (KIC1)5.406ON10803071824e-13
ZYRO0C06776g5.591ON8902741814e-13
Suva_15.2975.406ON10742041815e-13
YPL150W8.668ON9012951815e-13
ACR133C8.668ON8511971815e-13
Kwal_26.77882.479ON12672001815e-13
Ecym_55055.406ON10031981815e-13
Kpol_2002.461.52ON11232551815e-13
ZYRO0A06446g5.406ON9432041815e-13
CAGL0L03520g1.271ON14472831815e-13
KLLA0F11319g8.668ON8431931805e-13
YGL180W (ATG1)8.141ON8973141806e-13
Ecym_60406.371ON8961941806e-13
KNAG0D040404.192ON4382341786e-13
AFR092W1.271ON14232811816e-13
Smik_6.3388.652ON5112301786e-13
Kpol_1044.37.86ON9321791806e-13
TDEL0D053203.92ON10571981807e-13
KAFR0D032002.479ON14481981807e-13
KNAG0I026706.371ON9081981807e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00640
         (621 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284   1143   0.0  
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   557   0.0  
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   512   e-178
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   522   e-178
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   525   e-177
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   517   e-174
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   515   e-173
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   513   e-173
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   509   e-172
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   503   e-171
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   508   e-171
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   507   e-170
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   505   e-170
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   498   e-169
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   501   e-168
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   497   e-168
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   491   e-166
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   491   e-166
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   493   e-165
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   490   e-165
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   488   e-163
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   484   e-163
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   478   e-162
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   474   e-158
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   467   e-156
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   463   e-154
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   459   e-152
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   457   e-152
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   442   e-148
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   434   e-142
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   446   e-141
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   417   e-137
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   306   2e-91
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   296   3e-89
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   294   5e-88
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   293   7e-88
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   291   6e-87
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   293   2e-86
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   291   3e-86
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   291   6e-86
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   291   1e-85
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   291   1e-85
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   285   2e-85
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   289   6e-85
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   289   7e-85
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   282   2e-84
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   288   3e-84
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   285   8e-84
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   285   1e-83
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   288   1e-83
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   285   2e-83
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   281   5e-83
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   282   5e-83
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   280   6e-83
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   280   1e-82
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   281   1e-82
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   278   6e-82
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   277   2e-81
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    96   1e-20
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    96   6e-20
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    94   2e-19
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    93   3e-19
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    91   3e-19
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             93   4e-19
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    91   5e-19
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    92   6e-19
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    93   7e-19
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    92   8e-19
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    90   1e-18
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    89   2e-18
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    92   2e-18
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    91   2e-18
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    90   2e-18
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    91   2e-18
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    91   3e-18
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    90   5e-18
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      90   7e-18
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     89   9e-18
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    89   1e-17
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    87   1e-17
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    89   1e-17
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    87   1e-17
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    89   2e-17
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    88   2e-17
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    88   2e-17
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    88   2e-17
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    87   2e-17
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    86   2e-17
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    87   6e-17
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    87   7e-17
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    86   8e-17
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    84   9e-17
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    86   9e-17
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    86   1e-16
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    83   2e-16
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    85   2e-16
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    84   2e-16
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    84   2e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    84   3e-16
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    84   4e-16
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    84   4e-16
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    83   5e-16
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        83   5e-16
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    84   6e-16
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    83   7e-16
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    83   7e-16
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    83   7e-16
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    84   8e-16
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    83   8e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    83   8e-16
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    83   1e-15
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    83   1e-15
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    82   1e-15
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    83   1e-15
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    83   1e-15
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     82   2e-15
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    80   2e-15
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    82   2e-15
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    82   3e-15
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    82   3e-15
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    81   3e-15
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    82   3e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    80   3e-15
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    79   3e-15
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    80   4e-15
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    81   4e-15
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    80   4e-15
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    81   4e-15
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    81   5e-15
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    80   5e-15
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    80   6e-15
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    80   6e-15
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    79   6e-15
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    80   7e-15
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    80   8e-15
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    80   8e-15
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    80   8e-15
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    78   1e-14
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    80   1e-14
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    79   1e-14
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    79   1e-14
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    79   1e-14
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    78   1e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    79   1e-14
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     79   2e-14
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    79   2e-14
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    79   2e-14
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    79   2e-14
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    79   2e-14
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    79   2e-14
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    78   2e-14
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    79   3e-14
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    78   3e-14
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    78   3e-14
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    79   3e-14
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    77   3e-14
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    78   3e-14
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    78   4e-14
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    78   4e-14
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    78   4e-14
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    78   4e-14
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    76   4e-14
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    78   4e-14
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    78   4e-14
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    78   5e-14
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     77   5e-14
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    77   5e-14
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    77   5e-14
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    77   5e-14
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    77   6e-14
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    77   6e-14
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    77   6e-14
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       77   6e-14
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    77   6e-14
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    77   6e-14
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    76   6e-14
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    77   6e-14
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    77   7e-14
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    75   7e-14
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    77   7e-14
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    75   7e-14
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    77   7e-14
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    77   7e-14
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    77   8e-14
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    77   8e-14
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    77   8e-14
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    77   9e-14
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    77   9e-14
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    77   9e-14
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    77   9e-14
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    76   1e-13
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    77   1e-13
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    77   1e-13
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    77   1e-13
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    76   1e-13
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    77   1e-13
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    77   1e-13
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    76   1e-13
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    76   1e-13
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    76   1e-13
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    76   1e-13
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    76   2e-13
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    76   2e-13
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    76   2e-13
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    76   2e-13
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    76   2e-13
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    76   2e-13
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    76   2e-13
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    76   2e-13
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    75   2e-13
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    75   2e-13
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    75   2e-13
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    75   2e-13
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    75   2e-13
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    74   2e-13
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    75   2e-13
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    75   2e-13
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    75   2e-13
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    75   2e-13
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    75   3e-13
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    75   3e-13
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    75   3e-13
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    75   3e-13
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    75   3e-13
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    75   3e-13
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    75   3e-13
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    75   3e-13
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    75   3e-13
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    75   4e-13
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    74   4e-13
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    75   4e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    74   4e-13
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    74   5e-13
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    74   5e-13
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    74   5e-13
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    74   5e-13
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    74   5e-13
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    74   5e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    74   5e-13
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    74   5e-13
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    74   5e-13
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    74   6e-13
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    74   6e-13
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    73   6e-13
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    74   6e-13
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    73   6e-13
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    74   6e-13
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    74   7e-13
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    74   7e-13
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    74   7e-13
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    74   7e-13
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    74   7e-13
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     72   7e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    74   8e-13
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    74   8e-13
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    74   8e-13
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    73   8e-13
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    74   9e-13
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    74   9e-13
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    73   9e-13
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    73   1e-12
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    73   1e-12
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    73   1e-12
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    73   1e-12
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    73   1e-12
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    73   1e-12
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    72   1e-12
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    73   1e-12
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    73   1e-12
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    73   1e-12
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    73   1e-12
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    73   1e-12
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    73   1e-12
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    73   1e-12
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    73   2e-12
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    73   2e-12
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    72   2e-12
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    72   2e-12
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    73   2e-12
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    72   2e-12
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    72   2e-12
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    72   2e-12
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    72   2e-12
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    72   2e-12
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    72   2e-12
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    72   2e-12
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    72   2e-12
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     72   2e-12
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    72   2e-12
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    71   2e-12
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    72   2e-12
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    72   3e-12
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    72   3e-12
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    72   3e-12
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    72   3e-12
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    72   3e-12
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    70   3e-12
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    71   3e-12
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    72   3e-12
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    72   3e-12
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    71   3e-12
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    72   3e-12
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    72   3e-12
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    71   3e-12
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    72   3e-12
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    72   3e-12
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    71   4e-12
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    72   4e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    71   4e-12
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    72   4e-12
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    71   4e-12
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    71   4e-12
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    72   4e-12
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               71   4e-12
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    70   4e-12
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    71   4e-12
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    71   4e-12
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    71   5e-12
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    71   5e-12
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    71   5e-12
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    71   5e-12
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    71   5e-12
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    71   5e-12
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    71   5e-12
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    71   5e-12
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    71   5e-12
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    71   5e-12
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    71   5e-12
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    71   6e-12
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    71   6e-12
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    71   6e-12
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    71   6e-12
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    71   6e-12
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    71   6e-12
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    70   7e-12
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    70   7e-12
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    70   8e-12
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    70   8e-12
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    70   8e-12
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    69   8e-12
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    70   8e-12
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    70   8e-12
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    70   8e-12
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    69   8e-12
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    70   8e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    70   9e-12
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    70   9e-12
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    70   1e-11
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    70   1e-11
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     69   1e-11
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    70   1e-11
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    70   1e-11
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    70   1e-11
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    69   1e-11
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    69   1e-11
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    70   1e-11
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    70   1e-11
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    70   1e-11
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    70   1e-11
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    70   1e-11
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    70   1e-11
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    70   1e-11
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    70   1e-11
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    70   1e-11
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    70   1e-11
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    70   1e-11
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    70   1e-11
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              70   1e-11
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    69   1e-11
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    69   2e-11
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    69   2e-11
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    69   2e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    69   2e-11
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    70   2e-11
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    69   2e-11
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    70   2e-11
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    68   2e-11
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    70   2e-11
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    68   2e-11
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    69   2e-11
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    69   2e-11
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    69   2e-11
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    69   2e-11
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    69   2e-11
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    69   2e-11
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    69   2e-11
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    69   2e-11
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    69   2e-11
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    69   2e-11
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    69   2e-11
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    69   2e-11
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    69   2e-11
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    69   2e-11
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    69   2e-11
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    69   2e-11
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    68   2e-11
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    69   2e-11
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    68   3e-11
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    69   3e-11
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    68   3e-11
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    68   3e-11
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    68   3e-11
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    67   3e-11
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    68   3e-11
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    68   3e-11
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    67   3e-11
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    68   4e-11
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    68   4e-11
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    68   4e-11
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    68   4e-11
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    68   4e-11
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    69   4e-11
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    68   4e-11
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    67   4e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    68   4e-11
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    67   4e-11
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    68   4e-11
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    67   4e-11
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    67   4e-11
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    68   4e-11
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    68   4e-11
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    68   4e-11
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    67   5e-11
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    68   5e-11
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    67   5e-11
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    67   5e-11
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    68   5e-11
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    68   5e-11
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    68   5e-11
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    68   5e-11
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    67   5e-11
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    68   5e-11
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    67   5e-11
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    68   5e-11
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    68   5e-11
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    68   6e-11
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    67   6e-11
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    68   6e-11
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    68   6e-11
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    67   6e-11
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    67   6e-11
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    67   6e-11
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    67   6e-11
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     67   7e-11
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    67   7e-11
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    67   7e-11
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    67   7e-11
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      68   7e-11
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    67   7e-11
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    66   7e-11
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    67   7e-11
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    67   7e-11
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    67   7e-11
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    67   8e-11
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    66   8e-11
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    66   8e-11
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    67   8e-11
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    66   8e-11
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    67   8e-11
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     66   8e-11
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    66   9e-11
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    67   9e-11
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    67   9e-11
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    67   9e-11
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    67   9e-11
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    67   1e-10
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    66   1e-10
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    66   1e-10
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    67   1e-10
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              67   1e-10
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    67   1e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    66   1e-10
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    67   1e-10
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    67   1e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    67   1e-10
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    65   1e-10
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    66   1e-10
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    67   1e-10
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    66   1e-10
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    67   1e-10
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    66   1e-10
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    67   1e-10
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    66   1e-10
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    65   2e-10
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    66   2e-10
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    66   2e-10
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    66   2e-10
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    66   2e-10
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    65   2e-10
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    66   2e-10
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    65   2e-10
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    65   2e-10
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    66   2e-10
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    66   2e-10
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    66   2e-10
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    65   2e-10
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    66   2e-10
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    66   2e-10
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    65   2e-10
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    65   2e-10
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    66   2e-10
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     66   2e-10
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    64   2e-10
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    65   2e-10
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    65   2e-10
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    65   2e-10
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    65   2e-10
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               65   2e-10
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    65   2e-10
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    65   3e-10
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    65   3e-10
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    65   3e-10
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       65   3e-10
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    64   3e-10
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               65   3e-10
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    65   3e-10
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    64   3e-10
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    65   3e-10
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    65   3e-10
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    65   3e-10
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    64   3e-10
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    65   3e-10
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              64   3e-10
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    65   3e-10
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    65   4e-10
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    65   4e-10
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    65   4e-10
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    64   4e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    65   4e-10
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    65   4e-10
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    65   4e-10
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    65   4e-10
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    65   4e-10
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    65   4e-10
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    65   4e-10
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    65   4e-10
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    65   4e-10
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    65   4e-10
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    65   4e-10
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    65   4e-10
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    65   4e-10
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    65   4e-10
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    65   4e-10
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    64   5e-10
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    65   5e-10
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    65   5e-10
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    64   5e-10
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    65   5e-10
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    65   5e-10
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    64   5e-10
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    65   5e-10
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    64   5e-10
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    64   5e-10
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    64   5e-10
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    64   5e-10
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     64   6e-10
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    64   6e-10
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    64   6e-10
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    64   6e-10
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    64   6e-10
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    64   6e-10
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    64   6e-10
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    64   6e-10
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    64   6e-10
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    64   6e-10
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    64   6e-10
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    64   6e-10
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    64   6e-10
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    64   6e-10
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    64   7e-10
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    63   7e-10
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    63   7e-10
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               64   7e-10
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    63   7e-10
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    64   7e-10
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    64   7e-10
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    64   8e-10
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    64   8e-10
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    64   8e-10
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    64   8e-10
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    64   8e-10
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    64   8e-10
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    63   8e-10
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    64   8e-10
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    64   8e-10
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    64   8e-10
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    64   9e-10
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    64   9e-10
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    63   9e-10
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    64   9e-10
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    63   9e-10
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     64   9e-10
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    63   9e-10
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    64   9e-10
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    64   9e-10
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    63   9e-10
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    63   9e-10
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    64   1e-09
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    64   1e-09
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     62   1e-09
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    64   1e-09
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    63   1e-09
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    64   1e-09
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    64   1e-09
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    63   1e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    62   1e-09
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    64   1e-09
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    64   1e-09
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    63   1e-09
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    63   1e-09
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    62   1e-09
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    63   1e-09
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    64   1e-09
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    64   1e-09
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    63   1e-09
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    63   1e-09
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    64   1e-09
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               63   1e-09
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    63   1e-09
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    62   1e-09
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    63   1e-09
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    63   1e-09
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    63   1e-09
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    63   1e-09
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    61   1e-09
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    63   1e-09
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    62   2e-09
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    63   2e-09
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    62   2e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    62   2e-09
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    63   2e-09
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    62   2e-09
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    63   2e-09
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    63   2e-09
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    62   2e-09
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    63   2e-09
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    62   2e-09
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    62   2e-09
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    63   2e-09
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    62   2e-09
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    63   2e-09
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    63   2e-09
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    62   2e-09
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    62   2e-09
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    62   2e-09
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    62   2e-09
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    62   2e-09
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    62   2e-09
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    63   2e-09
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    63   2e-09
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    62   2e-09
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    62   2e-09
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    62   2e-09
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    62   2e-09
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    63   2e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    62   2e-09
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    62   2e-09
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    62   2e-09
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    62   2e-09
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    62   2e-09
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    62   2e-09
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    61   2e-09
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    62   3e-09
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    62   3e-09
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    62   3e-09
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    62   3e-09
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    62   3e-09
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    62   3e-09
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    62   3e-09
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    61   3e-09
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    62   3e-09
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    62   3e-09
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    60   3e-09
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    62   3e-09
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    62   3e-09
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    62   3e-09
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    62   3e-09
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    62   3e-09
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    62   3e-09
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    62   3e-09
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    62   3e-09
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    62   3e-09
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    61   3e-09
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    61   3e-09
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    61   3e-09
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    62   3e-09
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    62   3e-09
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    62   3e-09
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    62   3e-09
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    62   3e-09
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    62   3e-09
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    62   4e-09
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    62   4e-09
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    61   4e-09
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    62   4e-09
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    62   4e-09
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    62   4e-09
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    60   4e-09
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    61   4e-09
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    62   4e-09
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    61   4e-09
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    60   4e-09
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    61   4e-09
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    60   4e-09
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               61   4e-09
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    61   4e-09
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    62   5e-09
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    60   5e-09
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    61   5e-09
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    61   5e-09
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    61   5e-09
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    62   5e-09
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    61   5e-09
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    60   5e-09
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    60   5e-09
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    60   6e-09
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    60   6e-09
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    61   6e-09
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    61   6e-09
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    58   6e-09
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    61   6e-09
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    59   6e-09
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    61   6e-09
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    61   7e-09
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    61   7e-09
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    60   7e-09
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    60   7e-09
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    61   8e-09
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    60   8e-09
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    61   8e-09
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    61   8e-09
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    60   8e-09
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    60   8e-09
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    61   8e-09
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    60   9e-09
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    61   9e-09
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    60   9e-09
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    61   9e-09
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    60   9e-09
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    60   9e-09
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    60   9e-09
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    60   9e-09
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    60   1e-08
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    60   1e-08
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    60   1e-08
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     60   1e-08
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    60   1e-08
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    60   1e-08
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    60   1e-08
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    60   1e-08
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    60   1e-08
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    60   1e-08
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    60   1e-08
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    60   1e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    59   1e-08
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    60   1e-08
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    60   1e-08
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    60   1e-08
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    59   1e-08
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    60   1e-08
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              60   1e-08
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    60   1e-08
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    58   1e-08
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    60   1e-08
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    59   2e-08
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    60   2e-08
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               60   2e-08
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    60   2e-08
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    60   2e-08
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    60   2e-08
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    60   2e-08
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    60   2e-08
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    58   2e-08
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    59   2e-08
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    58   2e-08
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    59   2e-08
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    59   2e-08
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    59   2e-08
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              59   2e-08
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    59   2e-08
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    59   2e-08
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    59   2e-08
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    59   2e-08
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    59   2e-08
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    59   2e-08
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    59   2e-08
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    59   2e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    59   2e-08
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    59   2e-08
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    59   2e-08
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    59   2e-08
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    59   2e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               58   2e-08
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    59   2e-08
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    59   2e-08
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    59   2e-08
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    59   2e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    59   3e-08
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              59   3e-08
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    59   3e-08
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    59   3e-08
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    58   3e-08
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    58   3e-08
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    59   3e-08
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    59   3e-08
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    59   3e-08
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    59   3e-08
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    57   3e-08
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    58   3e-08
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    59   3e-08
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    59   3e-08
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    59   3e-08
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    59   3e-08
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    58   4e-08
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    59   4e-08
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    58   4e-08
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    59   4e-08
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    58   4e-08
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    58   4e-08
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    58   4e-08
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    57   4e-08
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     58   4e-08
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    58   4e-08
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    58   4e-08
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    58   4e-08
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    58   4e-08
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    58   4e-08
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    57   4e-08
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    57   4e-08
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    58   4e-08
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    58   4e-08
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    58   5e-08
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    59   5e-08
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    58   5e-08
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    58   5e-08
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    57   5e-08
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    58   5e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    58   5e-08
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    58   5e-08
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    58   5e-08
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    58   5e-08
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    58   5e-08
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    58   5e-08
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              58   5e-08
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    57   6e-08
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    58   6e-08
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    57   6e-08
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    58   6e-08
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    58   6e-08
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    58   6e-08
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    57   6e-08
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               57   6e-08
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     58   6e-08
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    58   6e-08
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    57   6e-08
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    57   7e-08
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    58   7e-08
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    57   7e-08
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    58   7e-08
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    57   7e-08
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    57   7e-08
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    57   7e-08
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    57   7e-08
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    57   7e-08
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    56   8e-08
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    57   8e-08
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    57   8e-08
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    57   8e-08
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              58   8e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    57   8e-08
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    57   8e-08
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    57   8e-08
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    57   9e-08
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    57   9e-08
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    57   9e-08
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    57   9e-08
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    57   9e-08
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    57   9e-08
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    57   1e-07
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    57   1e-07
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    57   1e-07
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    57   1e-07
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    57   1e-07
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    57   1e-07
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    57   1e-07
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    57   1e-07
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    56   1e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    57   1e-07
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    57   1e-07
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    57   1e-07
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    57   1e-07
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     57   1e-07
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    57   1e-07
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     56   1e-07
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    57   1e-07
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    57   1e-07
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    57   1e-07
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    57   1e-07
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    56   1e-07
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    57   1e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    57   1e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    56   1e-07
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    57   1e-07
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    56   2e-07
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    56   2e-07
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    56   2e-07
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    56   2e-07
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    56   2e-07
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    56   2e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    56   2e-07
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    57   2e-07
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    56   2e-07
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    56   2e-07
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    56   2e-07
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    55   2e-07
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    56   2e-07
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    56   2e-07
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    56   2e-07
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    56   2e-07
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    56   2e-07
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    56   2e-07
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    56   2e-07
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    56   2e-07
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    56   2e-07
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    55   2e-07
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    56   2e-07
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    56   2e-07
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    56   2e-07
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    56   2e-07
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    56   2e-07
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    56   2e-07
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    55   2e-07
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    56   2e-07
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    55   2e-07
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    55   2e-07
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    56   2e-07
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    56   2e-07
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    55   3e-07
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    55   3e-07
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    55   3e-07
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    55   3e-07
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    55   3e-07
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    55   3e-07
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    54   3e-07
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    55   3e-07
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    55   3e-07
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    55   3e-07
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    55   3e-07
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    56   3e-07
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    55   3e-07
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    55   3e-07
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    55   3e-07
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    56   3e-07
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    55   3e-07
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    54   3e-07
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    55   3e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    55   3e-07
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    55   3e-07
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    55   3e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    55   3e-07
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    54   3e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    55   3e-07
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    55   3e-07
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    55   3e-07
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    55   3e-07
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    55   3e-07
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    55   3e-07
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    55   3e-07
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    55   3e-07
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    55   3e-07
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    55   3e-07
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    55   4e-07
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    55   4e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    55   4e-07
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    55   4e-07
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    55   4e-07
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    55   4e-07
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    55   4e-07
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    55   4e-07
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    55   4e-07
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    54   4e-07
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     55   4e-07
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    55   4e-07
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    55   4e-07
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    55   4e-07
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    55   4e-07
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    55   5e-07
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    55   5e-07
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    55   5e-07
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    55   5e-07
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    55   5e-07
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    55   5e-07
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    55   5e-07
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    54   5e-07
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    55   5e-07
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    55   5e-07
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    55   5e-07
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    55   5e-07
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    55   6e-07
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    55   6e-07
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    54   6e-07
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    54   6e-07
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    55   6e-07
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    54   6e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    54   6e-07
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    55   7e-07
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    54   7e-07
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    54   7e-07
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    54   7e-07
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    54   7e-07
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    54   7e-07
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    54   7e-07
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    54   7e-07
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    54   7e-07
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    54   7e-07
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    55   7e-07
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    54   7e-07
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    54   7e-07
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    54   7e-07
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    54   8e-07
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    54   8e-07
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    54   8e-07
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    54   8e-07
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    54   8e-07
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    54   8e-07
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    54   8e-07
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    54   9e-07
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    54   9e-07
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    54   9e-07
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               54   9e-07
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    53   9e-07
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    54   9e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    54   9e-07
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    54   9e-07
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    54   9e-07
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    54   1e-06
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    54   1e-06
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    54   1e-06
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    54   1e-06
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    54   1e-06
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    54   1e-06
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    54   1e-06
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    53   1e-06
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    54   1e-06
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    53   1e-06
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    54   1e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    54   1e-06
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    53   1e-06
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    54   1e-06
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    53   1e-06
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    54   1e-06
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    54   1e-06
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               53   1e-06
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    54   1e-06
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    54   1e-06
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    54   1e-06
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    54   1e-06
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    54   1e-06
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    54   1e-06
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    53   1e-06
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    54   1e-06
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               53   1e-06
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    53   1e-06
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    53   2e-06
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    53   2e-06
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    53   2e-06
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    53   2e-06
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    53   2e-06
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    52   2e-06
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    53   2e-06
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    53   2e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    53   2e-06
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    52   2e-06
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    53   2e-06
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    53   2e-06
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    53   2e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    53   2e-06
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    53   2e-06
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    52   2e-06
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    53   2e-06
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    53   2e-06
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    52   2e-06
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    53   2e-06
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     53   2e-06
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    53   2e-06
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    52   2e-06
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    53   2e-06
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    53   2e-06
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    52   2e-06
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    52   2e-06
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    49   2e-06
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    52   3e-06
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    52   3e-06
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               52   3e-06
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    52   3e-06
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    52   3e-06
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    52   3e-06
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    52   3e-06
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    52   3e-06
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    52   3e-06
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    52   3e-06
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    52   3e-06
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    52   3e-06
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    52   3e-06
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    52   3e-06
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    52   3e-06
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    52   3e-06
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    52   3e-06
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    52   3e-06
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    51   3e-06
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    52   4e-06
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    52   4e-06
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    52   4e-06
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             52   4e-06
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    52   4e-06
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    52   4e-06
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    52   4e-06
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    52   4e-06
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    52   4e-06
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              52   4e-06
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    52   4e-06
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    51   4e-06
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    52   4e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    52   4e-06
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    51   4e-06
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    52   4e-06
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    51   4e-06
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    52   5e-06
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    52   5e-06
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    51   5e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    51   5e-06
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    52   5e-06
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    52   5e-06
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    52   5e-06
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    51   5e-06
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    51   5e-06
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    51   5e-06
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    51   5e-06
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    52   5e-06
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    51   5e-06
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    52   5e-06
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    52   5e-06
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    51   6e-06
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    52   6e-06
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    51   6e-06
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    52   6e-06
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    51   6e-06
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    51   6e-06
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    51   6e-06
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    51   6e-06
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    51   6e-06
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    51   6e-06
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    51   6e-06
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    51   6e-06
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    50   6e-06
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    51   6e-06
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    51   6e-06
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    50   7e-06
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    50   7e-06
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    51   7e-06
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    51   7e-06
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    51   7e-06
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       51   7e-06
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    51   7e-06
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    51   7e-06
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    51   7e-06
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    51   7e-06
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    51   8e-06
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    51   8e-06
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    51   8e-06
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    51   8e-06
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    51   8e-06
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    50   8e-06
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    51   8e-06
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    50   8e-06
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    50   8e-06
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    51   8e-06
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    50   9e-06
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    51   9e-06
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     51   9e-06
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    51   9e-06
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    50   9e-06
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    50   9e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     50   9e-06
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    50   1e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    50   1e-05
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    51   1e-05
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    50   1e-05
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    51   1e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    50   1e-05
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    50   1e-05
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    51   1e-05
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    50   1e-05
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    50   1e-05
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               50   1e-05
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    50   1e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    50   1e-05
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    50   1e-05
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    50   1e-05
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    50   1e-05
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    50   1e-05
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    50   1e-05
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    50   1e-05
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    50   1e-05
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              50   1e-05
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    50   1e-05
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    50   1e-05
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    50   1e-05
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    50   1e-05
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    50   1e-05
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    50   1e-05
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    50   1e-05
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    50   1e-05
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    49   1e-05
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     50   1e-05
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    50   1e-05
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    50   1e-05
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    50   1e-05
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    50   1e-05
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    50   1e-05
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    50   1e-05
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    50   1e-05
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    50   1e-05
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    50   1e-05
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    50   1e-05
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    49   1e-05
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    50   1e-05
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    50   1e-05
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    50   2e-05
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    50   2e-05
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    50   2e-05
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    49   2e-05
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    50   2e-05
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    50   2e-05
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    50   2e-05
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    50   2e-05
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    50   2e-05
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    49   2e-05
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    50   2e-05
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    50   2e-05
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    49   2e-05
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    49   2e-05
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    50   2e-05
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    50   2e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    50   2e-05
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    49   2e-05
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    50   2e-05
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    49   2e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    50   2e-05
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    49   2e-05
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    50   2e-05
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    50   2e-05
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    49   2e-05
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    50   2e-05
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    50   2e-05
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    49   2e-05
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    50   2e-05
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    50   2e-05
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    49   2e-05
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    49   2e-05
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    49   2e-05
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    49   2e-05
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    49   2e-05
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    49   2e-05
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    50   2e-05
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    49   2e-05
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    49   2e-05
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    49   2e-05
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    49   2e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    49   2e-05
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    49   2e-05
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     49   2e-05
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    49   2e-05
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    49   2e-05
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    49   2e-05
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    49   2e-05
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    49   2e-05
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    49   3e-05
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    49   3e-05
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    49   3e-05
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    49   3e-05
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    49   3e-05
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    49   3e-05
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    49   3e-05
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    49   3e-05
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    49   3e-05
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    49   3e-05
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    49   3e-05
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    49   3e-05
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    49   3e-05
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    49   3e-05
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    49   3e-05
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    48   3e-05
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    49   3e-05
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    49   3e-05
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    49   3e-05
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    49   3e-05
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    49   3e-05
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    49   3e-05
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    49   3e-05
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    49   3e-05
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    49   3e-05
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    49   3e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    49   3e-05
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    49   3e-05
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    49   3e-05
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    48   3e-05
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    49   3e-05
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    49   3e-05
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    49   3e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    48   3e-05
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    49   3e-05
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    49   3e-05
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    49   4e-05
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    49   4e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    49   4e-05
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    48   4e-05
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    49   4e-05
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    48   4e-05
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    48   4e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    49   4e-05
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    49   4e-05
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    49   4e-05
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    48   4e-05
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    48   4e-05
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    48   4e-05
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    48   4e-05
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    49   4e-05
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    49   4e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    48   4e-05
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    48   5e-05
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    48   5e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    48   5e-05
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    49   5e-05
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               48   5e-05
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    49   5e-05
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    49   5e-05
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    48   5e-05
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    49   5e-05
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    49   5e-05
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    48   5e-05
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    48   5e-05
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    48   5e-05
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    48   5e-05
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    48   5e-05
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    48   5e-05
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    48   5e-05
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    48   5e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    48   5e-05
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     48   5e-05
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    49   5e-05
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    49   6e-05
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               48   6e-05
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    48   6e-05
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               48   6e-05
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    47   6e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    48   6e-05
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    48   6e-05
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    48   6e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    48   6e-05
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    48   6e-05
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    47   6e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    48   6e-05
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    48   6e-05
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    48   6e-05
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    48   6e-05
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    48   6e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    48   6e-05
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    48   7e-05
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    48   7e-05
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    48   7e-05
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    48   7e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    47   7e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    48   7e-05
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    48   7e-05
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    48   7e-05
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    48   7e-05
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    47   7e-05
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    48   7e-05
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    48   7e-05
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    48   7e-05
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    48   7e-05
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    48   7e-05
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    47   7e-05
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    47   8e-05
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    47   8e-05
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    48   8e-05
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    47   8e-05
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    48   8e-05
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    48   8e-05
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    47   8e-05
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    47   8e-05
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    47   8e-05
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      48   8e-05
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      48   8e-05
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    47   9e-05
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    47   9e-05
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    47   9e-05
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    47   9e-05
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    47   9e-05
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    47   9e-05
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    47   9e-05
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    47   9e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    47   1e-04
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    47   1e-04
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    47   1e-04
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    47   1e-04
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    47   1e-04
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    47   1e-04
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    47   1e-04
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    47   1e-04
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    47   1e-04
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    47   1e-04
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    47   1e-04
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     47   1e-04
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    47   1e-04
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    47   1e-04
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    47   1e-04
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    47   1e-04
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    47   1e-04
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    47   1e-04
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    47   1e-04
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    47   1e-04
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    47   1e-04
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    47   1e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    47   1e-04
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    47   1e-04
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      47   1e-04
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    47   1e-04
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    46   1e-04
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    47   1e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    47   1e-04
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    47   1e-04
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    47   1e-04
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    47   1e-04
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    46   1e-04
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    47   1e-04
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    47   1e-04
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    47   1e-04
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    47   1e-04
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    47   2e-04
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    47   2e-04
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    47   2e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    47   2e-04
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    47   2e-04
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    47   2e-04
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    47   2e-04
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    47   2e-04
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    47   2e-04
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    47   2e-04
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    46   2e-04
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    46   2e-04
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    46   2e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    47   2e-04
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    45   2e-04
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    46   2e-04
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    46   2e-04
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    46   2e-04
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    47   2e-04
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    46   2e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     47   2e-04
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    46   2e-04
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    46   2e-04
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    46   2e-04
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    46   2e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    46   2e-04
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    45   2e-04
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    46   2e-04
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    45   2e-04
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    46   2e-04
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    46   2e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    46   2e-04
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    46   2e-04
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    46   2e-04
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    46   2e-04
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    46   2e-04
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    46   2e-04
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    45   2e-04
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    46   3e-04
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    46   3e-04
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    46   3e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    45   3e-04
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    46   3e-04
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    46   3e-04
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    46   3e-04
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    46   3e-04
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    46   3e-04
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    45   3e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    46   3e-04
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    46   3e-04
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    46   3e-04
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    46   3e-04
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    46   3e-04
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    45   3e-04
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    45   3e-04
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    45   3e-04
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    45   3e-04
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    45   3e-04
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    45   4e-04
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    45   4e-04
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    45   4e-04
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    45   4e-04
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    45   4e-04
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    45   4e-04
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    45   4e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    45   4e-04
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    45   4e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    45   4e-04
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    45   4e-04
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    45   4e-04
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    45   4e-04
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    45   4e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    45   4e-04
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    45   4e-04
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    45   4e-04
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    45   4e-04
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    45   4e-04
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    45   4e-04
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    45   5e-04
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    44   5e-04
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    44   5e-04
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    45   5e-04
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    45   5e-04
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    45   5e-04
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    45   5e-04
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    45   5e-04
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    45   5e-04
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    45   5e-04
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    45   5e-04
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    45   6e-04
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    45   6e-04
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    45   6e-04
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    45   6e-04
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    45   6e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    45   6e-04
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    44   6e-04
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    44   6e-04
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    45   6e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    45   6e-04
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    44   6e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    45   6e-04
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    45   7e-04
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    45   7e-04
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    45   7e-04
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    45   7e-04
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    45   7e-04
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    44   7e-04
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    44   7e-04
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    44   8e-04
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    44   8e-04
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    44   8e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    44   8e-04
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    44   8e-04
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    44   8e-04
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    44   8e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    44   8e-04
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    44   9e-04
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 44   9e-04
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    44   9e-04
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    44   9e-04
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    44   0.001
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    44   0.001
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    44   0.001
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    43   0.001
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    44   0.001
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    44   0.001
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    44   0.001
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    44   0.001
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    44   0.001
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    44   0.001
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    44   0.001
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    44   0.001
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    44   0.001
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    44   0.001
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    44   0.001
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    44   0.001
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    44   0.001
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    44   0.001
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    44   0.001
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    44   0.001
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    44   0.001
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    44   0.001
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    43   0.001
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    44   0.001
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    44   0.001
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    44   0.001
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    44   0.001
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    43   0.001
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    43   0.001
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    43   0.001
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    44   0.001
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    44   0.001
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     44   0.001
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    43   0.001
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    44   0.001
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    43   0.001
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    43   0.001
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    44   0.002
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    44   0.002
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    44   0.002
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      44   0.002
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    43   0.002
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    43   0.002
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    43   0.002
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    43   0.002
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    42   0.002
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    43   0.002
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      43   0.002
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    43   0.002
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    43   0.002
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    43   0.002
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    42   0.002
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    42   0.003
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    43   0.003
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    43   0.003
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    43   0.003
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    43   0.003
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    43   0.003
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    42   0.003
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    42   0.003
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    42   0.003
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    42   0.003
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    42   0.004
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    42   0.004
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    42   0.004
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    42   0.004
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    42   0.004
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    42   0.004
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    42   0.004
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.004
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    42   0.005
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    42   0.005
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    42   0.005
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.005
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    42   0.005
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    42   0.005
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    42   0.005
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    42   0.005
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    42   0.006
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    42   0.006
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    42   0.006
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       42   0.006
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    42   0.006
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    41   0.007
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    42   0.007
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    42   0.007
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    42   0.007
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    41   0.007
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     41   0.007
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    41   0.007
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    41   0.007
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    41   0.007
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    41   0.008
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    41   0.008
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    41   0.008
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    41   0.009
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    41   0.010
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    41   0.010
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    40   0.011
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    40   0.011
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    41   0.012
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    40   0.013
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    40   0.013
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    40   0.014
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    40   0.016
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    40   0.016
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    40   0.017
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    40   0.017
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    40   0.019
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    40   0.020
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    40   0.020
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    40   0.021
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    40   0.021
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    40   0.022
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    40   0.023
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    40   0.023
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    40   0.023
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    40   0.026
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    39   0.027
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    39   0.036
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    39   0.036
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    39   0.037
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    39   0.038
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    39   0.038
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    39   0.039
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    39   0.041
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    39   0.047
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    39   0.049
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    39   0.054
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    39   0.056
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    38   0.056
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    38   0.056
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    38   0.061
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    38   0.063
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    39   0.068
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    38   0.070
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    38   0.075
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    38   0.077
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    38   0.081
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    37   0.094
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    38   0.094
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    38   0.094
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    38   0.098
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    37   0.10 
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    37   0.11 
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    37   0.12 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    37   0.12 
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    37   0.12 
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    37   0.12 
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               37   0.12 
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    37   0.13 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    37   0.14 
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    37   0.15 
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    37   0.18 
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    37   0.19 
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    37   0.19 
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    37   0.19 
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    36   0.20 
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    37   0.20 
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    37   0.21 
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    36   0.23 
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    36   0.23 
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    37   0.25 
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    36   0.28 
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    36   0.29 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     36   0.29 
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    36   0.30 
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    36   0.30 
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    36   0.35 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    36   0.39 
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    36   0.43 
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    35   0.44 
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    35   0.45 
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    35   0.50 
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    35   0.54 
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    35   0.63 
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    35   0.66 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    35   0.72 
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    34   0.80 
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    35   0.89 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    34   0.94 
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    34   0.97 
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    34   1.0  
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    34   1.1  
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    34   1.2  
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    34   1.2  
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    34   1.2  
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    34   1.3  
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    34   1.3  
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    34   1.5  
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    34   1.5  
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    33   1.6  
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    33   1.6  
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    33   1.6  
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    34   1.6  
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    33   1.8  
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    33   1.8  
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    33   1.9  
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    33   2.2  
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    33   2.5  
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    32   3.0  
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    33   3.7  
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    32   4.0  
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    32   4.1  
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    32   4.1  
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    32   4.5  
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    32   5.4  
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    32   5.8  
KLTH0H04686g Chr8 complement(419384..421726) [2343 bp, 780 aa] {...    32   5.8  
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    32   6.1  
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    31   7.7  
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    31   7.9  
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    31   8.0  
Suva_2.116 Chr2 (201124..203163) [2040 bp, 679 aa] {ON} YBL009W ...    32   8.0  
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    31   8.0  
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    31   8.1  
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    31   8.2  
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    31   8.7  
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    31   8.9  

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/621 (90%), Positives = 564/621 (90%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 NVPCPIPDFYLQRKLXXXXXXXXXXDVVMNVPIPSYPVAIPAITNNNGSYNYNMSIASAT 360
           NVPCPIPDFYLQRKL          DVVMNVPIPSYPVAIPAITNNNGSYNYNMSIASAT
Sbjct: 301 NVPCPIPDFYLQRKLAQAQAQTQAQDVVMNVPIPSYPVAIPAITNNNGSYNYNMSIASAT 360

Query: 361 IXXXXXXXXXXXXXXXXXXXXXXTGILQSINAPLLNVPLQPNRPISSQKKHIQKSQTMPM 420
           I                      TGILQSINAPLLNVPLQPNRPISSQKKHIQKSQTMPM
Sbjct: 361 INPQNANNNNTNNNPYTVASNNVTGILQSINAPLLNVPLQPNRPISSQKKHIQKSQTMPM 420

Query: 421 PSMDANLKKSTCQLGHTTLSIPNKNNDVIQKRAXXXXXXXXPLLQERIIXXXXXXXXXXX 480
           PSMDANLKKSTCQLGHTTLSIPNKNNDVIQKRA        PLLQERII           
Sbjct: 421 PSMDANLKKSTCQLGHTTLSIPNKNNDVIQKRASVSSSRSSPLLQERIISTDMSFSSDDD 480

Query: 481 XXXXXXIHTDEQNVKIDTQPLTHTISKTKSLFDNNDNVEHGRSLNKHATKREKHRSLPPL 540
                 IHTDEQNVKIDTQPLTHTISKTKSLFDNNDNVEHGRSLNKHATKREKHRSLPPL
Sbjct: 481 KDDDSSIHTDEQNVKIDTQPLTHTISKTKSLFDNNDNVEHGRSLNKHATKREKHRSLPPL 540

Query: 541 QRNTLKNNFDQMYDDTTQSNSKSSTPEKSILSNQETKEQIKKKMLEKLQRVKSITASTPT 600
           QRNTLKNNFDQMYDDTTQSNSKSSTPEKSILSNQETKEQIKKKMLEKLQRVKSITASTPT
Sbjct: 541 QRNTLKNNFDQMYDDTTQSNSKSSTPEKSILSNQETKEQIKKKMLEKLQRVKSITASTPT 600

Query: 601 LPTTSNDKEVAQKKKQNQLFL 621
           LPTTSNDKEVAQKKKQNQLFL
Sbjct: 601 LPTTSNDKEVAQKKKQNQLFL 621

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/432 (62%), Positives = 320/432 (74%), Gaps = 19/432 (4%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQPQ+ +Y PGTLL+VGSH+ +++KYLTSGGFAQ+YT +ISP D F N+++ CLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDKPSLNTLRAEVD MKLLRNN HVVSYIDSHAAKF+ N GSYEVFLLMEYCD GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQ RL E+EIL+IMSQV+QG+AAMHAL PPLLHRDIKIENVLLTS+G YK+CDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCGIIRPP+N QE +YVQHDIMKNTTAQYR+PEMI+L +GLPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK GE AILHA+FQFPN+P YSDR+K LI   L  QPSQRPN YQ+LEEVS +Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 NVPCPIPDFYLQRKLXXXXXXXXXXDVVMNVPIPSYPVAIPAITNNNGSYNYNMSIASAT 360
           NV CPIP+FYL                  N  + + P   P + NNN  YN   +++   
Sbjct: 301 NVQCPIPNFYLMNNNVTQGQMAMQTQPQNNGAMMASPNMQPYVPNNNFVYNTPNAVSMND 360

Query: 361 IXXXXXXXXXXXXXXXXXXXXXXTGILQSINAPLL--NVPLQPNRPISSQKKHIQKSQTM 418
           I                      TG++    A  +   +P+QP          +QKSQT+
Sbjct: 361 I-------QMMNAINLKVNSTHNTGMIPPTMATNMARTIPMQP----------VQKSQTL 403

Query: 419 PMPSMDANLKKS 430
           P+ S+  NL+ +
Sbjct: 404 PVSSIPTNLQNT 415

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  512 bits (1318), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 238/312 (76%), Positives = 271/312 (86%), Gaps = 1/312 (0%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQP++  YHPGT+L VGSHQ RIIKY+TSGGFAQ+YT EISP D F +S+I CLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDKPSLNTLRAEVDAMKLLRNN HVVSYIDSHA+K + N GSYEVFLLMEYC+RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E+E+L I SQV+QG+AAMHALQPPLLHRDIKIENVL++    YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           V GIIRPP NPQE  YVQHD++KNTTAQYRSPEMI+  +GLPI+EKSDIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEKT-GENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKI 299
           YYTTPFEK  GE AIL A +++PNFP YS+R+K LI   L   P QRPNIYQ++EE+SK+
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QNVPCPIPDFYL 311
           QNVPCPI +FYL
Sbjct: 301 QNVPCPIVNFYL 312

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  522 bits (1345), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 245/347 (70%), Positives = 281/347 (80%), Gaps = 6/347 (1%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQP++  Y+PGT+L+VGSH A++I YLTSGGFAQVY+AEI P D FI+S++ CLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDKPSLNTLRAEVDAMKLLRNN HVVSYIDSHAAK     GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E EIL+IMSQV+QG+AAMHALQPPL+HRDIKIENVL++  G YK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCG+IRPP NPQEF YVQHD++KNTTAQYRSPEMI+L +G PI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK GE AILH+ FQFP  P YSDR+K LIR  L   P QRPN+ Q+LE+VS++Q
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 NVPCPIPDFYLQRKLXXXXXXX------XXXDVVMNVPIPSYPVAIP 341
            + CP+ +FYL R +                  V+NVPI S PV  P
Sbjct: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVLNVPIISQPVGFP 347

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  525 bits (1352), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 238/315 (75%), Positives = 277/315 (87%), Gaps = 1/315 (0%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MN PQ+++Y PGT+L+VGSH A+IIKYLTSGGFAQVY+AEISP DP+ +++I CLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NN HVVSYIDSHAAK   N  +YEVF+LMEYC+RGGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK-SVNGVAYEVFVLMEYCERGGLIDF 119

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRL+NRL E+EILDIM Q  QG+AAMHALQPPL+HRDIKIENVL++  G YK+CDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           V G+IRPP NPQEF YVQHDI+ NTTAQYRSPEMI+L +GLPI+EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEKTGE AILHA +Q+P+FP YSDR+K+LIR+ L   PSQRPNI Q+LEEVS++Q
Sbjct: 240 YYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 NVPCPIPDFYLQRKL 315
           N PCPI +FYL R +
Sbjct: 300 NRPCPIRNFYLLRAM 314

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  517 bits (1332), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/315 (74%), Positives = 274/315 (86%), Gaps = 1/315 (0%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MN PQ+++Y PGT+L+VGSH A+IIKYLTSGGFAQVYTAEISP DP+ N++I CLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           P K  LNTLRAEVDAMKLLRNN HVVSYIDSHAA+    I +YEVF+LME+C+RGGLIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGI-AYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E+EIL+IMSQ  QG+ AMHALQPPL+HRDIKIENVL++  G YK+CDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           V G+IRPP N QEF YVQHDI+ NTTAQYRSPEMI+L +GLPI+EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK+GE  ILHA +Q+P+FP YSDR+K+LIR+ L   PSQRPNI Q+LEEVS++Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 NVPCPIPDFYLQRKL 315
           N PCPI +FYL R +
Sbjct: 300 NKPCPIRNFYLLRAM 314

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  515 bits (1326), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 234/315 (74%), Positives = 274/315 (86%), Gaps = 1/315 (0%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MN PQ+++Y PGT+L+VGSH A+IIKYLTSGGFAQVYTAEISP DP+ N++I CLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NN HVVSYIDSHAAK   N  +YEVF+LME+C+RGGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK-SVNGVAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E+EIL+IMSQ  QG+AAMHALQPPL+HRDIKIENVL++  G YK+CDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           V G+IRPP N QEF YVQHDI+ NTTAQYRSPEMI+L +GLPI+EKSDIWALG+FLYK+C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK+GE  ILHA +Q+P FP YSDR+K+LIR+ L   PS+RPNI Q+LEEVS++Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299

Query: 301 NVPCPIPDFYLQRKL 315
             PCPI +FYL R +
Sbjct: 300 IKPCPIRNFYLLRAM 314

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  513 bits (1320), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 237/315 (75%), Positives = 272/315 (86%), Gaps = 1/315 (0%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           M+QP +  Y  GT+L+VGSH+ARIIKYLTSGGFA +Y+AEISP DP  +SSI CLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPN-SSSIACLKRVLV 59

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDKPSLN+LRAEVDAMKLL+ +  VVSYIDSHAAK   N GSYEVFLLMEYC RGGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E E+L IMSQVSQGVAAMHALQPPL+HRDIKIENVL++  G++K+CDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCG+IRPP NPQE  YVQHDI+KNTTAQYRSPEMI+L +GLP++EKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK GE AILH+ FQFP +P YSD++K+LI   L   P QRPNI QLL EVS+IQ
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 NVPCPIPDFYLQRKL 315
            VPCP+ +FYL+RK+
Sbjct: 300 GVPCPVKNFYLERKM 314

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  509 bits (1312), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 230/315 (73%), Positives = 268/315 (85%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQP +  Y PGTLL+VGSH  +IIKYLTSGGFAQ+YT EISPI+P+ NS   CLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NN HVVSYIDSHAA+     G+YEVFLLMEYC  GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E EIL+I+SQ  QGV+AMHALQP L+HRDIKIENVL++++G +K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VC  IRPP NPQE  YVQHD++KNTTAQYR+PEM++L +GLPINEKSDIWALGVFLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK GE AILH+ +Q+P FP Y+D++K+LIR TL   PS+RPNI QLLEE+S+IQ
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 NVPCPIPDFYLQRKL 315
            +PCPI +FYL R +
Sbjct: 301 GIPCPINNFYLSRTI 315

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  503 bits (1294), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/309 (74%), Positives = 265/309 (85%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQPQ+  Y+ GT L+VGSHQ  I+KYLTSGGFAQVY+A ISP DP  +S+I CLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDKPSLNTLRAEVDAM+LLRNN +VVSYIDSHAAK   + GSYEVF+LMEYC+RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRLHE EIL IMSQV+QGVAAMHALQPPL+HRDIKIENVL+++   YKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCG+IRPP NPQE +YVQ DI KNTTAQYRSPEM+++ +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK GE AIL   F+FP +P YS++++ LIR  L   P QRPN+YQLL+ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 NVPCPIPDF 309
           NVPCPI D 
Sbjct: 301 NVPCPISDI 309

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  508 bits (1307), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 232/315 (73%), Positives = 266/315 (84%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQP   IY  GT L+VGSHQARIIKYLTSGGFA +Y+AEISP DP    ++ CLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDK SLN LRAEVDAMKLLR N HVVSYIDSHAAK     GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL ENE+L IMS ++QG+AAMHAL PPL+HRDIKIENVL++    +K+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCG+IRPP N QEF+YVQ+DI+KNTTAQYRSPEMI+L +G PINEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK G+ AILH+ FQFP +P YSDR+K+LI + L+  P+QRPNI Q+LEEVS+IQ
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 NVPCPIPDFYLQRKL 315
           NVPCP+ +FYL R +
Sbjct: 301 NVPCPLRNFYLLRSM 315

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  507 bits (1306), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 231/315 (73%), Positives = 271/315 (86%), Gaps = 1/315 (0%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MN PQ+++Y PGT+L+VGSH A+IIKYLTSGGFAQVYTAEISP DP+ N++  CLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDK  LNTLRAEVDAMKLL+NN HVVSYIDSHAAK    I +YEVF+LME+C+RGGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQ+RL E+EIL+IMSQ  QG+AAMH LQPPL+HRDIKIENVL++  G YK+CDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           V G+IRPP N QEF YVQHDI+ NTTAQYRSPEMI+L +  PI+EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK+GE AILH+ +Q+P+FP YSDR+K LI + L   PSQRPNI Q+LEEVS++Q
Sbjct: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299

Query: 301 NVPCPIPDFYLQRKL 315
           N PCPI +FYL R +
Sbjct: 300 NEPCPIRNFYLLRAM 314

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  505 bits (1301), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/316 (72%), Positives = 268/316 (84%), Gaps = 1/316 (0%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MN PQ+  +  G +L+VGSH A++IKYLTSGG+AQVY  EISP DP+INS+I CLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDKPSLNTLRAEVDAMKLL+NN HVVSYIDSHA+K     G+YEVF+LME+C+RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MN+RLQ+RL E EIL IMS  SQG+AAMH LQP LLHRDIKIENVL++    YK+CDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCGI+RPP N QEF +V HDIMKNTTAQYRSPEM++L KGLPINEKSDIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKT-GENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKI 299
           YYTTPFEK  GE AIL A FQ+P++P YSDR+K+LIR+ L+  PS RPN+ Q+LEEVS++
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QNVPCPIPDFYLQRKL 315
           Q +PCPI +FYL R +
Sbjct: 301 QGIPCPIRNFYLLRAM 316

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  498 bits (1283), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 230/309 (74%), Positives = 264/309 (85%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQPQ+  Y+ GT L+VGSHQ  IIKYLTSGGFAQVY+A I+P DP  NSS+ CLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDKPSLNTLRAEVDAM+LL+NN +VVSYIDSHAAK   + GSYEVF+LMEYC+RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRLHE EIL IMSQV+QGVAAMHALQPPL+HRDIKIENVL+++   YKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCGIIRPP N QE +YVQ DI+KNTTAQYRSPEMI+  +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK G+ AIL   F+FP +P+YS+++K LIR  L   P  RPN+YQLL+ +S +Q
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 NVPCPIPDF 309
           NVPCPI D 
Sbjct: 301 NVPCPINDI 309

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  501 bits (1291), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 229/315 (72%), Positives = 261/315 (82%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQ    IY PGT L+VGSH+ARIIKYLTSGGFA +YTAEI P D    + I CLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDKPSLN LRAEVDAMKLLR N HVVSYIDSHAAK   + GSYEVFLLMEYC  GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E E+L I S ++QG+AAMHALQPPL+HRDIKIENVL++    +K+CDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCG+IRPP NPQEF YVQHDI+KNTTAQYR+PEMI+L +G PINEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK GE AILH+ FQFP++P YSD +K LI   L+  P+QRPNI Q+LEEVS+IQ
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 NVPCPIPDFYLQRKL 315
             PCP+ +FY+ R +
Sbjct: 301 GTPCPLRNFYVTRAM 315

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  497 bits (1280), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 268/319 (84%), Gaps = 4/319 (1%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQP++ +Y PG +L VGSHQA+I+KYLTSGGFAQVY  EISP D    S+I CLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKF----DTNIGSYEVFLLMEYCDRGG 116
           PDK SLN  RAEV+AMKLLRNN +VVSYIDSHAAK         GSYEVFLLMEYC   G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLC 176
           LIDFMNTRLQNRL E EIL+IMS VSQGVAAMHALQPPLLHRDIKIENVL++++  +KLC
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFL 236
           DFGSVCG+IRPPTN  E  +VQHDI+KNTTAQYRSPEM++L K +PINEKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
           YK+CYYTTPFEK GENAILH+ +Q+P +P YSD +K+LIR+ L V PS+RPNI Q++EEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SKIQNVPCPIPDFYLQRKL 315
           S++Q VPCP+ +FYL+R +
Sbjct: 301 SRLQGVPCPLKNFYLERAI 319

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  491 bits (1265), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 226/309 (73%), Positives = 263/309 (85%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQPQ+  Y+ GT L+VGSHQ  IIKYLTSGGFAQVY+  ISP DP  N+++ CLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDKPSLNTLRAEVDAM+LL+NN +VVSYIDSHAAK     GSYEVF+LMEYC+RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRLHE EIL I+SQV+QGVAAMHALQPPL+HRDIKIENVL+++   YKLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCGIIR P N QE +YVQ DI+KNTTAQYRSPEMI++ +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK GE AIL   F+FP +P+YS+++KSLIR  L   P  RP+++QLL+ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 NVPCPIPDF 309
           NVPCPI D 
Sbjct: 301 NVPCPINDI 309

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  491 bits (1264), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/308 (72%), Positives = 267/308 (86%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQPQ+  Y+ GT L+VGSHQ  IIKYLTSGGFAQVY+A ISP DP  NS++ CLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDK SLNTLRAEVDAMKLLRNN +VVSYIDSHAAK   + GSYEVF+LMEYC+RGGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRLHE+EIL IM QV+QGVAAMHALQPPL+HRDIKIENVL++++  YKLCDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCG+IRPP NPQE +YV+ D++KNTTAQYRSPEM+++ +GLPI+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK GE AIL+  F+F  +P+YS+++++LI   L   PSQRPN++QLL++++ +Q
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 NVPCPIPD 308
           N P PI D
Sbjct: 301 NAPYPIRD 308

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  493 bits (1269), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 227/313 (72%), Positives = 264/313 (84%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQP + +Y  GTLL+VG+H+A I KYLTSGGFAQ+Y  EI+P+D +  S++ CLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           P K  LNTLRAEVDAMKLL+NN HVVSYIDS+A K   N GSYEV LLMEYC+ GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MN+RLQNRL E EIL+I+SQ +QGVA MHALQP LLHRDIKIENVL +  G +KLCDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCG IRPP N QE +YVQHDI+KNTTAQYR PEM++L +GLPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEKTGENAILH+ FQ+P FP YSDR+K+LIR+ L+  P++RPNI +LLEE+S IQ
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 NVPCPIPDFYLQR 313
            VPCPI +FYL R
Sbjct: 301 GVPCPIQNFYLIR 313

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  490 bits (1261), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 226/315 (71%), Positives = 265/315 (84%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQP +  Y  G  L VG H A I+KYLTSGG+AQVY A+ISP D    S IVCLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDK SLNT RAEVDAMKLLRN  HVVSYIDS+AAK   + G+YEV LLME+C  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E EIL+IMSQV+QGVAAMH+L+PPLLHRDIKIENVL+++ G YKLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCG+IRPPT+ QEF +VQHDI+KNTTAQYR+PEMI+L + LPI+EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK GE AILH+ +++  +PHYSD +K+LIR+ L  QPSQRPNI Q+LEEVS++Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 NVPCPIPDFYLQRKL 315
            +PCPI +FYL+R +
Sbjct: 301 GIPCPIKNFYLERAI 315

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  488 bits (1257), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 259/315 (82%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQPQ+  Y  GT+L VGSHQ +++KYL SGGFA VY+ EISP DP    ++ CLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDK SLNTLRAEVD+MK LR N  +VSYIDSHA K   N+G YEV+LLMEYC  GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E EIL+IMSQVSQGVAAMHALQPPL+HRDIKIENVLL+    +KLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           V G+IR P N +EF YVQ+DIMKNTTAQYR PEMI+L +GLPI+EKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK GE+AIL + F+FP +P YSDR+K+LI + L V P +RPNI Q++EEVS+IQ
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 NVPCPIPDFYLQRKL 315
            +PCPI +FYL R +
Sbjct: 301 GIPCPIKNFYLLRMM 315

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  484 bits (1246), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 226/315 (71%), Positives = 261/315 (82%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQP++   + GT L+VG+H  +I+KYLTSGGFAQ+Y  EI  +  F  S++ CLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDK SLN LRAEVDAMKLL NN HVVSYIDSHA +  TN G+YEVFLLMEYC+ GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E EILDIMSQ +QG+A MHAL PPLLHRDIKIENVLL+  G YK+CDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           V G+IRPP N QE  YVQHDIMKNTTAQYR PEM++L +GLPI+EK+DIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK GE AILHA FQFP+FP+YSDR+K+LI+  L   PS RPN+ Q+LEEVS++Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 NVPCPIPDFYLQRKL 315
           NVPCPI +FYL R +
Sbjct: 301 NVPCPIRNFYLLRAM 315

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  478 bits (1230), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 217/312 (69%), Positives = 261/312 (83%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQP ++ Y  GT L+VGSHQ +IIKYLT+GGFAQ+Y   ISPIDPF  ++I CLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDKPSLN LRAEVDAMKLLRNN  VVSYIDSHAAK     G+YEVFLLMEYC+ GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           +N+RLQNRL E+E+++IM  VSQGVAAMHALQPPL+HRDIKIENVLL+    +KLCDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           V G IRPP+NPQE   VQ+DIM+NTTAQYRSPEMI++ +G PI+EKSDIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK+GE  IL + ++FP FP YSDR++ LI   L VQP+ RPNIY +++E+S ++
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 NVPCPIPDFYLQ 312
           N+ CPI +FYL+
Sbjct: 301 NISCPIINFYLK 312

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  474 bits (1221), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 214/313 (68%), Positives = 259/313 (82%), Gaps = 1/313 (0%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQ       PG +L+VGSH+ +II+YLTSGGFAQ+Y+ E+    P I  S+ CLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDKPSLNTLRAEVDAMK+L+ + HVVSYIDSHAAK   + G+YEV+LLMEYC RGGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MN+RLQ RL E E+L IMS V+QG+ AMHAL PPL+HRDIKIENVL++  G +K+CDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           V G+IRPP N  EF YVQHDI+KNTTAQYR+PEMI+L + LP++EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           Y+TTPFEK GENAIL A FQFP++P Y+DR+K+LI + L+  P QRPNI Q+LEEVS+IQ
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 NVPCPIPDFYLQR 313
            VPCP+P+FYL+R
Sbjct: 300 GVPCPLPNFYLER 312

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  467 bits (1202), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 209/314 (66%), Positives = 257/314 (81%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQP +  Y PGT L+VG HQ  IIKYLTSGGFAQ+Y  +++P +P    ++ CLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           P+K  LNTLRAEV+AM+LL+   HVV YIDS+AA+  +N G+YEV  LME+C  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E E+L+IM+QV+QG+ AMH+L PPL+HRDIKIENVL++S G YK+CDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           V GIIRPP N +EF +VQ DIMKNTTAQYR PEM++L +G PINEKSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFE  GE AILHA +Q+P +P YS R+K+LIR+ L  +P QRPN+ Q+LEEVS +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 NVPCPIPDFYLQRK 314
            +PCP+P+FYLQR+
Sbjct: 301 GIPCPLPNFYLQRQ 314

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  463 bits (1191), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/315 (67%), Positives = 258/315 (81%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MN P++  Y PGT+LSVG+H A+I+KY+ SGGFAQVY+AE+ P D    ++ VCLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           P+K  LN LRAEV+AMKLL+ + HVV YIDSHAA+     G+YEVFLLME+C  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E EIL+IMSQV+QG+AAMHALQPPL+HRDIKIENVL+++ G YK+CDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           V G IRPP NPQEF +VQHDI+KNTTAQYRSPEMI+L +   I+EKSDIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK G+ AILH+ +QF   P YSDR+K+LI   L+ QP QRPNI Q+LEEVS++Q
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 NVPCPIPDFYLQRKL 315
            V  P+ +FYL R +
Sbjct: 301 GVSSPMRNFYLLRAM 315

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  459 bits (1181), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 219/351 (62%), Positives = 262/351 (74%), Gaps = 6/351 (1%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQ     + PGT+L+VGSH+ +++KYLTSGGFAQ+Y  E+   D  +   + CLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKD-VACLKRVHV 59

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDK SLNTLRAEVDAMKLLR N H+VSYIDSHA+K   N GSYEV LLMEYC RGGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQ+RL E E+L IM+QV QG+ AMHALQPPL+HRDIKIENVL+   G  K+CDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCG+IRPP N  E +YVQHDI+KNTTAQYR+PEMI+L +G  ++EKSDIWALGVFLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEKTGE AIL A+FQFP++P YS+R+K+LI + L   P  RPN  Q+LEEV +IQ
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 NVPCPIPDFYLQRKLXXXXXXXXXXDV-----VMNVPIPSYPVAIPAITNN 346
             PCP+ +FYL+R L           V      MN      P+ IP + N+
Sbjct: 300 GQPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQQAKIPIVIPQVQNS 350

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  457 bits (1177), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 208/333 (62%), Positives = 262/333 (78%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQ Q+ +Y P T+++VGSH A+I+KYL SGG+AQVY+A ++P+D    ++I CLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDK SLN LRAEVDA+K+LRN  +VVSYIDSHA+K   + GSYEVF+LMEYC  G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           +NTRL+NRL E EIL IM+QV+ GVA MH LQP L+HRDIKIEN+L++  G YK+CDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           VCG+IRPP + +E  Y+QHDIMKNTTAQYRSPEM++L KG  INEKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFEK GE AIL + FQ+P +P YSD +K++IR+ L+V P +RPNI QL+EE+S++Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 NVPCPIPDFYLQRKLXXXXXXXXXXDVVMNVPI 333
            +  P+ +FYL R L          +    VPI
Sbjct: 301 GIVPPMKNFYLSRALETSSLMQPLQNNSYKVPI 333

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  442 bits (1138), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 201/311 (64%), Positives = 246/311 (79%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MN P +  Y PGT ++VGSH   I+KYLTSGG+AQ+Y+A+I P D F+ +++  LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           PDK  LNTLRAEVDAMK L+++ ++VSYIDSHAAK     G+YEVFL+MEYC RGGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNTRLQNRL E EIL I   +SQGVAAMH LQPPL+HRDIKIENVL+++   YKLCDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240
           V G IRPP  P+E  YV+HDIM +TTAQYR+PEM++L KG  +N+KSDIWALGVFLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300
           YYTTPFE+TGE  IL+   +FP +PHYSD +K LI   L   P  RPNI+Q+++ VSK+ 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 NVPCPIPDFYL 311
           NV CPIP+ ++
Sbjct: 301 NVNCPIPNIHV 311

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  434 bits (1115), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 205/317 (64%), Positives = 251/317 (79%), Gaps = 8/317 (2%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
           MNQP +  Y PG ++ VGSHQA+I+KYLTSGGFAQ+Y+ EISP D + NS+I CLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120
           P+K  LN LR EVDAMKLL+NN HVVSYIDS+AAK +   GSYEVFLLMEYC+RG L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180
           MNT+L+ RL E E+L+IM+QV QG+AAMH L PPL+HRDIKIENVL++  G +K+CDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYK-- 238
           VCGIIRPP NPQE  YVQHD+MKNTTAQYRSPEMI+L KG PI  K  I  LG +     
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238

Query: 239 --LCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
             L +YT  F +  E AIL+  +Q+P +P YSDR+K+++R+ L+  P +RPNI QLLEE+
Sbjct: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296

Query: 297 SKIQNVPCPIPDFYLQR 313
           SKIQN+PCPI +FYL+R
Sbjct: 297 SKIQNIPCPIDNFYLER 313

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  446 bits (1146), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 206/321 (64%), Positives = 245/321 (76%), Gaps = 14/321 (4%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSS--------I 52
           MNQP++  Y  G +L +G+HQ  I KYL  GGFAQVY+  +      I+SS        +
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV------IDSSNARNELGTM 54

Query: 53  VCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYC 112
            CLKRVIVPDK  LNTLRAEVDAMKLL+ N ++VSYIDSHA + +   G YEVFLLMEYC
Sbjct: 55  ACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYC 114

Query: 113 DRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGH 172
            RGG+IDF+NTRL +RL E EIL IMS V QGVAAMH LQPPL+HRDIKIENVL++  G 
Sbjct: 115 SRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGD 174

Query: 173 YKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWAL 232
           YK+CDFGS C ++RPP  PQE  ++ HDIM NTTAQYRSPEMI+   G PI+EKSDIWAL
Sbjct: 175 YKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWAL 234

Query: 233 GVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQL 292
           GVFLYKLCYYTTPFEK GENAIL+  FQFP++P YSD ++++I I LN  P +RPNI Q+
Sbjct: 235 GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294

Query: 293 LEEVSKIQNVPCPIPDFYLQR 313
           LE+VSK+Q VPCPI +F L R
Sbjct: 295 LEQVSKLQGVPCPIENFMLTR 315

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  417 bits (1073), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 192/307 (62%), Positives = 235/307 (76%)

Query: 9   YHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNT 68
           Y  GT L V SH+  I  YLTSGGFAQVYTA I+     +   + CLKRVIVP+K SLN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           LRAEVDAMK+L+NN ++VSYIDSHA +   +  SY V LLMEYC   GL+DFMN RL+ R
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKER 128

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L E EIL IM+ VSQGV  MH LQPPLLHRDIKIENVLL+  G++KLCDFGSV G++R P
Sbjct: 129 LKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188

Query: 189 TNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEK 248
           T+ +EF Y+Q+DI+KNTTAQYRSPEM+NL  G PINEKSDIWALG+ LYKLCYYTTPFE+
Sbjct: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248

Query: 249 TGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNVPCPIPD 308
            G  AI+   F +P +P Y+D +K++IR+ L+  P QRPNI QLLEE+ +IQ+   P+P+
Sbjct: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308

Query: 309 FYLQRKL 315
           FY+QR +
Sbjct: 309 FYVQRAM 315

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  306 bits (785), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 159/319 (49%), Positives = 207/319 (64%), Gaps = 20/319 (6%)

Query: 9   YHPGTLLSVGSHQARIIKYLTSGGFAQVYTA-------EISPID--------PFINSSIV 53
           +  G  ++VGSH   I+KYLT GGFAQ+Y         E   ID              +V
Sbjct: 29  FSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIGDLV 88

Query: 54  CLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCD 113
           CLKRV+V D+  L+ ++ EV+ MK LR   +VV Y DS+A +     G +EVFLLMEYC 
Sbjct: 89  CLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLMEYCP 148

Query: 114 RGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHY 173
              L+D+MN RL  +L E+EIL+IM  ++ GV+ +H L  PL+HRDIKIENVL+     +
Sbjct: 149 NKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHNNRF 208

Query: 174 KLCDFGSVCGIIRPP--TNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWA 231
           KLCDFGS    I PP  T  Q+ + + HDI  +TT QYRSPEMI+L + LP+NEK+DIWA
Sbjct: 209 KLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKADIWA 266

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQ 291
           LGVFLYKL +YTTPFE TG+ AILH+ ++ P   HYS+R+ +LI + L   P+ RPNIYQ
Sbjct: 267 LGVFLYKLLFYTTPFELTGQFAILHSKYEIPQ-SHYSERLLNLIVVMLAENPNLRPNIYQ 325

Query: 292 LLEEVSKIQNVPCPIPDFY 310
           +L E+  I NV  PIPD Y
Sbjct: 326 VLSEICSILNVEVPIPDIY 344

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  296 bits (758), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 148/311 (47%), Positives = 204/311 (65%), Gaps = 10/311 (3%)

Query: 9   YHPGTLLSVGSHQARIIKYLTSGGFAQVYTAE----ISPIDP-----FINSSIVCLKRVI 59
           Y PGT++ VG H+  ++KYL  GGFA++Y  +    +S +DP       N   +CLKRV+
Sbjct: 29  YVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKRVL 88

Query: 60  VPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLID 119
           V D   LN +R EV+ M+ L+    VV Y DS+A++       YEV LLME C    L+D
Sbjct: 89  VQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSLLD 148

Query: 120 FMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFG 179
           +MN RL  +L E+EIL IM  V+  VA MH L  PL+HRDIKIENVL+ S+ ++KLCDFG
Sbjct: 149 YMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCDFG 208

Query: 180 SVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKL 239
           S    +   ++ Q+   +  +I  +TT QYRSPEMI+L + LP+NEKSDIWALGVFLYKL
Sbjct: 209 STSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLYKL 268

Query: 240 CYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKI 299
            +YTTPFE+TG+ AILH+ ++FP   +YS ++ +LI + L   P+ RPNIYQ+L ++  I
Sbjct: 269 MFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQICYI 327

Query: 300 QNVPCPIPDFY 310
             +  P+ D Y
Sbjct: 328 SGIKNPMDDAY 338

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  294 bits (753), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 208/325 (64%), Gaps = 26/325 (8%)

Query: 9   YHPGTLLSVGSHQARIIKYLTSGGFAQVYTA----------------EISPIDPFIN--- 49
           ++PG +++VG H+  IIKYL  GGFAQ+Y+                 E S ID F     
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 50  --SSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAK-FDTNIGSYEVF 106
              ++ CLKRV+VPD+  LN LR EV+ M+ L+   ++V Y DS+A++  D N G +EV 
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPG-FEVL 137

Query: 107 LLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVL 166
           LLME C    L+D+MN RL  +L E EIL IM  V+ G++ MH LQ PL+HRDIKIENVL
Sbjct: 138 LLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVL 197

Query: 167 LTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK 226
           + S  ++KLCDFGS        T+ QE   +  +I  +TT QYRSPEMI+L + LPI+EK
Sbjct: 198 VDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEK 257

Query: 227 SDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFP-HYSDRMKSLIRITLNVQPSQ 285
           SDIWALGVFLYKL +YTTPFE TG+ AILH+ ++ P  P +YS R+ +LI I L   P+ 
Sbjct: 258 SDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIP--PNNYSSRLINLIIIMLAENPNL 315

Query: 286 RPNIYQLLEEVSKIQNVPCPIPDFY 310
           RPNIYQ++ +V     +  PI D Y
Sbjct: 316 RPNIYQVMHQVCITIGIEPPIKDKY 340

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  293 bits (749), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 148/308 (48%), Positives = 197/308 (63%), Gaps = 9/308 (2%)

Query: 11  PGTLLSVGSHQARIIKYLTSGGFAQVYTAEI--------SPIDPFINSSIVCLKRVIVPD 62
           PGTL+ VGSH+  I+KYL  GGFA +Y  +         +P        + CLKRV+V D
Sbjct: 34  PGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTD 93

Query: 63  KPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMN 122
           +  LN LR EV+ MK L+N+ ++V Y DS+A++       YEV LLME C    L+D+MN
Sbjct: 94  ENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMN 153

Query: 123 TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVC 182
            RL  +L E E+L IM  V++ VA MH L  PL+HRDIKIENVL+ S  ++KLCDFGS  
Sbjct: 154 QRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTS 213

Query: 183 GIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYY 242
                 T  Q+   + ++I  +TT QYR+PEMI+L + LPI+EKSDIWALG+FLYKL +Y
Sbjct: 214 SCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFY 273

Query: 243 TTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNV 302
           TTPFE TG+ AILH+ +  P   +YS ++ +LI I L   P+ RPNIYQ++ +V  I  V
Sbjct: 274 TTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMKV 332

Query: 303 PCPIPDFY 310
             P  D Y
Sbjct: 333 DVPFEDKY 340

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  291 bits (746), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 150/324 (46%), Positives = 206/324 (63%), Gaps = 20/324 (6%)

Query: 6   VAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTA-----------EISP--IDPFINSSI 52
           V  Y PG ++ VGSH+  I++Y+  GGFAQ+Y+            E SP   D      +
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  VCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGS------YEVF 106
            CLKRVIV D+  LN LR EV+ MK L    ++V Y DS+A++      S      +EV 
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVL 134

Query: 107 LLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVL 166
           LLME C    L+D+MN RL  +L E EIL++M  VS  +A MH L+ PL+HRDIKIENVL
Sbjct: 135 LLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVL 194

Query: 167 LTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK 226
           +  +  +KLCDFGS           ++  Y+  +I  +TT QYRSPEMI+L + LPI+EK
Sbjct: 195 VDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 254

Query: 227 SDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQR 286
           SDIWALG+FLYKL ++TTPFE+TG+ AILH+ F+FP   +YS ++ +LI + L+  P+ R
Sbjct: 255 SDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQ-NNYSFKLINLIIVMLSENPNLR 313

Query: 287 PNIYQLLEEVSKIQNVPCPIPDFY 310
           PNIYQ+L ++ +++ VP PI D Y
Sbjct: 314 PNIYQVLHQICQLKQVPIPIADKY 337

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  293 bits (749), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 200/322 (62%), Gaps = 12/322 (3%)

Query: 2   NQPQ-VAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEI----SPID------PFINS 50
           N+P  V  +  G+ + VG+ +  I+KYLT GGFAQ+Y  +     +  D      P    
Sbjct: 17  NKPSAVEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIG 76

Query: 51  SIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLME 110
            + CLKRV+V D+  LN +R EV+ MKLL+   ++V Y DS+A++       +EV LLME
Sbjct: 77  DLACLKRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLME 136

Query: 111 YCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSR 170
            C    L+DFMN RL  +L E EIL IM  V+  VA MH L PPL+HRDIKIENVL+ S+
Sbjct: 137 LCPNKSLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQ 196

Query: 171 GHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIW 230
             +KL DFGS        +  Q+   +  DI  +TT QYRSPEMI+L K LPI+EKSDIW
Sbjct: 197 NGFKLADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIW 256

Query: 231 ALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIY 290
           ALG+FLYKL +Y TPFE TG+ AILH+ + FP   +YS R+ +LI I L+  P+ RPNIY
Sbjct: 257 ALGIFLYKLLFYITPFEMTGQFAILHSKYDFPQ-TNYSSRLINLIIIMLSENPNLRPNIY 315

Query: 291 QLLEEVSKIQNVPCPIPDFYLQ 312
           Q+L E+  I      I D Y Q
Sbjct: 316 QVLHEICSISGTRLEITDKYGQ 337

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  291 bits (745), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 149/321 (46%), Positives = 208/321 (64%), Gaps = 13/321 (4%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFIN---------S 50
           +N P    Y  G ++SVG+H+  I+ YL  GGFAQ+Y  + +  ++ F +          
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  SIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLME 110
            I CLKRVIV D+  LN +R EV+ MK L+++ ++V Y DS+A++       +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSR 170
            C    L+D+MN RL+ +L E+EIL IM  VS G++ MH L  PL+HRDIKIENVL+ + 
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 GHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIW 230
            ++KLCD GS      P  + Q+   +  +I  +TT QYR+PEMI+L + LPINEKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPH-YSDRMKSLIRITLNVQPSQRPNI 289
           ALG+FLYKL +YTTPFE TG+ AILH+ + FP  P+ YS ++ +LI I L   P+ RPNI
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFP--PNKYSSKIINLIIIMLAENPNLRPNI 309

Query: 290 YQLLEEVSKIQNVPCPIPDFY 310
           +Q++  +  I N+P PI D Y
Sbjct: 310 FQVVYHICSIMNLPVPIEDRY 330

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  291 bits (746), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 148/321 (46%), Positives = 204/321 (63%), Gaps = 10/321 (3%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFINSS-------- 51
           M  P V  Y PG ++ VG+H+  I+ YL  GGFAQ+Y  + +  ++ F N++        
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  IVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEY 111
           + CLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+A++    +  +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRG 171
           C    L+D+MN RL  +L E EI+ IM  V+  ++ MH L  PL+HRDIKIENVL+ ++ 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 HYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWA 231
            +KL DFGS        T  Q+   +  +I  +TT QYRSPEMI+L + LPINEKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQ 291
           LG+FLYKL ++TTPFE TG+ AILH+ ++FP    YS ++ +LI I L   P+ RPNIYQ
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLEEVSKIQNVPCPIPDFYLQ 312
           +L  +  I NV  PI D Y +
Sbjct: 313 VLCHLCDILNVEVPIEDKYAE 333

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  291 bits (745), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 203/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFINSS-------- 51
           M  P V  Y PG ++ VG+H+  I+ YL  GGFAQ+Y  + +  ++ F N++        
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  IVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEY 111
           + CLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+A++    +  +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRG 171
           C    L+D+MN RL  +L E+EI+ IM  V+  ++ MH L  PL+HRDIKIENVL+ +  
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 HYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWA 231
           ++KL DFGS        T  Q+   +  +I  +TT QYRSPEMI+L + LPINEKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQ 291
           LG+FLYKL ++TTPFE TG+ AILH+ ++FP    YS ++ +LI I L   P+ RPNIYQ
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLEEVSKIQNVPCPIPDFY 310
           +L  +  I N   PI D Y
Sbjct: 313 VLYHICDILNAEVPIEDKY 331

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  291 bits (744), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 149/320 (46%), Positives = 204/320 (63%), Gaps = 11/320 (3%)

Query: 3   QPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFIN---------SSI 52
           +P    Y PGT ++VG+H+  IIKY+  GGFAQ+Y  + I  ++ F N           +
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 53  VCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYC 112
            CLKRV+V D+  LN +R EV+ MK L+   ++V Y DS+A++       +EV LLME C
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135

Query: 113 DRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGH 172
               L+D+MN RL  +L E EIL IM  V+  V+ MH L  PLLHRDIKIENVL+ ++ +
Sbjct: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195

Query: 173 YKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWAL 232
           +KLCDFGS        T  Q+   +  +I  +TT QYRSPEMI+L + LPI+EKSDIWAL
Sbjct: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255

Query: 233 GVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQL 292
           G+FLYKL ++TTPFE TG+ AILH+ ++FP   +YS ++ +LI I L   P+ RPNIYQ+
Sbjct: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPNLRPNIYQV 314

Query: 293 LEEVSKIQNVPCPIPDFYLQ 312
           L  +  I  +  PI D Y +
Sbjct: 315 LHNICSISGMKVPIEDQYAE 334

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  285 bits (729), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 147/314 (46%), Positives = 198/314 (63%), Gaps = 10/314 (3%)

Query: 6   VAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTA---------EISPIDPFINSSIVCLK 56
           +  Y PG ++ VG H+  IIKYL  GGFA++Y A         +I+ I       ++CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGG 116
           RV+V D   LN +R EV  MK L    ++V   DS+A++    I  YEV LLME C    
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLC 176
           L+D+MN RL  +L E EIL IM  V+  VA MH L  PL+HRDIKIENVL+ S+ ++KLC
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFL 236
           DFGS    +   T  ++   +  ++  +TT QYRSPEMI++ + + INEKSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
           YKL +Y TPFE+TG+ AILH+ ++FP    YS ++ +LI I L   P+ RPNIYQ+L  +
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 297 SKIQNVPCPIPDFY 310
            KI N+  PI D Y
Sbjct: 395 CKIINIKTPIDDIY 408

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  289 bits (739), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 205/321 (63%), Gaps = 10/321 (3%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFINSS-------- 51
           M  P V  Y PG ++ VG+H+  ++ YL  GGFAQ+Y  + +  ++ F N++        
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  IVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEY 111
           + CLKRV+V D+  LN +R EV+ MK L+   ++V Y DS+A++    +  +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRG 171
           C    L+D+MN RL  +L E EI+ IM  V+  ++ MH L   L+HRDIKIENVL+ ++ 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 HYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWA 231
           ++KL DFGS        T  Q+   +  +I  +TT QYRSPEMI+L + LPINEKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQ 291
           LGVFLYKL ++TTPFE TG+ AILH+ ++FP    YS ++ +LI I L   P+ RPNIYQ
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLEEVSKIQNVPCPIPDFYLQ 312
           +L  + +I NV  PI D Y +
Sbjct: 313 VLYHLCEILNVEVPIEDKYAE 333

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  289 bits (739), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 205/321 (63%), Gaps = 10/321 (3%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFINSS-------- 51
           M  P V  + PG ++ VG+H+  +I YL  GGFAQ+Y  + +  ++ F N++        
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  IVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEY 111
           + CLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+A++    +  +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRG 171
           C    L+D+MN RL  +L E+EI+ IM  V   ++ MH L  PL+HRDIKIENVL+ +  
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 HYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWA 231
           ++KL DFGS        T  Q+   +  +I  +TT QYRSPEMI+L + LPINEKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQ 291
           LG+FLYKL ++TTPFE TG+ AILH+ ++FP    YS ++ +LI I L   P+ RPNIYQ
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 LLEEVSKIQNVPCPIPDFYLQ 312
           +L  + +I N+  PI D Y +
Sbjct: 313 VLYHLCEILNIEVPIEDKYTE 333

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  282 bits (722), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 198/317 (62%), Gaps = 11/317 (3%)

Query: 4   PQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEI----SPIDPFINS------SIV 53
           P   +  P T + VG+H+  I+++L  GGFA +Y  +     + +D  I+S       I 
Sbjct: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83

Query: 54  CLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCD 113
           CLKRVIVPD+  LN LR EV+ MK LR + ++V Y DS+A++       +E+ LLME C 
Sbjct: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143

Query: 114 RGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHY 173
           +  L+D+MN +L  +L E EIL IM  VS  +A MH L  PL+HRDIKIENVL+    ++
Sbjct: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203

Query: 174 KLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALG 233
           KLCDFGS        +  Q+   + ++I  +TT QYRSPEMI+L + LPINEKSDIWALG
Sbjct: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263

Query: 234 VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
           +FLYKL +YTTPFE TG+ AILH+ ++ P    YS ++ +LI I L   PS RPNIYQ++
Sbjct: 264 IFLYKLLFYTTPFELTGQFAILHSKYEIPQ-NGYSSKLINLIIIMLAENPSLRPNIYQVM 322

Query: 294 EEVSKIQNVPCPIPDFY 310
             V  I     P  D Y
Sbjct: 323 HHVCSILKCDVPFTDKY 339

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  288 bits (736), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 148/325 (45%), Positives = 206/325 (63%), Gaps = 25/325 (7%)

Query: 12  GTLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFINSS------------------- 51
           GT ++VGSH+  IIKY+  GGFAQ+Y  + +  ++ F +S+                   
Sbjct: 27  GTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNPMIL 86

Query: 52  ----IVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFL 107
               I CLKRV+V D+  LN +R EV+ MK L+   +VV Y DS+A++       +EV L
Sbjct: 87  KLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGFEVLL 146

Query: 108 LMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLL 167
           LME C    L+D+MN RL  +L E+EIL IM  ++  V+ MH L+ PLLHRDIKIENVL+
Sbjct: 147 LMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIENVLV 206

Query: 168 TSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKS 227
            ++ ++KLCDFGS    +   T  Q+   +  +I  +TT QYRSPEMI+L + LPI+EKS
Sbjct: 207 DAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS 266

Query: 228 DIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRP 287
           DIWALG+FLYKL ++ TPFE TG+ AILH+ ++FP   +YS ++ +LI I L   P+ RP
Sbjct: 267 DIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPNLRP 325

Query: 288 NIYQLLEEVSKIQNVPCPIPDFYLQ 312
           NIYQ+L+ +  + NV  PI D Y Q
Sbjct: 326 NIYQVLDNICSMMNVEVPIEDIYEQ 350

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  285 bits (729), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 160/353 (45%), Positives = 208/353 (58%), Gaps = 43/353 (12%)

Query: 2   NQP-QVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFIN---------- 49
           N+P  +  Y  GT+L+VG  +  I+KYLT GGFAQ+YT   I  ++ F N          
Sbjct: 32  NRPGSIEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSR 91

Query: 50  ----SSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIG---- 101
                 + CLKRV+VPD+  L+ +R EVD MK L N  ++V Y DS+A+K   N      
Sbjct: 92  NLKIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTT 151

Query: 102 -----------SYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHA 150
                       +E+ LLMEYC    L+DFMN RL  +L ENEIL  M+ ++  V  MH 
Sbjct: 152 NNNDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHY 211

Query: 151 LQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYR 210
           L  PL+HRDIKIENVL+ S  ++KL DFGS   I  P T  Q+   +  DI  NTT QYR
Sbjct: 212 LAQPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYR 271

Query: 211 SPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDR 270
           SPEMI+L K LPI+EKSDIWALGV LYKL +YTTPFE TG+ AILH+ ++FP   +YS +
Sbjct: 272 SPEMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFP-ANNYSSK 330

Query: 271 MKSLIRITLNVQPSQRPNIYQLLEEV-----------SKIQNVPCPIPDFYLQ 312
             +LI I L   P+ RPNI+Q+L  +           +++QN     PD Y Q
Sbjct: 331 FINLIIIMLAENPNLRPNIFQVLYYLKSISNTMNSNNNEVQNTQVQFPDKYEQ 383

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  285 bits (729), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 197/319 (61%), Gaps = 21/319 (6%)

Query: 9   YHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEI-----------------SPIDPFINSS 51
           Y  GT ++VGSH+  +IKY+  GGFAQ+YT +                   P+ P     
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQP---GD 155

Query: 52  IVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEY 111
           I CLKRV+V D   LN +R EV+ M+ L+    VV Y DS+A+    +   YEV LLME+
Sbjct: 156 IACLKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEF 215

Query: 112 CDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRG 171
           C    L+D+MN RL  RL E EI+ IM   + G+A +H L+ PL+HRDIKIENVL+    
Sbjct: 216 CPNNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQEN 275

Query: 172 HYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWA 231
           ++KLCDFGS        TN ++      +I  NTT QYRSPEMI+L +  PI+EKSDIWA
Sbjct: 276 NFKLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWA 335

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQ 291
           LGVFLYKL ++TTPFE+TG+ AILH+ ++FP   +YS ++ +LI I L   PS RPNIYQ
Sbjct: 336 LGVFLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQ 394

Query: 292 LLEEVSKIQNVPCPIPDFY 310
           +L+ +  I     P+ D Y
Sbjct: 395 VLQYLCSINGWKVPLNDKY 413

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  288 bits (736), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 145/316 (45%), Positives = 201/316 (63%), Gaps = 12/316 (3%)

Query: 6   VAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFIN----------SSIVC 54
           +  Y PG L+SVG+HQ +I  YL  GGFAQ+Y  + I  ++ F N            I C
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDR 114
           LKRV+V D+  LN +R EV+ MKLL+   ++V Y DS+A + +  +  YE+ LLME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
             L+D+MN RL+ +L+E EI+ IM   +  V+ MH L  PL+H+DIK+EN+L+ S  ++K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGV 234
           LCDFGS        T+  +   +  +I  +TT QYRSPEMI+L + LPINE SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           FLYKL ++ TPFE+TG+ +ILHA F  P   +Y  ++ +LI I L+   + RPNIYQ++ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDIP-VNNYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 295 EVSKIQNVPCPIPDFY 310
           E+  I N P PI D Y
Sbjct: 331 EICSITNTPLPIEDKY 346

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  285 bits (729), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 146/319 (45%), Positives = 201/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFINSS-------- 51
           + +P V  Y PGT+++VG+ Q  II ++  GGFAQ+Y+ + I  +  F N S        
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 52  IVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEY 111
           I CLKRV+VPD+  L+ +R EV+ MK LR    ++ Y DS+A++  +    YEV LLME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 112 CDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRG 171
           C    L+D+MN RL  RL E EIL +M   +  ++ MH L  PL+HRDIKIENVL+ ++ 
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 172 HYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWA 231
           ++KLCDFGS        T  Q+   +  +I  NTT QYRSPEMI+L + LPINEKSDIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQ 291
           LG+FLYKL ++ TPFE TG+ +ILH+ ++FP    YS ++ +LI I L   P  RPNIYQ
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 292 LLEEVSKIQNVPCPIPDFY 310
           ++  +  +     PI D Y
Sbjct: 313 VMHHICSVIGCEVPIEDKY 331

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  281 bits (720), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 146/319 (45%), Positives = 197/319 (61%), Gaps = 18/319 (5%)

Query: 9   YHPGTLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFIN----------------SS 51
           +  G  L+VG+H+  I+ YLT GGFAQ+Y  + I  ++ F N                  
Sbjct: 31  FEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLKLGD 90

Query: 52  IVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEY 111
           + CLKRV+V D+  LN +R EV+ MK LR   ++V Y DS+A +       YEV LLME 
Sbjct: 91  VACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLLMEL 150

Query: 112 CDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRG 171
           C    L+++MN RL  +L E E+L IM  V+ GVA MH L+ PL+HRDIKIENVL+ S  
Sbjct: 151 CSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVDSNN 210

Query: 172 HYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWA 231
           ++KLCDFGS        T  Q+   +  ++  +TT QYRSPEMI+L + LPINEKSDIWA
Sbjct: 211 NFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSDIWA 270

Query: 232 LGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQ 291
           LGVFLYKL +YTTPFE TG+ A+LH+ F  P    YS ++ +L+ I L+   + RPNIYQ
Sbjct: 271 LGVFLYKLLFYTTPFETTGQFAMLHSKFDIP-ANKYSSKIINLVIIMLSENLNLRPNIYQ 329

Query: 292 LLEEVSKIQNVPCPIPDFY 310
           ++  + ++  V  PI D Y
Sbjct: 330 VMHYICQLIQVDTPILDIY 348

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  282 bits (721), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 202/322 (62%), Gaps = 21/322 (6%)

Query: 3   QPQVAIYHP-GTLLSVGSHQARIIKYLTSGGFAQVYTAEI-------------SPIDPFI 48
           QPQ+    P G +++VGSH+  ++ YL  GGFAQ+Y  +              S   P  
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 49  NSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIG----SYE 104
             S  CLKRV+V D+  LN +R+EV+ MK L+   ++V Y DS+A++     G     +E
Sbjct: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           V LLME C    L+D+MN RL  +L E EI  IM  ++  VA MH L  PL+HRDIKIEN
Sbjct: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268

Query: 165 VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPIN 224
           VL+ +  ++KLCDFGS        T+ Q+   +  D+  +TT QYRSPEMI+L K +PIN
Sbjct: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPH-YSDRMKSLIRITLNVQP 283
           EKSDIWALGVFLYKL ++TTPFE+TG+ A+LH+ F+FP  P+ YS ++ +LI + L   P
Sbjct: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFP--PNSYSSKLINLIIVMLAENP 386

Query: 284 SQRPNIYQLLEEVSKIQNVPCP 305
           S RPNIYQ+L  +S++ N   P
Sbjct: 387 SLRPNIYQVLYYLSEVTNREVP 408

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  280 bits (717), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 193/308 (62%), Gaps = 10/308 (3%)

Query: 12  GTLLSVGSHQARIIKYLTSGGFAQVYTA---------EISPIDPFINSSIVCLKRVIVPD 62
           G+ + VG+H+  I+KYL  GGFA +Y           E +P          CLKRV+V D
Sbjct: 32  GSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKRVLVTD 91

Query: 63  KPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMN 122
           +  LN +R EV  MK L    ++V Y DSHA++    +  +EV LLME C    L+D+MN
Sbjct: 92  ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPNNSLLDYMN 151

Query: 123 TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVC 182
            RL  +L E EIL IM  V++ +A MH L  PL+HRD+KIENVL+    ++KLCDFGS  
Sbjct: 152 QRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCDFGSTS 211

Query: 183 GIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYY 242
             +      QE   + ++I  +TT QYRSPEMI+L + LPI+EKSDIWALG+FLYKL +Y
Sbjct: 212 TCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFY 271

Query: 243 TTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNV 302
           TTPFE TG+ AILH+ ++FP   +YS ++ +LI I L   P+ RPNIYQ+++ +  I  V
Sbjct: 272 TTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMDNLCSIMKV 330

Query: 303 PCPIPDFY 310
             PI D Y
Sbjct: 331 ENPIEDKY 338

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  280 bits (715), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 145/309 (46%), Positives = 195/309 (63%), Gaps = 9/309 (2%)

Query: 12  GTLLSVGSHQARIIKYLTSGGFAQVY-------TAEISPIDPFIN-SSIVCLKRVIVPDK 63
           G++L VG H+  II+YL  GGFA +Y       T E+      +    I CLKRV V D+
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVNDE 90

Query: 64  PSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNT 123
             LN LR EV+ MK L+   +VV Y DS+A++       +EV LLME C  G L+D+MN 
Sbjct: 91  NGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMNQ 150

Query: 124 RLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCG 183
           RL  +L E E+L IM  +++G++ MH L+ PL+HRDIKIENVL+ S  ++KLCDFGS   
Sbjct: 151 RLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTST 210

Query: 184 IIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYT 243
            +   +  QE   + ++I  +TT QYRSPEMI+L + L INEKSDIWALG+FLYKL +YT
Sbjct: 211 CLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFYT 270

Query: 244 TPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNVP 303
           TPFE TG+ AILH+ +  P   ++S ++ +LI + L   P  RPNIYQ+L  +  I    
Sbjct: 271 TPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICSIMECD 329

Query: 304 CPIPDFYLQ 312
            PI D Y Q
Sbjct: 330 VPIEDHYGQ 338

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  281 bits (720), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 199/317 (62%), Gaps = 12/317 (3%)

Query: 4   PQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFINSS--------IVC 54
           P +  + PG +++VG+H+  ++ YL  GGFAQ+Y  + +  ++ F N S        + C
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDR 114
           LKRV+V D+  L+ +R EV+ MK L    ++V Y DS+A +       +EV LLME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
             L+D+MN RL  +L E EIL IM  VS  V+ MH L+ PL+HRDIKIENVL+ ++  +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGV 234
           LCDFGS        T  QE   +  +I  +TT QYR PEMI+L + LPINEKSDIWALG+
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKTGENAILHASFQFPNFP-HYSDRMKSLIRITLNVQPSQRPNIYQLL 293
           FLYKL ++ TPFE TG+ AILH+ ++FP  P HYS ++ +LI I L   P  RPNIYQ+L
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFP--PNHYSSQLINLIIIMLAENPFVRPNIYQVL 314

Query: 294 EEVSKIQNVPCPIPDFY 310
             +  +  V  PI D Y
Sbjct: 315 NHICTMIGVEVPIEDKY 331

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  278 bits (711), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 192/308 (62%), Gaps = 10/308 (3%)

Query: 12  GTLLSVGSHQARIIKYLTSGGFAQVYTA---------EISPIDPFINSSIVCLKRVIVPD 62
           G+ + VG+H+  I+KYL  GGFA +Y           E  P        + CLKRV+V D
Sbjct: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133

Query: 63  KPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMN 122
           +  LN +R EV  MK L    ++V Y DSHA++       +EV LLME C    L+D+MN
Sbjct: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN 193

Query: 123 TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVC 182
            RL  +L E EIL IM  V++ +A MH L  PL+HRD+KIENVL+ +  ++KLCDFGS  
Sbjct: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253

Query: 183 GIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYY 242
                    QE   + ++I  +TT QYRSPEMI+L + LPINEKSDIWALG+FLYKL +Y
Sbjct: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313

Query: 243 TTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNV 302
           TTPFE TG+ AILH+ ++FP   +YS ++ +LI I L   P+ RPNIYQ+++ +  I  V
Sbjct: 314 TTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372

Query: 303 PCPIPDFY 310
             P+ D Y
Sbjct: 373 KNPLEDKY 380

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  277 bits (708), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 142/309 (45%), Positives = 195/309 (63%), Gaps = 9/309 (2%)

Query: 12  GTLLSVGSHQARIIKYLTSGGFAQVY-------TAEISPIDPFIN-SSIVCLKRVIVPDK 63
           G+ + VG HQ  +I+YL  GGFA +Y       T E+   D  +     VCLKRV V D+
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDE 91

Query: 64  PSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNT 123
             LN LR EV+ MK LRN +++V Y DS+A++       YEV LLME C  G L+D+MN 
Sbjct: 92  NGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQ 151

Query: 124 RLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCG 183
           RL  +L E E+L IM  ++ G++ MH  + PL+HRDIKIENVL+ +  ++KLCDFGS   
Sbjct: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSP 211

Query: 184 IIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYT 243
            +    + QE   + ++I  +TT QYRSPEMI+L + LPINEKSDIWALG+FLYKL +YT
Sbjct: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271

Query: 244 TPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNVP 303
           TPFE TG+ AILH+ ++ P    +S ++ +L+ I L   P  RPN+YQ++  +  +    
Sbjct: 272 TPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMECE 330

Query: 304 CPIPDFYLQ 312
             I D Y Q
Sbjct: 331 VKIDDLYGQ 339

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 91/350 (26%), Positives = 150/350 (42%), Gaps = 77/350 (22%)

Query: 18  GSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVP--DKPSLNTLRAEVDA 75
           G H A I + L  GGF+ VY  +        N+ +  LK++  P  +  S++    EV++
Sbjct: 25  GQHYA-IQRLLGEGGFSFVYLVQSRE-----NNDLFALKKIHCPFGNIESVSEAMREVNS 78

Query: 76  MKLLRN--NTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQN--RLHE 131
            K  R+   TH VS     +       GS  VF+L+ Y   G L+D +NT L +   + E
Sbjct: 79  YKKFRSPYITHCVS-----SQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDGTTISE 133

Query: 132 NEILDIMSQVSQGVAAMH-------------ALQPPLLHRD------------------- 159
            EI+ I+  V++G+  MH             ++   L +RD                   
Sbjct: 134 EEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLNDSLEL 193

Query: 160 ---------------------IKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQ 198
                                IK  N++ +S G   +CD GS        ++  +    Q
Sbjct: 194 DVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLVEFQ 253

Query: 199 HDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEK----TGEN-- 252
               ++ T  +RSPE++N+     I+EK DIW+LG  LY +C+  +PFE+    +G +  
Sbjct: 254 EWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGASMT 313

Query: 253 -AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQN 301
            AI    F  P   +YS  +  +I+  + V   +RP+I +LL  +  +Q 
Sbjct: 314 YAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 96.3 bits (238), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 135/271 (49%), Gaps = 28/271 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +      F   ++    ++ +  + + N L +E+   K +R+  ++V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRH-QNIV 158

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            +ID     F+ +I    V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 159 HFIDC----FEDDIN---VYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+    ++HRD+K+ N+      + K+ DFG +  II    N +++T          T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAIINNE-NERKYTIC-------GT 258

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFE----KTGENAILHASFQFP 262
             Y +PE+I  GK +  + + DIW+LGV ++ +     PF+     T  + I H ++ FP
Sbjct: 259 PNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYSFP 318

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
              + S  +K LI+  L++ P +RP I ++L
Sbjct: 319 TDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 130/274 (47%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +      F   ++  L    +  + +   L +E+   K +++  +VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMKHQ-NVV 142

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            +ID      DTN     V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFED--DTN-----VYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+      + K+ DFG    +     N +E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVL----ANDRERKYTV-----CGT 242

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----ASFQFP 262
             Y +PE++ +GK    + + DIW++GV LY L     PF+    N I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFSFP 301

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
              H S+  K LI+  L++ P +RP+I ++++ V
Sbjct: 302 KEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 93.2 bits (230), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 93/309 (30%), Positives = 136/309 (44%), Gaps = 51/309 (16%)

Query: 31  GGFAQVYTAEISPIDPFINSSIVCLKRV-IVPDKPSLNTLRAEVDAMKLLRNNTHVVSYI 89
           G F  VY A     D   N +IV +K V +   +  ++ L  E+  +  LR+  ++ +YI
Sbjct: 24  GNFGDVYKA----FDK-TNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELRS-PYITNYI 77

Query: 90  DSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMH 149
                   T I    ++++MEYC  G   D + T   N L EN++  I  +V +G+  +H
Sbjct: 78  T-------TMIEDVSMWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLH 130

Query: 150 ALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQY 209
             +   +HRDIK  N+LLT  G  KL DFG V G IR       F           T  +
Sbjct: 131 DQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYW 178

Query: 210 RSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFP---- 265
            +PE++N  +    NEK+DIW+LG+ +Y+L     P  K     ++  S      P    
Sbjct: 179 MAPEVVN-KESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVM-VSLPRRKPPKLHG 236

Query: 266 HYSDRMKSLIRITLNVQPSQRPNIYQLL--EEVS-----------------KIQNVPCPI 306
            YSD  K  +   L   P+ RP+   LL  E V+                 K+QN     
Sbjct: 237 QYSDVAKGFVAACLVKDPNLRPSAEMLLTNEFVTNTEINDLKSDIDFVKRRKVQNNYSKA 296

Query: 307 PDFYLQRKL 315
           P F LQ KL
Sbjct: 297 PKFQLQEKL 305

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 139/331 (41%), Gaps = 61/331 (18%)

Query: 15  LSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIV-----CLKRVIVPDKPSLNTL 69
           + V   + RI + L  GG + VY  ++S     I++ I       LK++I P   S++  
Sbjct: 23  IRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNG 82

Query: 70  RAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRL--QN 127
             E++  K  ++  +V+  IDS   +     GS  +++++ Y   G L D +N RL    
Sbjct: 83  MREIENYKRFQS-PYVIKSIDSQVMQ--EKDGSKTIYIVLPYYSLGSLQDSINRRLLEGT 139

Query: 128 RLHENEILDIMSQVSQGVAAMHA---------------------------------LQPP 154
            + E E + IM  V++G+  +H                                  L+  
Sbjct: 140 FVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMD 199

Query: 155 LL-----------HRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMK 203
           +L           HRDI   N+L +S G   + D GS         N  + + +Q  +  
Sbjct: 200 MLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVND 259

Query: 204 NTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGE-------NAILH 256
           N T  Y  PE++NL     ++ K DIW+LG   Y L +  +PFE+  +        AI  
Sbjct: 260 NCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINT 319

Query: 257 ASFQFPNFPHYSDRMKSLIRITLNVQPSQRP 287
             + FP    +S+ + S+I+  + V P QRP
Sbjct: 320 GKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 93.2 bits (230), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 122/244 (50%), Gaps = 40/244 (16%)

Query: 67  NTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQ 126
           +T+  E++  KL+  + +++S ID     F+ +   Y   +++E C  G L D +  R +
Sbjct: 94  STILKEIEIHKLVNGHKNIISMID----HFEIDATMY---MVLELCGAGSLYDII-CRSK 145

Query: 127 NRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIR 186
             L E E   +M Q+   V  +H  +  ++H D+K+ N+L+ S  + +LCDFG       
Sbjct: 146 RSLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH------ 197

Query: 187 PPTNPQEFTYVQHDIMKNT-----TAQYRSPEMIN-----LGKGLPINEKSDIWALGVFL 236
                   ++V  DI  N+     T  Y SPE+I+       K L   ++SDIW++G+ L
Sbjct: 198 --------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVL 249

Query: 237 YKLCYYTTPFEKTG-----ENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQ 291
           Y + +  TPFE T      EN I+   + F      S+++K LI+  L +QP +R  I +
Sbjct: 250 YAMIFDKTPFEATTLRSTYEN-IVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVE 308

Query: 292 LLEE 295
           ++ +
Sbjct: 309 IVSD 312

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 90.5 bits (223), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 84/339 (24%), Positives = 144/339 (42%), Gaps = 63/339 (18%)

Query: 13  TLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAE 72
           + +S+   + RI K L  GG + VY  E    + F       LK+   P      ++ + 
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVESKEGELFA------LKKTRCP----FGSIGSI 66

Query: 73  VDAMKLLRN-----NTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQN 127
             AMK + N     + ++   +DS   +     GS  V++L+ Y  +G L D +N  L +
Sbjct: 67  SPAMKEVANYQRFSSPYIAQIVDSQVVQ--EKDGSKTVYVLLPYFAKGSLQDLINRHLLD 124

Query: 128 --RLHENEILDIMSQVSQGVAAMHALQP-------------------PLL---------- 156
             ++ E +IL +   +++G+  +H   P                    LL          
Sbjct: 125 CTQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGE 184

Query: 157 ------HRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNP-QEFTYVQHDIMKNTTAQY 209
                 HRD+K  N++++      + D GS C   R   N  Q     Q     N T  Y
Sbjct: 185 SQQSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSY 243

Query: 210 RSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEK----TGEN---AILHASFQFP 262
            +PE++++     I EK DIW+ G  +Y +C+  +PFE+    +G +   AI    +  P
Sbjct: 244 AAPEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVP 303

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQN 301
               YS  +  LI   L+V P QRP++ +L+  + ++Q 
Sbjct: 304 RGTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 92.4 bits (228), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 131/296 (44%), Gaps = 53/296 (17%)

Query: 11  PGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLR 70
           P TL ++        K +  G F  V+ A  +     +   +V +K +I  D     T  
Sbjct: 12  PSTLFTID-------KCVGKGNFGDVFKAMNN-----VTKEVVAIK-IINLDDSEEETFE 58

Query: 71  --AEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGS-YEVFLLMEYCDRGGLIDFMNTRLQN 127
              E+  M LL++          + A++ T I   Y ++++MEYC  G   D + T  + 
Sbjct: 59  IIKEMRLMSLLKS---------PYIARYITTINEDYLMWIVMEYCGGGSARDLIKTCYRE 109

Query: 128 RLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRP 187
            L EN++  ++  V  G+  +HA     +HRDIK  N+LLT  G  K+ DFG V   +R 
Sbjct: 110 GLAENKVAFVVKSVLLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEMRS 166

Query: 188 PTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFE 247
               + F           T  + +PE++ + +G+  NEKSDIW+LG+  Y+L     P  
Sbjct: 167 TMKAKTFV---------GTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPLA 216

Query: 248 KTGENAILHASFQFPNFPH---------YSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           K     ++       N P          Y++ +K  I   L   P +RP+  +LLE
Sbjct: 217 KYDAIRVMR------NIPKRKPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLE 266

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 92.8 bits (229), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 132/285 (46%), Gaps = 29/285 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +    D F   ++    +  +  + +   L +E+   K +  + ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-AHPNIV 142

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            +ID      D+N     V++L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFED--DSN-----VYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+   S  + K+ DFG    +     N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----ANESERKYTI-----CGT 242

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHA----SFQFP 262
             Y +PE++ +GK    + + DIW+LGV LY L     PF+    N I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNVPCPIP 307
                SD  K LIR  L++ P +RP++ ++++ V      P  IP
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIP 346

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 92.4 bits (228), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 132/274 (48%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +      F   ++    ++ +  + +   L +E+   K +R+  +VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRH-FNVV 151

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            +ID      DTN     V++L+E C  G L++ +  R    + E E+   M+Q+   + 
Sbjct: 152 QFIDCFED--DTN-----VYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIK 202

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+      + K+ DFG    +     N +E  Y         T
Sbjct: 203 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVL----ANDRERKYTV-----CGT 251

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HASFQFP 262
             Y +PE++ +GK    + + DIW++GV +Y L     PF+    N I     +  F FP
Sbjct: 252 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDFAFP 310

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
              + S+  K+LI   L+  P +RP+I ++++ V
Sbjct: 311 KDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 134/301 (44%), Gaps = 58/301 (19%)

Query: 55  LKRVIVP--DKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYC 112
           LKR+  P  +  S++    EVD  K  ++  ++++ +DS   +     GS  + +L+ Y 
Sbjct: 73  LKRIRCPFGNIESISAAMKEVDNYKRFQS-PYIITLVDSQVVQ--EKDGSKTLCILLPYF 129

Query: 113 DRGGLIDFMNTRL--QNRLHENEILDIMSQVSQGVAAMHA-------------------- 150
             G L D +N  L     + E E + IM  +++G+  +H                     
Sbjct: 130 PLGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSY 189

Query: 151 ------------LQPPLL------------HRDIKIENVLLTSRGHYKLCDFGSVCGIIR 186
                       L+  +L            HRDI++ N+L +S G   + D GS C    
Sbjct: 190 SDEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADI 249

Query: 187 PPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF 246
             +   +   +Q  +  N +  Y +PE++N+     I+ K+DIW++G   Y + +  +PF
Sbjct: 250 TVSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPF 309

Query: 247 EK----TGEN---AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKI 299
           E+    +G +   AI    + FP    YS+ + ++I+  L V P+ RP+I +LL+ +  +
Sbjct: 310 ERELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDL 369

Query: 300 Q 300
           Q
Sbjct: 370 Q 370

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/337 (23%), Positives = 148/337 (43%), Gaps = 59/337 (17%)

Query: 13  TLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVP--DKPSLNTLR 70
           + +SV  H+  I + L  GGF+ VY  E         + ++ LK++  P     S++   
Sbjct: 17  SYVSVNGHRYHIKRLLGEGGFSFVYLVESR------ENGLMALKKIRCPFGSIGSISPAM 70

Query: 71  AEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQN--R 128
            EVD  +  ++  ++   IDS   +     GS  V++L+ Y  +G L D +N  L +  +
Sbjct: 71  KEVDNYQKFKS-PYIAQIIDSQVVQ--ERDGSKTVYILLPYFSKGSLQDEINRHLLDCTQ 127

Query: 129 LHENEILDIMSQVSQGVAAMHALQPP-------------------LL------------- 156
           + E E++ +   V++G+  +H   P                    LL             
Sbjct: 128 VPELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQ 187

Query: 157 ---HRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPE 213
              H DIK  N++++S G   + D GS         + Q     Q    ++ T  + +PE
Sbjct: 188 AYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPE 247

Query: 214 MINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHAS---------FQFPNF 264
           ++++     I EK D+W+ G  +Y +C+  +PFE+  E  I  AS         +  P+ 
Sbjct: 248 ILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFER--EEQISGASVTYSLTTGKYSIPSG 305

Query: 265 PHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQN 301
            +YS  +  +++  LNV P  RP++ +L+  +  +Q+
Sbjct: 306 TNYSSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQS 342

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 134/275 (48%), Gaps = 29/275 (10%)

Query: 26  KYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHV 85
           ++L  GGFA+ +  +      F   ++    ++ +  + +   L +E+   K + ++T++
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM-SHTNI 140

Query: 86  VSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGV 145
           V +ID     F+ N+    V++L+E C  G L++ +  R    + E E+   M+Q+  G+
Sbjct: 141 VQFIDC----FEDNVN---VYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGI 191

Query: 146 AAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNT 205
             MH+ +  ++HRD+K+ N+      + K+ DFG     +      ++FT          
Sbjct: 192 QYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG--LAAVLANDRERKFTIC-------G 240

Query: 206 TAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HASFQF 261
           T  Y +PE++ +GK    + + DIW++GV LY L     PF+    N I       +F +
Sbjct: 241 TPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAY 299

Query: 262 PNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
           P     S   K LI   L++ P +RP+I ++++ V
Sbjct: 300 PKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 133/285 (46%), Gaps = 29/285 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +    + F   ++    +  +  + +   L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            +ID      D+N     V++L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFED--DSN-----VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+   S  + K+ DFG    +     N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----ANESERKYTI-----CGT 242

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHA----SFQFP 262
             Y +PE++ +GK    + + DIW+LGV LY L     PF+    N I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNVPCPIP 307
                SD  K LIR  L++ P +RP++ ++++ V      P  IP
Sbjct: 302 RDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIP 346

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/296 (27%), Positives = 128/296 (43%), Gaps = 51/296 (17%)

Query: 11  PGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRV-IVPDKPSLNTL 69
           P T+ S+     R       G F  VY A    ID  +   IV +K V +      +  +
Sbjct: 17  PSTIYSIQDCVGR-------GNFGDVYKA----IDK-LTGEIVAIKVVNLESSDEDIELI 64

Query: 70  RAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRL 129
             E+  +  L++  ++ +YI        T +    ++++MEYC  G   D +       L
Sbjct: 65  AQEIFFLAELKS-PYITNYIT-------TMLEDVSMWIVMEYCGGGSCSDLIRYHYNEGL 116

Query: 130 HENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPT 189
           HE+++  I   V +G+  +H  +   +HRD+K  NVLLT  G  KL DFG V G +R   
Sbjct: 117 HEDKVAFITKNVLRGLQYLHEQRK--IHRDVKAANVLLTDDGLVKLADFG-VSGQLRSTA 173

Query: 190 NPQEFTYVQHDIMKNTTAQYRSPEMI-NLGKGLPINEKSDIWALGVFLYKLCYYTTPFEK 248
               F           T  + +PE+I N   G   NEK+DIW+LG+ +Y+L     P+ K
Sbjct: 174 KRNTFV---------GTPYWMAPEIISNSSHGY--NEKADIWSLGITVYELLKGCPPYAK 222

Query: 249 TGENAILHASFQFPNFPH---------YSDRMKSLIRITLNVQPSQRPNIYQLLEE 295
                ++       N P          +SD  K  I   L   P +RP   +LL++
Sbjct: 223 YDAGKVMR------NIPKKNLQDCMVSFSDAAKLFISACLIKDPDERPTATELLQQ 272

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 133/285 (46%), Gaps = 29/285 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +    + F   ++    +  +  + +   L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            +ID      D+N     V++L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFED--DSN-----VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+   S  + K+ DFG    +     N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----ANESERKYTI-----CGT 242

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHA----SFQFP 262
             Y +PE++ +GK    + + DIW+LGV LY L     PF+    N I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNVPCPIP 307
                SD  K LIR  L++ P +RP++ ++++ V      P  IP
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIP 346

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 128/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +         F   ++  L    +  + +   L +E+   K ++N  ++V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKN-VNIV 143

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            +ID      DTN     V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 144 QFIDCFED--DTN-----VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+      + K+ DFG    +     N +E  Y         T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAAVL----ANDRERKYTV-----CGT 243

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----ASFQFP 262
             Y +PE++ +GK    + + DIW++GV LY L     PF+    N I        F FP
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP 302

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
              + S   K LI+  L++ P +RP++ ++++ V
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 132/285 (46%), Gaps = 29/285 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +    + F   ++    +  +  + +   L +E+   K +  + ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-AHPNIV 142

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            ++D      D+N     V++L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFVDCFED--DSN-----VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+   S  + K+ DFG    +     N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----ANESERKYTI-----CGT 242

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHA----SFQFP 262
             Y +PE++ +GK    + + DIW+LGV LY L     PF+    N I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNVPCPIP 307
                SD  K LIR  L++ P +RP++ ++++ V      P  IP
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIP 346

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 89.7 bits (221), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 135/290 (46%), Gaps = 29/290 (10%)

Query: 11  PGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLR 70
           P +L+       R   +L  GGFA+ +  +      F   ++    ++ +  + +   L 
Sbjct: 81  PPSLIKTRGRDYRRGHFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLL 137

Query: 71  AEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLH 130
           +E+   K +++  ++V ++D      DTN     V++L+E C  G L+D M  R    L 
Sbjct: 138 SEIQIHKSMKH-PNIVHFVDCFED--DTN-----VYILLEICSNGSLMDLMKKR--KTLT 187

Query: 131 ENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTN 190
           E E+    +Q+   V  MH+ +  ++HRD+K+ N+      + K+ DFG    +     N
Sbjct: 188 EPEVRFFTTQICGAVKYMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAAVL----AN 241

Query: 191 PQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTG 250
            +E  Y         T  Y +PE++ +GK    + + DIW++GV +Y L     PF+   
Sbjct: 242 NRERKYTV-----CGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKD 295

Query: 251 ENAILH----ASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
            N I        + +P   + S   K+LI   L V P +RP+I +++++V
Sbjct: 296 VNVIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 89.4 bits (220), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 88/331 (26%), Positives = 141/331 (42%), Gaps = 73/331 (22%)

Query: 13  TLLSVGSHQARIIKYLTSGGFAQVYTAE-ISPIDPFINSSIV---------CLKRVIVP- 61
           T + VGS +  + K +  G FA V+ A  I+P  P ++ S+V         C    IVP 
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 62  ----DKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGL 117
               +K  L  L  E+  +K + ++ H+V  ID           S + +L+MEYC  G L
Sbjct: 89  SKLKNKKLLENLEIEIAILKKI-SHPHIVKLIDFERT-------SKDFYLIMEYCSLGDL 140

Query: 118 IDFMNTRLQ----------------------NRLHENEILDIMSQVSQGVAAMHALQPPL 155
              +  R Q                      N LH+  IL+ + Q+S  +  + +    L
Sbjct: 141 TFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKN--L 198

Query: 156 LHRDIKIENVLLTS-----RGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQ-- 208
           +HRDIK +N+LL++            D G V     P     +F + +   + NT+    
Sbjct: 199 VHRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLPNTSMAET 256

Query: 209 ------YRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQ-- 260
                 Y +PE++N  K    N K+D+W++G  LY++CY   PF K   +  L+   +  
Sbjct: 257 LCGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPF-KASNHLELYKKIKKA 312

Query: 261 -----FPNFPHYSDRMKSLIRITLNVQPSQR 286
                FP +    + +KSLI   L   P +R
Sbjct: 313 NDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 130/274 (47%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +      F   ++  L    +  + +   L +E+   K +R+  ++V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMRH-ANIV 161

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            +ID      +TN     V++L+E C  G L++ +  R    L E E+    +Q+  G+ 
Sbjct: 162 QFIDCFED--ETN-----VYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+      + K+ DFG    +     N +E  Y         T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVL----ANDRERKYTV-----CGT 261

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----ASFQFP 262
             Y +PE++ +GK    + + DIW++GV +Y L     PF+    N I        F FP
Sbjct: 262 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFP 320

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
              + S   + L++  L++ P +RP+I ++L+ V
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 128/277 (46%), Gaps = 28/277 (10%)

Query: 21  QARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLR 80
           Q  I++ +  G F  VY A     +  +   +V L+     D+P ++ L  E+  +  LR
Sbjct: 19  QYEILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDT---DEP-IDLLAQEIFFLSELR 74

Query: 81  NNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQ 140
           +      YI ++   F  ++    ++++MEYC  G   + +    +++L E++   I+S+
Sbjct: 75  S-----PYITNYKTAFLVDVS---MWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSE 126

Query: 141 VSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHD 200
           V  G+  +H+ +   +HRDIK  N+LLT  GH KL DFG V G +        F      
Sbjct: 127 VLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV----- 178

Query: 201 IMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHA--S 258
                T  + +PE+I+  K    NE +DIW+LG+ + +L     P +K      L A   
Sbjct: 179 ----GTPFWMAPEVIDRNKK-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPK 233

Query: 259 FQFPNF-PHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
              P     +S   K  +   L   PSQRP   +LL+
Sbjct: 234 RDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 129/274 (47%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +         F   ++    ++ +  + +   L +E+   K +++  ++V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-VNIV 155

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            +ID      DTN     V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 156 QFIDCFED--DTN-----VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+    + + K+ DFG    +     N +E  Y         T
Sbjct: 207 YMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATL----ANDRERKYTV-----CGT 255

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----ASFQFP 262
             Y +PE++ +GK    + + DIW++GV +Y L     PF+    N I        F FP
Sbjct: 256 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFSFP 314

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
                S   K LI+  L++ P +RP++ ++++ +
Sbjct: 315 KDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/333 (23%), Positives = 140/333 (42%), Gaps = 61/333 (18%)

Query: 13  TLLSVGSHQARIIKYLTSGGFAQVYTAEI-----SPIDPFINSSIVCLKRVIVPDKPSLN 67
           T + V   + +I + L  GG + VY  ++     S  +    + +  LK++I P   +++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  TLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRL-- 125
               E++  K  ++  +V+  IDS   +     GS  +++++ Y   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQ--EKDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLHENEILDIMSQVSQGVAAMHA---------------------------------LQ 152
              + E E + IM  V++G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 153 PPLL-----------HRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDI 201
             +L           HRDI   N+L +S G   + D GS         N  + + +Q  +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 MKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGE-------NAI 254
             N T  Y +PE++NL     ++ K DIW++G   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 255 LHASFQFPNFPHYSDRMKSLIRITLNVQPSQRP 287
               + FP    +S+R+  +I+  + V P QRP
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 134/295 (45%), Gaps = 62/295 (21%)

Query: 14  LLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV--PDKPSLNTLRA 71
           L  VG++  +I+K +  G F +VY A   P            K+V++   DK   N +R 
Sbjct: 33  LNEVGNY--KILKQIGEGSFGKVYLALHKP----------THKKVVLKSSDKTDPNVVR- 79

Query: 72  EVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHE 131
                ++  +      YI      ++  I   +V++++EYC    L D++ ++   R+  
Sbjct: 80  -----EIFYHRQFDFPYI---TKLYEVIITETKVWMVIEYCPNKELYDYLLSK--KRISL 129

Query: 132 NEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNP 191
           +E   I +Q+   V   H+L    +HRD+K+EN+LL    + KL DFG            
Sbjct: 130 DESARIFAQIVGAVYYAHSLS--CVHRDLKLENILLDKDNNAKLTDFG------------ 175

Query: 192 QEFTYVQHDIMKNT-------TAQYRSPEMINLGK--GLPINEKSDIWALGVFLYKLCYY 242
             FT    D  KNT       T  Y +PE++   K  G  I    DIWALG+ LY +   
Sbjct: 176 --FT---RDFSKNTQLETICGTTVYMAPELLRREKYDGYKI----DIWALGILLYTIING 226

Query: 243 TTPFE----KTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
           T PF+    K  E  I+ AS  + N  +++D    L+   L+  PS RP I Q+L
Sbjct: 227 TMPFDEDDPKKTELKIISASPDYDN-KYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 128/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +      F   ++    ++ +  + +   L +E+   K +R+  ++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRH-PNIV 133

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            + D      DTN     V++L+E C  G L+D +  R Q  L E E+    +Q+   + 
Sbjct: 134 QFTDCFED--DTN-----VYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+      + K+ DFG    +     N +E  Y         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVL----ANDRERKYTI-----CGT 233

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----ASFQFP 262
             Y +PE++  GK    + + D+W++GV +Y L     PF+    N I        F FP
Sbjct: 234 PNYIAPEVLT-GKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFNFP 292

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
                S   K LI+  L++ P +RP++ +++E V
Sbjct: 293 RDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 128/274 (46%), Gaps = 35/274 (12%)

Query: 28  LTSGGFAQVYTAEISPIDPFINSSIVCL---KRVIVPDKPSLNTLRAEVDAMKLLRNNTH 84
           L  GGFA+ +      I   +  S  C    K+ I  ++     L +E+   + LR  +H
Sbjct: 99  LGEGGFARCF-----HIKDDVGISFACKIVSKKSIKTERTKFKLL-SEIQIHQNLRY-SH 151

Query: 85  VVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQG 144
           +V ++D    + +       V++L+E C  G L+D +  R    L E E+  + +QV   
Sbjct: 152 IVKFMDCFEDELN-------VYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCGA 202

Query: 145 VAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKN 204
           +  MH+    ++HRD+K+ NV      + K+ DFG    +    +N  E  Y        
Sbjct: 203 INYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG---- 252

Query: 205 TTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----ASFQ 260
            T  Y +PE+I L K +  + ++DIW+LG+ +Y +     PF+      I        ++
Sbjct: 253 -TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYE 310

Query: 261 FPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           FP   + ++ +K LI+  L + PSQRP I  +L+
Sbjct: 311 FPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 128/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +      F   ++    ++ +  + +   L +E+   K +++  ++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-PNIV 133

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            + D      DTN     V++L+E C  G L+D +  R Q  L E E+    +Q+   + 
Sbjct: 134 QFTDCFED--DTN-----VYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+      + K+ DFG    +     N +E  Y         T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVL----ANDRERKYTI-----CGT 233

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----ASFQFP 262
             Y +PE++  GK    + + DIW++GV +Y L     PF+    N I        F FP
Sbjct: 234 PNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFP 292

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
                S   K LI+  L++ P +RP++ +++E V
Sbjct: 293 KDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/194 (32%), Positives = 95/194 (48%), Gaps = 18/194 (9%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +       + E+++  I+    +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMIN-LGKGLPI 223
           +LLT  G  KL DFG V G IR       F           T  + +PE+IN   KG   
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYWMAPEVINKQCKGY-- 191

Query: 224 NEKSDIWALGVFLYKLCYYTTPFEKTGE-NAILHASFQFPNFPH--YSDRMKSLIRITLN 280
           NEK+DIW+LG+  Y+L     P  K      +L+   + P   H  YS++ K  + + L 
Sbjct: 192 NEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLI 251

Query: 281 VQPSQRPNIYQLLE 294
             P QRP+I  LLE
Sbjct: 252 KDPKQRPSIEALLE 265

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/339 (23%), Positives = 140/339 (41%), Gaps = 61/339 (17%)

Query: 13  TLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVC-----LKRVIVPDKPSLN 67
           T + V   + +I + L  GG + VY  ++      + + +       LK++I P+  S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  TLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRL-- 125
               E++  K  ++  +V+  IDS   +     GS  +++++ +   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQ--EKDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 126 QNRLHENEILDIMSQVSQGVAAMHA---------------------------------LQ 152
              + E E + IM  V +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 153 PPLL-----------HRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDI 201
             +L           HRDI   N+L +S G   + D GS         N  +   +Q  +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 MKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGE-------NAI 254
             N T  Y +PE++ L     ++ K DIW+LG   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
               + FP    +S+ + S+I+  + V P QRP   QLL
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 133/290 (45%), Gaps = 29/290 (10%)

Query: 11  PGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLR 70
           P +L+       R   +L  GGFA+ +  +      F   ++    ++ +  + +   L 
Sbjct: 84  PPSLIKTRGRDYRREHFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLL 140

Query: 71  AEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLH 130
           +E+   K +++ +++V +ID      D N     V++L+E C  G L+D +  R    L 
Sbjct: 141 SEIQIHKSMKH-SNIVQFIDCFED--DAN-----VYILLEICPNGSLMDLLKKR--KSLT 190

Query: 131 ENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTN 190
           E E+    +Q+   +  +H+ +  ++HRD+K+ N+      + K+ DFG    +     N
Sbjct: 191 EPEVRFFTTQICGAIKYLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLAAVL----AN 244

Query: 191 PQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTG 250
            +E  Y         T  Y +PE++ +GK    + + DIW++GV +Y L     PF+   
Sbjct: 245 DRERKYTVCG-----TPNYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKD 298

Query: 251 ENAILH----ASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
            N I        + +P   + S   + LI   L++ P QRP I  ++++V
Sbjct: 299 VNVIYERIKLCKYGYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 89/179 (49%), Gaps = 20/179 (11%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +   L+  + E E   I  QV   +  +H+    ++HRDIK ENV++ S+G  K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWALG 233
            L DFGS   +   P           D+   T   Y +PE+++   G P + K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLS---GEPFDGKPQDIWAIG 1197

Query: 234  VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQL 292
            V LY + +   PF    E  IL  + +F      S+   +LI++ LN  PSQRP I ++
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 86.3 bits (212), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 126/272 (46%), Gaps = 39/272 (14%)

Query: 31  GGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPS--LNTLRAEVDAMKLLRNNTHVVSY 88
           G F  VY         +I ++ VC  +V+  D     +  ++ EV  +  L+   ++  Y
Sbjct: 28  GKFGIVYKGY------YIKTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLKQVPNITHY 81

Query: 89  IDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAM 148
             S+       + + E++++MEYC  G L   +      ++ E  I  IM ++   +A M
Sbjct: 82  YGSY-------LNNTELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALM 129

Query: 149 HALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQ 208
           H  +  ++HRDIK  NVL+T+ GH KLCDFG    + +        T ++   M   T  
Sbjct: 130 HIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQ--------TKIRRQTMAG-TPY 180

Query: 209 YRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFP--- 265
           + +PE+I   +G+  + K DIW+LG+  Y++     P+      A+        + P   
Sbjct: 181 WMAPEVIM--EGVYYDTKVDIWSLGITAYEIATGNPPYCDV--EALRAMQLITKSKPPRL 236

Query: 266 ---HYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
               +S  +K  I + L+  P +RP+  +LL+
Sbjct: 237 EGRQHSSALKEFIALCLDEDPKERPSAEELLK 268

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 84.3 bits (207), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/352 (21%), Positives = 143/352 (40%), Gaps = 65/352 (18%)

Query: 6   VAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPS 65
              +  G  +S+      +   L  G    +Y  +        +  +  LK+V  P   +
Sbjct: 15  CGFWFDGVRISINGKSYLVTTLLREGELTALYQVKCPKRSH--SGGVYALKKVTCPIGRA 72

Query: 66  LNTLRAEVDAMKLLRNNT-HVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTR 124
               RA  +     R N+ ++ + +D   A+ D   G+  +++L+ Y   G L D +N  
Sbjct: 73  DFVTRAMTEISNYQRFNSPYITNILDFQVAQHDN--GTKIIYMLLPYFPAGSLQDLINNM 130

Query: 125 L--QNRLHENEILDIMSQVSQGVAAMHA-------------------------------- 150
           +   + L E+ ++ +M  + +GV  MH                                 
Sbjct: 131 IIRGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDA 190

Query: 151 -----LQPPL--------LHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP---TNPQEF 194
                L PPL        +H  +  EN++L+S G   + +  S    +R P   T+  + 
Sbjct: 191 MELDLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKL 247

Query: 195 TYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGE--- 251
             +Q  + +N+   Y  PE+++L     I  + DIW+LG   Y L Y  + F +  +   
Sbjct: 248 LGLQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCG 307

Query: 252 ----NAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKI 299
               ++I   +F FP+ P YS  +K +++  L + P +RP+IY+ L +  ++
Sbjct: 308 TPIKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 85.9 bits (211), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 127/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +      F   ++    ++ +  + +   L +E+   K +R+ T++V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRH-TNIV 139

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            ++D      DTN     V++L+E C  G L+D +  R    L E E+    +Q+   V 
Sbjct: 140 QFVDCFED--DTN-----VYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+      + K+ DFG    +     N +E  Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFGLAAVL----ANDRERKYTV-----CGT 239

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----ASFQFP 262
             Y +PE++  GK    + + DIW+ GV +Y L     PF+    N I        F FP
Sbjct: 240 PNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDFVFP 298

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
                S     LI+  L++ P +RP++ ++++ V
Sbjct: 299 KDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 127/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +      F   ++    ++ +  + +   L +E+   K +R+  ++V
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRH-FNIV 139

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            +ID      DTN     V++L+E C  G L+D +  R    L E E+    +Q+   V 
Sbjct: 140 QFIDCFED--DTN-----VYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+      + K+ DFG    +     N +E  Y         T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFGLAAVL----ANDRERKYTV-----CGT 239

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----ASFQFP 262
             Y +PE++  GK    + + DIW+ GV +Y L     PF+    N I        + FP
Sbjct: 240 PNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDYVFP 298

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
                S    +LIR  L++ P +RP++ ++++ V
Sbjct: 299 RDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 139/333 (41%), Gaps = 61/333 (18%)

Query: 13  TLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIV-----CLKRVIVPDKPSLN 67
           T + V   + +I + L  GG + VY  ++      + + I+      LK++I P   S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  TLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRL-- 125
               E++  K  ++  +V+  IDS   + + N GS  +++++ Y   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVTQ-EKN-GSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLHENEILDIMSQVSQGVAAMH------------------------------------ 149
              + E E + IM  V++G+  +H                                    
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 150 --------ALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDI 201
                   A      HRDI   N+L +S G   + D GS         +  + + +Q  +
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 202 MKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGE-------NAI 254
             N T  Y +PE++NL     ++ K DIW++G   Y L +  +PFE+  +        AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LHASFQFPNFPHYSDRMKSLIRITLNVQPSQRP 287
               + FP    +S+ + ++I+  + V P QRP
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 128/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +         F   ++  L    +  + +   L +E+   K +++  ++V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMKHQ-NIV 205

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            +ID      DTN     V++L+E C  G L++ +  R Q  L E E+    +Q+   + 
Sbjct: 206 QFIDCFED--DTN-----VYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+      + K+ DFG     +      ++FT          T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG--LAAVLANDRERKFTVC-------GT 305

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----ASFQFP 262
             Y +PE++ +GK    + + D+W++GV +Y L     PF+    N I        F FP
Sbjct: 306 PNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDFIFP 364

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
                S   K L++  L++ P +RP+I ++++ V
Sbjct: 365 KEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 120/268 (44%), Gaps = 32/268 (11%)

Query: 26  KYLTSGGFAQVYTA-EISPIDPFINSSIVCLKRV-IVPDKPSLNTLRAEVDAMKLLRNNT 83
           K +  G F  VY A EI       +  IV +K V +      +  L  E+  +  LR+  
Sbjct: 19  KCVGRGNFGDVYKAVEIK------SGKIVAIKVVNLEHTNEDIELLSQEIFFLAELRS-P 71

Query: 84  HVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQ 143
           +V  Y+        T +    ++++MEYC  G   D +    +  L EN+   I  +V +
Sbjct: 72  YVTKYLT-------TLLEDVSIWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLK 124

Query: 144 GVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMK 203
           G+  +H  +   +HRDIK  N+LLT  G  KL DFG V G I+       F         
Sbjct: 125 GLRYLHEQKK--IHRDIKAANILLTDDGMVKLGDFG-VSGQIKATLKKDTFV-------- 173

Query: 204 NTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHA--SFQF 261
             T  + +PE++   +    NEK+DIW+LG+ +Y+L     P  K     ++ +    + 
Sbjct: 174 -GTPYWMAPEVVKKDES-GYNEKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRA 231

Query: 262 PNF-PHYSDRMKSLIRITLNVQPSQRPN 288
           P    HYS+  KS I   L   P+ RPN
Sbjct: 232 PKLHGHYSEDAKSFISHCLIKDPNARPN 259

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 127/278 (45%), Gaps = 30/278 (10%)

Query: 21  QARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPS-LNTLRAEVDAMKLL 79
           Q  I++ +  G F  VY A         ++ IV +K V + D    ++ L  E+  +  L
Sbjct: 19  QYEILQCIGRGNFGDVYKAR-----DLTSNEIVAIKVVNLEDTDEPIDLLAQEIFFLSEL 73

Query: 80  RNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMS 139
           R+      YI ++   F  ++    ++++MEYC  G   + +    ++++ E +   I+S
Sbjct: 74  RS-----PYITNYKTAFLVDVS---MWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVS 125

Query: 140 QVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQH 199
           +V  G+  +H+ +   +HRDIK  N+LLT  GH KL DFG V G +        F     
Sbjct: 126 EVLIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV---- 178

Query: 200 DIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHA-- 257
                 T  + +PE+I+  K    NE +DIW+LG+ + +L     P +K      L A  
Sbjct: 179 -----GTPFWMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIP 232

Query: 258 SFQFPNF-PHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
               P     +S   +  +   L   PSQRP   +LL+
Sbjct: 233 KRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 125/287 (43%), Gaps = 34/287 (11%)

Query: 11  PGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLR 70
           P +L  +     R       G F  VY A  +    ++   ++ L+         ++ L 
Sbjct: 12  PSSLFDIKECVGR-------GNFGDVYKAIDNITKKYVAIKVINLEY----SDEDIDLLA 60

Query: 71  AEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLH 130
            E+  +  L+++ ++++YI        T +    ++++M+YC  G   D +     N + 
Sbjct: 61  QEIFFLAELKSD-YIINYIT-------TIMEDVSMWIVMDYCGGGSCSDLIKIVYPNGIV 112

Query: 131 ENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTN 190
           E ++  I+  V  G+  +H  +   +HRDIK  N+LLT  G  KL DFG V G I+    
Sbjct: 113 EEKVSFIVKNVLLGLQYLHEQKK--IHRDIKAANILLTDDGQVKLGDFG-VSGQIKATLK 169

Query: 191 PQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTG 250
              F           T  + +PE+IN       +EK DIW+LG+  Y+L     P  K  
Sbjct: 170 RDTFV---------GTPYWMAPEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYD 220

Query: 251 ENAILHASFQF-PNFPH--YSDRMKSLIRITLNVQPSQRPNIYQLLE 294
              ++ +  +  P   H  Y+D  KS I   L   P  RPN+  LL+
Sbjct: 221 PVKVMTSLVKRKPPKLHGPYNDFTKSFISFCLIKDPKLRPNVQNLLK 267

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 87/184 (47%), Gaps = 22/184 (11%)

Query: 114  RGGLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGH 172
            + G ID  +    +  + E E   I  Q+  G++ +H  +  ++HRDIK ENV++ ++G 
Sbjct: 1092 KTGCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGF 1149

Query: 173  YKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGK--GLPINEKSDIW 230
             KL DFGS   +   P           D+   T   Y SPE++   K  G P     DIW
Sbjct: 1150 VKLIDFGSAAYVKNGP----------FDVFVGTI-DYASPEVLRGEKYEGKP----QDIW 1194

Query: 231  ALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIY 290
            ALG+ LY + +   PF    E  IL    +FP   + S     LI++ LN    +RP+I 
Sbjct: 1195 ALGILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSIT 1252

Query: 291  QLLE 294
             + E
Sbjct: 1253 DISE 1256

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 88/183 (48%), Gaps = 20/183 (10%)

Query: 116  GLIDFMNT-RLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G +D  +    ++ + E E   I  Q+  G+  +H     ++HRDIK ENV++ S+G  K
Sbjct: 1038 GSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1095

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKS-DIWALG 233
            L DFGS   +   P +     +V        T  Y +PE++    G P   KS DIWA+G
Sbjct: 1096 LIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLG---GNPYEGKSQDIWAIG 1141

Query: 234  VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
            + LY L Y   PF    E  IL    +F +    S   K+LI   LN    +RP I ++ 
Sbjct: 1142 ILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEIC 1199

Query: 294  EEV 296
            ++V
Sbjct: 1200 QDV 1202

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 82.8 bits (203), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 93/199 (46%), Gaps = 28/199 (14%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +     N + E ++  I SQV +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLHEQKK--IHRDIKAAN 143

Query: 165 VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPIN 224
           +LLT  G  KL DFG V G IR       F           T  + +PE+++  +    +
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRATLKRGTFV---------GTPYWMAPEVVS-KENDGYD 192

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFP---------HYSDRMKSLI 275
           EK+DIW+LG+ +Y+L     P  K     ++       N P         HYS   K+ +
Sbjct: 193 EKADIWSLGITVYELLKGAPPLSKCDPMKVM------INLPKRKPPALHGHYSHSAKNFV 246

Query: 276 RITLNVQPSQRPNIYQLLE 294
              L   P  R + Y+++E
Sbjct: 247 SSCLVKNPVGRASAYEMVE 265

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 134/282 (47%), Gaps = 34/282 (12%)

Query: 19  SHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPD-KPSLNTLRAEVDAMK 77
           +H   + + +  G F  VY A    ID   N  +V +K V + +    L  L  E+  + 
Sbjct: 19  AHNYIVKECVGRGNFGDVYRA----IDRTTNK-VVAIKVVDLENTNERLEVLAQEIFFLA 73

Query: 78  LLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDI 137
            L++  ++++YI        T +    ++++MEYC  G   D +     N L E ++  I
Sbjct: 74  ELKS-PYIINYIT-------TLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYI 125

Query: 138 MSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYV 197
             ++ +G+  +H  +   +HRDIK  N+LLT  GH KL DFG V G ++        T  
Sbjct: 126 TREILKGLQYLHEQKK--IHRDIKAANILLTEEGHVKLGDFG-VSGQLKS-------TLR 175

Query: 198 QHDIMKNTTAQYRSPEMINLG-KGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH 256
           +  I+   T  + +PE+ +   +G   +EK DIW+LG+ +++L     P  K     +L 
Sbjct: 176 RGTIV--GTPYWMAPEVASQNIEGY--DEKIDIWSLGITVFELLKGVPPLVKLDPIRVL- 230

Query: 257 ASFQFPNFPH----YSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           A+    + P     YSD  KS + + L   P++RP    LL+
Sbjct: 231 ANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 131/285 (45%), Gaps = 29/285 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +      F   ++  L    +  + +   L +E+   K +++  ++V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKH-PNIV 150

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            + D      DTN     V++L+E C  G +++ +  R +  L E E+   M Q+   + 
Sbjct: 151 QFTDCFED--DTN-----VYILLEICPNGSVMELL--RQRKHLTEPEVRFCMIQIIGAIR 201

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+ +  ++HRD+K+ N+      + K+ DFG    +     N +E  Y         T
Sbjct: 202 YMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFGLAAVL----ANDKERKYTI-----CGT 250

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFE----KTGENAILHASFQFP 262
             Y +PE++  GK    + + DIW++GV LY L +   PF+    +T    I    F FP
Sbjct: 251 PNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFP 309

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNVPCPIP 307
                S   K+LI   L + P+ RP++Y++ + V      P  +P
Sbjct: 310 ADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLP 354

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 122/292 (41%), Gaps = 41/292 (14%)

Query: 11  PGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLR 70
           P T +   S    I + +  G F  VY A        +   I+ L+      +  ++ L 
Sbjct: 25  PDTAVEKPSQLYDIKECVGKGSFGDVYRAIDKETGEMVAVKIINLEET----QDDIDVLA 80

Query: 71  AEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLH 130
            E+  +  LR    V +Y       + T +    ++++ME+C  G   D +    ++RL 
Sbjct: 81  QEIYFLSELRA-PFVTTY-------YKTYVEDVSMWIVMEFCGGGSCADLLKHLPEHRLP 132

Query: 131 ENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTN 190
           EN++  I+ +V  G+  +H+ +   +HRD+K  N+LLT  G  KL DFG V G I     
Sbjct: 133 ENKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQIMATLK 189

Query: 191 PQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTG 250
              F           T  + +PE+I    G   +EK+DIW+LG+   +L     P+ K  
Sbjct: 190 RNTFV---------GTPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPPYAKYD 238

Query: 251 ENAILHASFQFPNFP---------HYSDRMKSLIRITLNVQPSQRPNIYQLL 293
              +L       N P          ++   +  I + L   P+ RP    LL
Sbjct: 239 PMKVLM------NIPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 117/248 (47%), Gaps = 31/248 (12%)

Query: 62  DKPSLNTLRAEV-------DAMKLLRNNTHVVS-----YIDSHAAKFDTNIGSYEVFLLM 109
           DK + NT+  +V       D + LL    + ++     YI ++   F T +    ++++M
Sbjct: 53  DKSTGNTVAIKVVNLEETDDEIDLLAQEIYFLAELHSPYITNY---FSTFVEDVSMWIVM 109

Query: 110 EYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTS 169
           EYC  G   D +    +  L E ++  I  ++ +G+  +H+ +   +HRDIK  N+LLT 
Sbjct: 110 EYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQRK--IHRDIKAANILLTD 167

Query: 170 RGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDI 229
            G  KL DFG V G +        F           T  + +PE+I   +    NEK+DI
Sbjct: 168 DGKVKLGDFG-VSGQMMATRRRDTFV---------GTPFWMAPEVIARSE-QGYNEKADI 216

Query: 230 WALGVFLYKLCYYTTPFEKTGENAILHA--SFQFPNFP-HYSDRMKSLIRITLNVQPSQR 286
           W+LG+ +++L     P  +     +L +  S + P     YS  ++  + + LN  P++R
Sbjct: 217 WSLGITVFELLKGQPPLSQHDPMKVLMSIPSRRPPKLEDRYSHAIREFVSLCLNKDPAKR 276

Query: 287 PNIYQLLE 294
           P   +LL+
Sbjct: 277 PTASELLK 284

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 97/210 (46%), Gaps = 53/210 (25%)

Query: 104 EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
           +V++ +EYC    L +++   +Q+R+   E   + +Q+   V   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 164 NVLLTSRGHYKLCDFG------------SVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRS 211
           N+LL  +G  K+ DFG            +VCG                      T  Y +
Sbjct: 158 NILLDKKGRAKITDFGFTRECATKTMLETVCG----------------------TTVYMA 195

Query: 212 PEMINLGK--GLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPN-FPHYS 268
           PE+I      G  I    DIW+LGV LY + + T PF++  E       ++  N  P Y+
Sbjct: 196 PELIERKSYDGFKI----DIWSLGVILYTMIHGTMPFDEEDETK---TKWKIINEEPFYN 248

Query: 269 DRM-----KSLIRITLNVQPSQRPNIYQLL 293
           D +     K LI   L   PSQRP + Q+L
Sbjct: 249 DDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 88/179 (49%), Gaps = 20/179 (11%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +   ++  + E+E + I  Q++ G+  +H     ++HRDIK ENV++   G  K
Sbjct: 1045 GSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVK 1102

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWALG 233
            + DFGS   +   P +     +V        T  Y +PE++    G P   K  DIWA+G
Sbjct: 1103 IVDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLG---GEPYEGKPQDIWAIG 1148

Query: 234  VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQL 292
            V LY + Y   PF    E  IL A  +  +    SD   +LIR  LN   S+RP+I ++
Sbjct: 1149 VLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 98/209 (46%), Gaps = 30/209 (14%)

Query: 96  FDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPL 155
           +D    S ++++++EY ++G L + +  R    L ENE +    Q+  G++  HAL   +
Sbjct: 92  YDVWETSKDLYMVLEYVEKGELFNLLVER--GPLPENEAVRFFRQIIIGISYCHALG--I 147

Query: 156 LHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTA---QYRSP 212
           +HRD+K EN+LL  + + KL DFG                    D +  T+     Y +P
Sbjct: 148 VHRDLKPENLLLDHKFNVKLADFGMAA-------------LESKDKLLETSCGSPHYAAP 194

Query: 213 EMINLGKGLPINE-KSDIWALGVFLYKLCYYTTPFEKTGEN------AILHASFQFPNFP 265
           E+++   GLP +  +SD+W+ GV LY L     PF++   N       +    F+ P   
Sbjct: 195 EIVS---GLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDD 251

Query: 266 HYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
             S   + LI   L V P QR    ++L+
Sbjct: 252 EISSEAQDLIARILTVDPEQRIKTREILK 280

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 133/293 (45%), Gaps = 37/293 (12%)

Query: 31  GGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPS--LNTLRAEVDAMKLLRNNTHVVSY 88
           G F  VY         +  +  VC  +V+  D     +  ++ E+  +  L+   ++  Y
Sbjct: 28  GKFGVVYKGY------YTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQVPNITHY 81

Query: 89  IDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAM 148
             S+       +   +++++MEYC  G L   +      ++ E  I  IM ++    A M
Sbjct: 82  YGSY-------LNDTKLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALM 129

Query: 149 HALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQ 208
           H  +  ++HRDIK  NVL+T+ GH KLCDFG    + +        T ++   M   T  
Sbjct: 130 HIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQ--------TKIRRQTMAG-TPY 180

Query: 209 YRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF-EKTGENAI-LHASFQFPNFP- 265
           + +PE+I   +G+  + K DIW+LG+  Y++     P+ E     A+ L    + P    
Sbjct: 181 WMAPEVIM--EGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEG 238

Query: 266 -HYSDRMKSLIRITLNVQPSQRPNIYQLLEE--VSKIQNVPCPIPDFYLQRKL 315
             +S  +K +I + L+  P +RP+   LL+   +   +NVP  I    + R L
Sbjct: 239 RQHSSALKEIIALCLDEDPKERPSAEDLLKTKFIKLHKNVPVSILKELISRYL 291

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 112/234 (47%), Gaps = 36/234 (15%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLL N+T+V+   D     ++TN     +++++EY ++G L + +  +    
Sbjct: 90  IEREIIIMKLL-NHTNVLRLYDV----WETN---NNLYMVLEYAEKGELFNLLVEK--GP 139

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L ENE +    Q+  G++  HAL   ++HRD+K EN+LL  + + K+ DFG         
Sbjct: 140 LAENEAVRFFRQIIIGMSYCHAL--GIVHRDLKPENILLDHKSNIKIADFGMAA------ 191

Query: 189 TNPQEFTYVQHDIMKNTTA--QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTTP 245
                    +  +++ +     Y +PE+++   GLP N  ++DIW+ GV L+ L     P
Sbjct: 192 ------LETEDKLLETSCGSPHYAAPEIVS---GLPYNGLETDIWSCGVILFALLTGRLP 242

Query: 246 FEKTGEN------AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
           F++   N       +    F+ P     S   + LI   L V P QR    ++L
Sbjct: 243 FDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREIL 296

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 82/176 (46%), Gaps = 20/176 (11%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +   L+N + E E+  I  Q+  G+  +H     ++HRDIK ENV++ + G  K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWALG 233
            L DFGS   +   P           D+   T   Y +PE+++   G P   K  DIWA+G
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLS---GDPYEGKPQDIWAIG 1375

Query: 234  VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNI 289
            + LY + +   PF    E  IL     F      S   K+LI + LN    +RP I
Sbjct: 1376 ILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTI 1429

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 82/312 (26%), Positives = 131/312 (41%), Gaps = 51/312 (16%)

Query: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRV-I 59
           M   +    HP +L S+     R       G F  VY A        ++  +V +K V +
Sbjct: 3   MTIDECECSHPSSLYSIKQCVGR-------GNFGDVYKACEK-----VSGKVVAVKVVNL 50

Query: 60  VPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLID 119
                 +N L  E+  +  L++  ++ +YI        T      ++++MEYC  G   D
Sbjct: 51  EHTDEDINLLAQEIFFLAELKS-PYITNYIT-------TMTEDVSMWIIMEYCGGGSCAD 102

Query: 120 FMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFG 179
            +       L E++   I  +V +G+  +H  +   +HRDIK  N+LLT  G  KL DFG
Sbjct: 103 LLRNIYNCGLPESKSAYITREVLKGLEYLHEQKK--IHRDIKAANILLTDEGKVKLGDFG 160

Query: 180 SVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKL 239
            V G IR       F           T  + +PE+++       +EK+DIW+LG+ +Y+L
Sbjct: 161 -VSGQIRATLKRGTFV---------GTPFWMAPEVVSKDSD-GYDEKADIWSLGITVYEL 209

Query: 240 CYYTTPFEKTGENAILHASFQFPNFP---------HYSDRMKSLIRITLNVQPSQRPNIY 290
              + P  K     ++       N P         HYS   K  +   L   P  RP+  
Sbjct: 210 LKGSPPLYKCDPMKVM------VNLPKRKPPVLHGHYSSAAKHFVASCLVKNPKNRPSAV 263

Query: 291 QLL--EEVSKIQ 300
           +LL  E V+ +Q
Sbjct: 264 ELLNSEFVTNLQ 275

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 89/192 (46%), Gaps = 20/192 (10%)

Query: 106  FLLMEYCDRGGLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
            +L  E     G ID  +   L+  + E E   +  QV+ G+  +H     ++HRDIK EN
Sbjct: 1051 YLETEMHGETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDEN 1108

Query: 165  VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPIN 224
            V++ ++G  KL DFGS   +   P           D+   T   Y +PE++    G P  
Sbjct: 1109 VIVDNKGFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---GEPYE 1154

Query: 225  EK-SDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQP 283
             K  DIWA+GV LY + Y   PF    E  IL    +  +    S    +LIR  LN   
Sbjct: 1155 GKPQDIWAIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSV 1212

Query: 284  SQRPNIYQLLEE 295
            S+RP I  ++E+
Sbjct: 1213 SKRPTIDDIMED 1224

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 138/300 (46%), Gaps = 41/300 (13%)

Query: 5   QVAIYHPGTLLSVGSHQARIIKY-LTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDK 63
           Q+  +  G  L +GS     + Y  T+G  A +   ++     F +S++  +     PD 
Sbjct: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAI---KVISKTIFQDSNVTSMVDNTTPDA 70

Query: 64  PSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNT 123
                 R E+  MKLL N+ +V+   D     ++TN     +++++EY ++G L + +  
Sbjct: 71  LPYGIER-EIVIMKLL-NHANVLRLYDV----WETN---SNLYMVLEYAEKGELFNLLVE 121

Query: 124 RLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCG 183
           R    L ENE +    Q+  G++  HAL   ++HRD+K EN+LL ++ + K+ DFG    
Sbjct: 122 R--GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFGMAA- 176

Query: 184 IIRPPTNPQEFTYVQHDIMKNTTA--QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLC 240
                         +  +++ +     Y +PE+++   G+P +   SD+W+ GV LY L 
Sbjct: 177 -----------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILYALL 222

Query: 241 YYTTPFEKTGEN------AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
               PF++   N       +    F+ P     S   ++LI   L V P++R     +L+
Sbjct: 223 TGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILK 282

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 134/324 (41%), Gaps = 71/324 (21%)

Query: 15  LSVGSHQARIIKYLTSGGFAQVYTAEI-------SPIDPFINSSIVCLKRVIVPDKPSLN 67
           +++G     I K +  G FA V+ A +           P +N +I  + R  + +K  L 
Sbjct: 30  ITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSPPLNFAIKIVSRSKLKNKKLLE 89

Query: 68  TLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQ- 126
            L  E+  +K + N+ H+V  ID      D        +L+MEYC  G L   +  R + 
Sbjct: 90  NLEIEIAILKKI-NHPHIVKLIDCERTTTD-------FYLIMEYCALGDLTFLIKKRHEL 141

Query: 127 ---------------------NRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENV 165
                                N LH   IL+ + Q++  +  + +    L+HRDIK +N+
Sbjct: 142 IKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRS--KNLVHRDIKPQNL 199

Query: 166 LL--------TSRGHYKLCDFGSVCGIIRPPT-NPQEFTYVQHDIMKNTTAQ-------- 208
           LL         S+   KL       GI   P     +F + +   + NT+          
Sbjct: 200 LLLTPLINYNDSKAFKKL----GFIGIYELPILKIADFGFAR--FLPNTSMAETLCGSPL 253

Query: 209 YRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL------HASFQFP 262
           Y +PE++N  K    N K+D+W++G  LY++CY T PF+ +    +       +    FP
Sbjct: 254 YMAPEILNYQK---YNAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFP 310

Query: 263 NFPHYSDRMKSLIRITLNVQPSQR 286
           N+    + MK LI   L   P +R
Sbjct: 311 NYIQIQNDMKILISKLLTFDPQRR 334

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 85/275 (30%), Positives = 117/275 (42%), Gaps = 49/275 (17%)

Query: 24  IIKYLTSGGFAQVYTAEISPIDPFINSSIVC-LKRVIVPDKPSLNT---LRAEVDAMKLL 79
           I K L  G F +VY          I S  VC LK +   D    N     R EV+    L
Sbjct: 111 IGKVLGKGKFGRVYCVR------HIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSL 164

Query: 80  R--NNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILD- 136
           R  N T +  Y   H  K         V+LLMEY   G L       L+ R H N+++  
Sbjct: 165 RHPNLTQLYGYF--HDEK--------RVYLLMEYLVNGELY----KHLKGRSHFNDVVAS 210

Query: 137 -IMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFT 195
             + Q++  +  MH  +  +LHRDIK EN+++      KL DFG    +I P  + ++  
Sbjct: 211 YYVYQMADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFG--WSVITPKGSKRKTL 266

Query: 196 YVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGEN--- 252
                     T  Y SPE+I   +    NEK D+WALGV  Y+L   + PFE+  +    
Sbjct: 267 --------CGTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTY 315

Query: 253 -AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQR 286
             IL  +  FP+  H     + LI   L   P  R
Sbjct: 316 KRILKRNLIFPD--HVDTEARHLISRLLEYDPGDR 348

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 126/248 (50%), Gaps = 30/248 (12%)

Query: 53  VCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYC 112
           V +K++ +  +P    +  E+  M+  ++ +++V++IDS+ AK D       ++++MEY 
Sbjct: 646 VAIKQMNLEKQPKKELILNEILVMRESKH-SNIVNFIDSYLAKGD-------LWIVMEYM 697

Query: 113 DRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGH 172
           + G L D +   L   L E +I  +  +  +G+  +H+    +LHRDIK +N+LL+ +G+
Sbjct: 698 EGGSLTDVVTHCL---LSEGQIGAVCRETLKGLQFLHSKG--VLHRDIKSDNILLSLKGN 752

Query: 173 YKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWAL 232
            KL DFG  C  I    N +  T V        T  + +PE+++  +  P   K DIW+L
Sbjct: 753 IKLTDFG-FCAQIN-ENNLKRTTMVG-------TPYWMAPEVVSRKEYGP---KVDIWSL 800

Query: 233 GVFLYKLCYYTTPF-EKTGENAI-LHASFQFPNFPH---YSDRMKSLIRITLNVQPSQRP 287
           G+ + ++     P+  +T   A+ L A+   P        SD +   +   L V PS+R 
Sbjct: 801 GIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERA 860

Query: 288 NIYQLLEE 295
              +LL++
Sbjct: 861 TATELLDD 868

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 113/235 (48%), Gaps = 38/235 (16%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLL N+ +V+   D     ++TN    +++L++EY ++G L + +  R    
Sbjct: 76  IEQEIIIMKLL-NHPNVLRLFDV----WETN---SDLYLVLEYAEKGELFNMLVER--GP 125

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L ENE +    Q+  G++  H+L   ++HRD+K EN+LL ++ + K+ DFG         
Sbjct: 126 LPENEAVRAFRQIIIGISYCHSL--GVVHRDLKPENLLLDNKLNIKIADFGMAA------ 177

Query: 189 TNPQEFTYVQHDIMKNTTA---QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTT 244
                      D +  T+     Y +PE+I+   GLP     SD+W+ GV L+ L     
Sbjct: 178 -------LESEDKLLETSCGSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRL 227

Query: 245 PFEKTGEN------AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
           PF++   N       +    F+ P+    +   + L+   L V PS+R  I ++L
Sbjct: 228 PFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREIL 282

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 85/183 (46%), Gaps = 22/183 (12%)

Query: 116  GLIDFMNT-RLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +    +  + E+E   +  QV   +  +H     ++HRDIK ENV++ S G  K
Sbjct: 933  GSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGFVK 990

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLG--KGLPINEKSDIWAL 232
            L DFGS   I   P +     +V        T  Y +PE++     KG P     DIWAL
Sbjct: 991  LIDFGSAAYIKSGPFD----VFV-------GTMDYAAPEVLGGSSYKGKP----QDIWAL 1035

Query: 233  GVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQL 292
            GV LY + Y   P+    E  IL    +F    H S+   SLI+  L  +  +RP I ++
Sbjct: 1036 GVLLYTIIYKENPYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEI 1093

Query: 293  LEE 295
             E+
Sbjct: 1094 YED 1096

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 128/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           +L  GGFA+ +  +      F   ++    ++ +  + +   L +E+   K +++  ++V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-PNIV 137

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
            +ID      DTN     V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 138 QFIDCFED--DTN-----VYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH  +  ++HRD+K+ N+   S  + K+ DFG    +     N +E  Y         T
Sbjct: 189 YMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----ANDRERKYTV-----CGT 237

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH----ASFQFP 262
             Y +PE++  GK    + + DIW++GV +Y L     PF+    N I        + FP
Sbjct: 238 PNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNIIYERIKSGDYIFP 296

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
                S  +  LI+  L++ P +RP++ ++++ V
Sbjct: 297 REKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 111/236 (47%), Gaps = 38/236 (16%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLL N+ +V+         +D    S ++++++EY ++G L + +  R    
Sbjct: 76  IEREITIMKLL-NHPNVLRL-------YDVWETSTDLYMVLEYVEKGELFNLLIER--GP 125

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L ENE +    Q+  G++  HAL   ++HRD+K EN+LL  + + KL DFG         
Sbjct: 126 LPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMAA------ 177

Query: 189 TNPQEFTYVQHDIMKNTTA---QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTT 244
                      D +  T+     Y +PE+++   GLP +  +SD+W+ GV LY L     
Sbjct: 178 -------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRL 227

Query: 245 PFEKTGEN------AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           PF++   N       +    F+ P+    S   + LI   L V PS R    ++L+
Sbjct: 228 PFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILK 283

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 88/198 (44%), Gaps = 28/198 (14%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I+ +V+ G+  +H  +   +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPIN 224
           +LL   G  KL DFG V G IR       F           T  + +PE++        N
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTLKRDTFV---------GTPYWMAPEVVCCEVD-GYN 195

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPH---------YSDRMKSLI 275
           EK+DIW+LG+  Y+L     P  K     ++       N P          +SD  K  +
Sbjct: 196 EKADIWSLGITTYELLKGLPPLSKYDPMKVM------TNLPKRKPPKLQGPFSDAAKDFV 249

Query: 276 RITLNVQPSQRPNIYQLL 293
              L   P+ RP+ Y LL
Sbjct: 250 AGCLVKTPADRPSAYNLL 267

>KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86
           YAL017W
          Length = 368

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 88/179 (49%), Gaps = 21/179 (11%)

Query: 117 LIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLC 176
           L DF++ R  + + + E   I+ Q+   +  +H     ++HRDIK EN+++ +RGH +L 
Sbjct: 204 LFDFIDIR--DEVSDWECKLIIKQLVSAIKYLH--DRDIVHRDIKDENIIMDARGHIQLI 259

Query: 177 DFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLP-INEKSDIWALGVF 235
           DFGS    +R P      T++        T  Y  PE+    +G P + +  DIWALG+ 
Sbjct: 260 DFGSATNAVRGPFR----TFL-------GTIDYEPPEV---ARGEPFLGKPQDIWALGIL 305

Query: 236 LYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           LY L +   PF    + AIL    +FP     +     LI   L+ +  +RP I  ++E
Sbjct: 306 LYILRFKEPPF--LDQKAILTGDLKFPQGTSVNTDCIDLINAILSPRVDERPTIDDIVE 362

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 88/198 (44%), Gaps = 28/198 (14%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I+ QV+ G+  +H  +   +HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPIN 224
           +LL   G  KL DFG V G +R       F           T  + +PE++        N
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLRSTMKRDTFV---------GTPYWMAPEVVCCEVD-GYN 190

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPH---------YSDRMKSLI 275
           EK+DIW+LG+  Y+L     P  K     ++       N P          +SD  K  +
Sbjct: 191 EKADIWSLGITTYELLKGLPPLSKYDPMKVM------TNLPKRKPPKLQGSFSDAAKEFV 244

Query: 276 RITLNVQPSQRPNIYQLL 293
              L   P+ RP+ Y LL
Sbjct: 245 AGCLVKVPADRPSAYDLL 262

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 99/209 (47%), Gaps = 30/209 (14%)

Query: 96  FDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPL 155
           +D    + ++++++EY ++G L + +  R    L ENE +    Q+  G++  HAL   +
Sbjct: 94  YDVWETAQDLYMVLEYVEKGELFNLLVQR--GPLPENEAVRFFRQIIIGISYCHALG--I 149

Query: 156 LHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTA---QYRSP 212
           +HRD+K EN+LL  + + KL DFG                    D +  T+     Y +P
Sbjct: 150 VHRDLKPENLLLDHKFNIKLADFGMAA-------------LESKDKLLETSCGSPHYAAP 196

Query: 213 EMINLGKGLPINE-KSDIWALGVFLYKLCYYTTPFEKTGEN------AILHASFQFPNFP 265
           E+++   GLP +  +SD+W+ GV LY L     PF++   N       +    ++ P   
Sbjct: 197 EIVS---GLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGED 253

Query: 266 HYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
             S   + LI   L V+P QR    ++L+
Sbjct: 254 EISPEARDLIVQILTVEPEQRIKTREILK 282

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 89/198 (44%), Gaps = 28/198 (14%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I+ QV+ G+  +H  +   +HRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPIN 224
           +LL   G  KL DFG V G IR       F           T  + +PE++   +    N
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIRSTMKRDTFV---------GTPYWMAPEVV-CCEVDGYN 190

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPH---------YSDRMKSLI 275
           EK+DIW+LG+  Y+L     P  K     ++       N P          +S+  K  +
Sbjct: 191 EKADIWSLGITTYELLKGLPPLSKYDPMKVM------TNLPKRKPPKLQGSFSEAAKEFV 244

Query: 276 RITLNVQPSQRPNIYQLL 293
              L   P+ RP+ Y LL
Sbjct: 245 AGCLVKAPADRPSAYDLL 262

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 133/275 (48%), Gaps = 45/275 (16%)

Query: 31  GGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYID 90
           G    VYTA     +   ++ +V +K++ +  +P    +  E+  MK  R+N +VV++I+
Sbjct: 526 GASGGVYTA-----NQVKSNELVAIKQMDLEKQPKKELILNEIIVMKESRHN-NVVNFIN 579

Query: 91  SHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHA 150
           +H +K +       ++++MEY + G L D +   L   L E +I  +  +  +G+  +H+
Sbjct: 580 AHLSKGN-------LWIVMEYMEGGSLTDVVTHCL---LSEGQIGAVCRETLEGLKFLHS 629

Query: 151 LQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQ-- 208
               ++HRDIK +NVLL+ +G  KL DFG  C  I             +DI  N T    
Sbjct: 630 --KGVIHRDIKSDNVLLSMKGDIKLTDFG-FCAQI-------------NDIDLNRTTMVG 673

Query: 209 ---YRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF--EKTGENAILHASFQFPN 263
              + +PE+++  +  P   K DIW+LG+ + ++     P+  E   +   L A+   P 
Sbjct: 674 TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNEAPLKALYLIATNGTPK 730

Query: 264 F---PHYSDRMKSLIRITLNVQPSQRPNIYQLLEE 295
                + SD   + +   L V+P +R +  +LL +
Sbjct: 731 LKEPENLSDVFSNFLDRCLRVEPEERASAIELLAD 765

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 109/233 (46%), Gaps = 38/233 (16%)

Query: 72  EVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHE 131
           E+  MKLL N+T+V+   D    K +       +++++EY ++G L + +  R    L E
Sbjct: 89  EIIIMKLL-NHTNVLRLYDVWETKSN-------LYMVLEYVEKGELFNLLVER--GPLPE 138

Query: 132 NEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNP 191
           NE +    Q+  G++  HAL   ++HRD+K EN+LL  + + K+ DFG            
Sbjct: 139 NEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA--------- 187

Query: 192 QEFTYVQHDIMKNTTA---QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTTPFE 247
                   D +  T+     Y +PE+++   GLP +  +SD+W+ GV LY L     PF+
Sbjct: 188 ----LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 240

Query: 248 KTGEN------AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           +   N       +    ++ P     S   + LI   L V P +R    ++L+
Sbjct: 241 EDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILK 293

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 125/297 (42%), Gaps = 66/297 (22%)

Query: 14  LLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEV 73
           L  VG++  +I+K +  G F +VY A   P         V LK     DK   N +R   
Sbjct: 31  LSEVGNY--KILKQIGEGSFGKVYLASHKPT-----HRKVVLK---TSDKSDPNLVR--- 77

Query: 74  DAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENE 133
              ++  +      YI      ++  +   +V++ +EYC    L + +   + +R+  +E
Sbjct: 78  ---EVFYHRQFDFPYI---TKLYEVIVTETKVWMALEYCPGRELYEHL--LMLHRIPLDE 129

Query: 134 ILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFG------------SV 181
              + +Q+   V   H+L    +HRD+K+EN+LL   G+ KL DFG            ++
Sbjct: 130 CAKLFAQIVSAVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETI 187

Query: 182 CGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLG--KGLPINEKSDIWALGVFLYKL 239
           CG                      T  Y +PE+I      G  I    DIW+LGV LY +
Sbjct: 188 CG----------------------TTVYMAPELIQRQAYDGFKI----DIWSLGVILYTM 221

Query: 240 CYYTTPFEKTGENAI-LHASFQFPNFPH--YSDRMKSLIRITLNVQPSQRPNIYQLL 293
              T PF++  E          FPNF     S   K LI+  L   PS+RP + Q+L
Sbjct: 222 INGTMPFDEDDETKTKWKIVNDFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 88/198 (44%), Gaps = 28/198 (14%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           ++++MEYC  G   D +     N L E ++  I+ QV+ G+  +H  +   +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPIN 224
           +LL   G  KL DFG V G IR       F           T  + +PE++        N
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTFKRDTFV---------GTPYWMAPEVVCCEVD-GYN 195

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPH---------YSDRMKSLI 275
           EK+DIW+LG+  Y+L     P  K     ++       N P          +S+  K  +
Sbjct: 196 EKADIWSLGITTYELLKGLPPLSKYDPMKVM------TNLPKRKPPKLQGPFSEAAKEFV 249

Query: 276 RITLNVQPSQRPNIYQLL 293
              L   P+ RP+ Y LL
Sbjct: 250 AGCLVKTPADRPSAYDLL 267

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 87/183 (47%), Gaps = 20/183 (10%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +   L+  + E E   I  QV  G+  +H  +  ++HRDIK ENV++ S+G  K
Sbjct: 1069 GSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVK 1126

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWALG 233
            L DFGS   +   P           D+   T   Y +PE++    G P   K  DIWA+G
Sbjct: 1127 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---GEPYEGKPQDIWAVG 1172

Query: 234  VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
            + LY + +   PF    E  I+  + +F      S+   +LI+  LN    +RP I  + 
Sbjct: 1173 ILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDIY 1230

Query: 294  EEV 296
            ++V
Sbjct: 1231 DDV 1233

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 82/341 (24%), Positives = 144/341 (42%), Gaps = 72/341 (21%)

Query: 13  TLLSVGSHQARIIKYLTSGGFAQVY--------TAEISPIDPFINSSIVCLKRVIVP--D 62
           + LS+   +  I K L    F+ +Y        TA  +P      +++  LKR+  P  +
Sbjct: 24  SYLSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTP-----RTNLYALKRIRCPFGN 78

Query: 63  KPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMN 122
             S++    EVD  K  ++  +++  +DS  A+     GS  V++L+ Y   G L D  +
Sbjct: 79  IESISGAMKEVDNYKRFQS-PYIIHLVDSQVAQ--QRDGSKTVYILLPYFPLGSLQDSTS 135

Query: 123 TRLQNR--LHENEILDIMSQVSQGVAAMHA------------------------------ 150
             L N   + E E + I+  +++G+  +H                               
Sbjct: 136 RNLLNGTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLE 195

Query: 151 ---LQPPLL------------HRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFT 195
              L+  +L            HRDIK  N+L +S G   + + GS            + T
Sbjct: 196 DTPLELDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLT 255

Query: 196 YVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEK----TGE 251
            +Q  +  + T  Y +PE++++     ++ K DIW+LG   Y + +  +PFE+    +G 
Sbjct: 256 ELQAWVSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGA 315

Query: 252 N---AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNI 289
           +   AI   +F FP+   YS+ +  LI   L V P+ RP+I
Sbjct: 316 SLKYAIGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 88/191 (46%), Gaps = 22/191 (11%)

Query: 106  FLLMEYCDRGGLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
            ++ +E     G ID  +   L+  + E E   I  Q+  G+  +H     ++HRDIK EN
Sbjct: 877  YIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVHRDIKDEN 934

Query: 165  VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMI--NLGKGLP 222
            V++ S G  KL DFGS        T P E  +V        T  Y +PE++  N  KG P
Sbjct: 935  VIVDSNGFVKLIDFGSAA---YTKTGPFE-VFVG-------TIDYAAPEILGGNPYKGKP 983

Query: 223  INEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQ 282
                 DIWALGV LY L Y   PF    E  IL    +F    + +     LIR  L   
Sbjct: 984  ----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIRWILTKS 1037

Query: 283  PSQRPNIYQLL 293
             + RP+I +++
Sbjct: 1038 VNDRPSIDEIV 1048

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 119/257 (46%), Gaps = 51/257 (19%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLL ++ +V+S  D    + D N+     +L++EY ++G L + +  R    
Sbjct: 74  IEREIVIMKLL-SHPNVLSLYD--VWETDNNL-----YLILEYAEKGELFNLLVDR--GP 123

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L E E +    Q+   ++  HAL   ++HRD+K EN+LL +  + K+ DFG         
Sbjct: 124 LPEREAIKCFKQIIIAISYCHALG--IVHRDLKPENLLLDNSYNIKIADFGMAA------ 175

Query: 189 TNPQEFTYVQHDI-MKNTTA---QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYT 243
                   +Q D  M  T+     Y +PE+++   GLP     SD+W+ GV L+ L    
Sbjct: 176 --------LQTDAGMLETSCGSPHYAAPEIVS---GLPYEGFASDVWSCGVILFALLTGR 224

Query: 244 TPFEKTGENA------ILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNI-------- 289
            PF++   N       +    F+ PN    S   + LIR  L V P+QR  I        
Sbjct: 225 LPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPL 284

Query: 290 ---YQLLEEVSKIQNVP 303
              YQ +++   I+++P
Sbjct: 285 LKKYQTIKDSKSIKDLP 301

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 134/290 (46%), Gaps = 29/290 (10%)

Query: 11  PGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLR 70
           P +L+       R  ++L  GGFA+ +  +      F   ++    ++ +  + +   L 
Sbjct: 131 PPSLIKTRGRDYRRGQFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLL 187

Query: 71  AEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLH 130
           +E+   K +++  ++V ++D     F+ +I    V++L+  C  G L++ +  R    L 
Sbjct: 188 SEIQIHKSMKHQ-NIVQFVDC----FEDHIN---VYILLGMCPNGSLMELLKKR--KILT 237

Query: 131 ENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTN 190
           E E+     Q+   +  MH+ +  ++HRD+K+ N+      + K+ DFG    +     N
Sbjct: 238 EPEVRFFTVQICGAIKYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLAAVL----AN 291

Query: 191 PQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTG 250
            +E  Y         T  Y +PE++ LGK    + + DIW++GV ++ L     PF+   
Sbjct: 292 DRERKYTVCG-----TPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKD 345

Query: 251 ENAIL----HASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
            N I     ++ + FP     S   K+LI+  L   P  RP+I +++E V
Sbjct: 346 VNTIYSRIKNSEYTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 105/224 (46%), Gaps = 35/224 (15%)

Query: 31   GGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPS--------LNTLRAEVDAMKLLRNN 82
            G F  VY A            ++ +K+V VP+  S        +  L++EV  +K L N+
Sbjct: 1047 GSFGAVYLALN-----VTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NH 1100

Query: 83   THVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVS 142
             ++V Y+      F+   G Y +FL  EY   G +   +  R+  R  +  I  +  QV 
Sbjct: 1101 VNIVQYLG-----FEEKNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVL 1151

Query: 143  QGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL + G  K+ DF    GI R   N     Y   D+ 
Sbjct: 1152 EGLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNN----IYSNSDMT 1201

Query: 203  KNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF 246
               T  + +PEM++   G   + K DIW+LG  + ++     P+
Sbjct: 1202 MRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPW 1243

>NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {ON}
           Anc_6.262 YPL236C
          Length = 367

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 80/348 (22%), Positives = 144/348 (41%), Gaps = 64/348 (18%)

Query: 13  TLLSVGSHQARIIKYLTSGGFAQVY---TAEISPIDPFINSSIVCLKRVIVP--DKPSLN 67
           +++S+ +   +I K L     +  Y   T +  P  PF N  +  LKR+  P  D  S++
Sbjct: 21  SIISINARDYKIEKLLQDENLSYSYLVRTLDSEP--PFENGPLFVLKRIYCPFGDIESVS 78

Query: 68  TLRAEVDAMKLLRNNTHVVSYIDSHA-AKFDTNIGSYEVFLLMEYCDRGGLIDFMN---- 122
               E+   K    N+H++S +D     K+D   GS ++ +L  +   G + D +N    
Sbjct: 79  AAMNEISYYKKFAGNSHIISCLDYQLHQKYD---GSKQIDVLFPFYHYGSVQDDINRHLL 135

Query: 123 ---TRLQNRLHENEILDIMSQVSQGVAAMH------------------ALQPPLLHRDIK 161
              T L   + E + + IM  + +G+  +H                  +   PLL  D+ 
Sbjct: 136 SSSTALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPDDMAIMSYSENAPLLLNDLP 195

Query: 162 IEN--------------------VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDI 201
           +E                     +LL+ +G+  + D  S        +   +    Q  I
Sbjct: 196 MELSKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQSCFRTNITISTEIQLNRFQQWI 255

Query: 202 MKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGE-------NAI 254
            ++ T Q+ +PE++ L  G  I  K DIW+LG  LY + +  +PFE+  +         I
Sbjct: 256 EEHCTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFEREEQLNGGVVKYCI 315

Query: 255 LHASFQFPNFPH-YSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQN 301
               +  P+    YS  +  ++   L V PS+RP++  +L  + +IQ 
Sbjct: 316 KMGKYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGILNNLQEIQG 363

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 86/179 (48%), Gaps = 20/179 (11%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G +D  +   L+  + E+E   I  Q+  G+  +H     ++HRDIK ENV++ S G  K
Sbjct: 1055 GSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHLH--DNGIVHRDIKDENVIVDSNGFVK 1112

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWALG 233
            + DFGS   +   P           D+   T   Y +PE++    G P   K  DIWA+G
Sbjct: 1113 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---GEPYEGKPQDIWAIG 1158

Query: 234  VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQL 292
            V LY + +   PF    E  IL A  +  +    SD   +LIR  LN   S+RP+I ++
Sbjct: 1159 VLLYTIIFKENPFYNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKI 1215

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 132/270 (48%), Gaps = 35/270 (12%)

Query: 31  GGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYID 90
           G    VYTA     +   N+S V +K++ +  +P    +  E+  MK  ++  ++V++ID
Sbjct: 676 GASGGVYTA----YEVGTNAS-VAIKQMNLEKQPKKELIINEILVMKASKH-ANIVNFID 729

Query: 91  SHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHA 150
           S+  + D       ++++MEY + G L D +   +   L E +I  +  +  +G+  +H+
Sbjct: 730 SYLLRGD-------LWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLHS 779

Query: 151 LQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYR 210
               ++HRDIK +NVLL+  G  KL DFG  C  I    N +  T V        T  + 
Sbjct: 780 --KGVIHRDIKSDNVLLSMSGEIKLTDFG-FCAQIN-EINLKRTTMV-------GTPYWM 828

Query: 211 SPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF-EKTGENAIL----HASFQFPNFP 265
           +PE+++  +  P   K DIW+LG+ + ++     P+  +T   A+     + + +  +  
Sbjct: 829 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDAD 885

Query: 266 HYSDRMKSLIRITLNVQPSQRPNIYQLLEE 295
             SD +KS +   L+V P +R    QLL +
Sbjct: 886 SLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 118/255 (46%), Gaps = 47/255 (18%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLL ++ +V+S  D     ++TN     ++L++EY ++G L + +       
Sbjct: 74  IEREIVIMKLL-SHPNVLSLYDV----WETN---NNLYLILEYAEKGELFNLLVD--HGP 123

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L E E ++   Q+  G++  HAL   ++HRD+K EN+LL S  + K+ DFG         
Sbjct: 124 LPEREAINCFRQIIIGISYCHALG--IVHRDLKPENLLLDSFYNIKIADFGMAA------ 175

Query: 189 TNPQEFTYVQHDIMKNTTA--QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTTP 245
                      D+++ +     Y +PE+++   GLP     SD+W+ GV L+ L     P
Sbjct: 176 ------LQTDADLLETSCGSPHYAAPEIVS---GLPYEGFASDVWSCGVILFALLTGRLP 226

Query: 246 FEKTGENA------ILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNI---------- 289
           F++   N       +    F+ PN    S   + LI   L V P QR  I          
Sbjct: 227 FDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLK 286

Query: 290 -YQLLEEVSKIQNVP 303
            YQ +++   I+++P
Sbjct: 287 KYQTIKDSKSIKDLP 301

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 83/295 (28%), Positives = 130/295 (44%), Gaps = 62/295 (21%)

Query: 14  LLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEV 73
           L  VG++  +I+K +  G F +VY A   P         VCLK     DK   N +R   
Sbjct: 35  LTEVGNY--KILKQVGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNIVR--- 81

Query: 74  DAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENE 133
              ++  +      YI      ++  +   +V++ +EYC    L D + +   +R+   E
Sbjct: 82  ---EVFYHRQFDFPYI---TKLYEVIVTETKVWMALEYCPGKELYDHLLS--LHRISLLE 133

Query: 134 ILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQE 193
             ++ +Q+S  V   H++    +HRD+K+EN+LL   G+ KL DFG              
Sbjct: 134 CAELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG-------------- 177

Query: 194 FTYVQHDIMKNTTAQ-------YRSPEMINLG--KGLPINEKSDIWALGVFLYKLCYYTT 244
           FT    + M  TT +       Y +PE+I      G  I    DIW+LGV LY L   + 
Sbjct: 178 FT---RECMTKTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGSL 230

Query: 245 PFEKTGENAILHASFQFPN-FPHYS-----DRMKSLIRITLNVQPSQRPNIYQLL 293
           PF+   E   +   ++  N  P+Y      D  K LI   L   P +RP++ Q+L
Sbjct: 231 PFDDDDE---VKTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} similar
           to uniprot|P06784 Saccharomyces cerevisiae YDL159W STE7
           Signal transducing MAP kinase kinase involved in
           pheromone response where it phosphorylates Fus3p and in
           the pseudohyphal/invasive growth pathway through
           phosphorylation of Kss1p phosphorylated by Ste11p
           degraded by ubiquitin pathway
          Length = 461

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 123/270 (45%), Gaps = 44/270 (16%)

Query: 49  NSSIVCLKRVIVPDKPSL-NTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFL 107
           +S I+  K + V +KP + N L  E+  MK ++ + ++V +   + A ++T   + E+ +
Sbjct: 149 DSRIIAKKTIPVDNKPMVKNQLVRELTIMKNVKTHANIVGF---YGAFYNTQTNN-EIVI 204

Query: 108 LMEYCDRGGLIDFMNT--RLQNRLHEN------------EILDIMSQVSQGVAAMHALQP 153
           LMEY D G L   + T  R  +R HE              I  I   V  G+  ++    
Sbjct: 205 LMEYMDCGSLDKILVTYKRWCSRQHEEGFDPRTLWFTELSISKISHAVLNGLTYLYN-NY 263

Query: 154 PLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPE 213
            ++HRDIK  NVL+ S+G  K+CDF    G+ +   N    T+V        T+ Y SPE
Sbjct: 264 KIIHRDIKPSNVLINSKGFVKICDF----GVSKKLINSMADTFV-------GTSTYMSPE 312

Query: 214 MINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGE--NAIL--------HASFQFPN 263
            I   +G   + K D+W+LG+ + +L     P     +    IL         A  + P+
Sbjct: 313 RI---QGSVYSTKGDVWSLGLMIIELVTGQFPLGGHSDTPEGILDLLQRIVNEAPPKLPS 369

Query: 264 FPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
           + HYS  M   +      +  +R ++ +LL
Sbjct: 370 YAHYSREMVDFVNRCCVKEERERSSLQELL 399

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 94/207 (45%), Gaps = 28/207 (13%)

Query: 96  FDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPL 155
           F T +    ++++ME+C  G   D +    ++RL EN++  I+ +V  G+  +H+ +   
Sbjct: 101 FKTFVEDVSMWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK-- 158

Query: 156 LHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMI 215
           +HRDIK  N+LLT  G  KL DFG V G I        F           T  + +PE+I
Sbjct: 159 IHRDIKAANILLTDDGEVKLGDFG-VSGQIMATLKRTTFV---------GTPYWMAPEII 208

Query: 216 NLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFP---------H 266
              K    NEK+DIW+LG+   +L     P+ K     +L       N P          
Sbjct: 209 A-KKDNGYNEKADIWSLGITAIELLTGQPPYAKHDPMKVL------VNIPLRKPPKLQGR 261

Query: 267 YSDRMKSLIRITLNVQPSQRPNIYQLL 293
           ++   +  I + L   P  RP+  +LL
Sbjct: 262 FTGSARDFIALCLIKDPDLRPSAAELL 288

>NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335
          Length = 638

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 101/194 (52%), Gaps = 32/194 (16%)

Query: 66  LNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGL-------- 117
           LN L  E+  MK ++++ +++S+   + A +D N+ + E+ +LMEY D G L        
Sbjct: 308 LNQLIRELTIMKSVKSHKNIISF---YGAYYD-NVKNNEIIILMEYMDCGSLDKILLTYK 363

Query: 118 ----IDFMNTRLQNRLHENEILDIMS-QVSQGVAAMHALQPPLLHRDIKIENVLLTSRGH 172
                 F++++L+N  +++ IL  +S  V  G+  ++     ++HRDIK  N+L+ S+G 
Sbjct: 364 RLVNRGFIDSKLKNWFNDSLILSKLSYAVLNGLDYLYT-NYKIIHRDIKPSNILVNSKGQ 422

Query: 173 YKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWAL 232
            K+CDFG    +I    N    T+V        T+ Y SPE I   +G   + K D+W+L
Sbjct: 423 VKICDFGVSKKLI----NSIADTFV-------GTSTYMSPERI---QGNVYSTKGDVWSL 468

Query: 233 GVFLYKLCYYTTPF 246
           G+ + +L     P 
Sbjct: 469 GLVIIELVTGKFPL 482

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 112/235 (47%), Gaps = 36/235 (15%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLL N+ +V+   D     ++TN    +++L++EY ++G L + +  R    
Sbjct: 78  IEREIIIMKLL-NHPNVLRLYDV----WETNT---DLYLVLEYAEKGELFNLLVER--GP 127

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L E+E +    Q+  GV+  HAL   ++HRD+K EN+LL  + + K+ DFG         
Sbjct: 128 LPEHEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA------ 179

Query: 189 TNPQEFTYVQHDIMKNTTA--QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTTP 245
                    +  +++ +     Y +PE+++   G+P     SD+W+ GV L+ L     P
Sbjct: 180 ------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLP 230

Query: 246 FEKTGEN------AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           F++   N       +    F+ P+    S   + LIR  L V P +R     +L+
Sbjct: 231 FDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILK 285

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 138/289 (47%), Gaps = 38/289 (13%)

Query: 13  TLLSVGS---HQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTL 69
           T++S G    H   ++K +  G    V+TA     D    + +V +K++ +  +P    +
Sbjct: 666 TIVSEGDPSKHYKDLVK-IGQGASGGVFTAH----DSRDENRLVAIKQMNLQKQPKKELI 720

Query: 70  RAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRL 129
             E+  MK  R+  ++V++IDS+  K D       ++++MEY + G L D +   +   L
Sbjct: 721 INEIIVMKGSRHE-NIVNFIDSYLMKGD-------LWVVMEYMEGGSLTDVVTHCI---L 769

Query: 130 HENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPT 189
            E +I  +  +   G+A +H+    ++HRDIK +N+LL+  G  KL DFG  C  I    
Sbjct: 770 TEGQIGTVCKETLGGLAFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQINE-- 824

Query: 190 NPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF-EK 248
                 +++   M   T  + +PE+++  +  P   K DIW+LG+ + ++     P+  +
Sbjct: 825 -----VHLKRTTMVG-TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNE 875

Query: 249 TGENAIL----HASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
           T   A+     + + Q  +  +  + +K  +   L V P +R    +LL
Sbjct: 876 TPLRALYLIATNGTPQLKDPENLGEILKKFLDWCLTVNPEERATALELL 924

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 99/201 (49%), Gaps = 35/201 (17%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           V++ +EYC    L +++  +    L E    ++ SQ+   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEE--CSELFSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 165 VLLTSRGHYKLCDFG-----SVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLG- 218
           +LL  +GH KL DFG     +  GI+              + +  TT  Y +PE+I    
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGIL--------------ETICGTTV-YMAPELIERKP 203

Query: 219 -KGLPINEKSDIWALGVFLYKLCYYTTPFEKTGE----NAILHASFQFPNFPHYSDRMKS 273
            +G  I    D W+LG+ LY + + T PF++  E      I+H +  + N  +     K 
Sbjct: 204 YEGYKI----DTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYDN-DYIDSNGKE 258

Query: 274 LIRITLNVQPSQRPNIYQLLE 294
           LI   L   P+QRP++ Q+L+
Sbjct: 259 LISQLLEKDPNQRPSLTQVLQ 279

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 101/213 (47%), Gaps = 31/213 (14%)

Query: 104 EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
           E++L++EY D G L D++ ++   +L E E +   +Q+ QGV+  H+    + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPE 255

Query: 164 NVLLTSRGHY-KLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGK--- 219
           N+LL  +    K+ DFG     +  P    E +          +  Y SPE++ +GK   
Sbjct: 256 NLLLDKKNKVIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIV-MGKPYH 304

Query: 220 GLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HASFQFPNFPHYSDRMKSLI 275
           G P    SD+W+ G+ L+ L     PF       +L       FQ P  P+ ++  K LI
Sbjct: 305 GGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLP--PYLTNDAKDLI 358

Query: 276 RITLNVQPSQRPNIYQLLEE--VSKIQNVPCPI 306
              L   P +R  I ++L    + K +N P  I
Sbjct: 359 TRILVTNPEKRLTINEILNHPLIKKYRNPPAHI 391

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 110/227 (48%), Gaps = 36/227 (15%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLL N+ +V+   D     ++TN    +++L++EY ++G L + +  R    
Sbjct: 78  IEREIIIMKLL-NHPNVLRLYDV----WETNT---DLYLVLEYAEKGELFNLLVER--GP 127

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L ENE +    Q+  GV+  HAL   ++HRD+K EN+LL  + + K+ DFG         
Sbjct: 128 LPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA------ 179

Query: 189 TNPQEFTYVQHDIMKNTTA--QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTTP 245
                    +  +++ +     Y +PE+++   G+P     SD+W+ GV L+ L     P
Sbjct: 180 ------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLP 230

Query: 246 FEKTGEN--AIL----HASFQFPNFPHYSDRMKSLIRITLNVQPSQR 286
           F++   N  A+L       F+ P+    S   + LI   L V P +R
Sbjct: 231 FDEEDGNIRALLLKVQKGEFELPSDDEISREAQDLISKILTVDPERR 277

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 89/196 (45%), Gaps = 20/196 (10%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           ++L MEYC  G     + TR   R+ E +     S+V   +  +H L    ++RD+K EN
Sbjct: 393 LYLCMEYCMGGEFFRALQTRKSKRITEEDAKFYASEVVAALEYLHLLG--FIYRDLKPEN 450

Query: 165 VLLTSRGHYKLCDFGSVCGII--RPPTNPQEFTYVQHDIMKN--------TTAQYRSPEM 214
           +LL   GH  L DF         R PT  ++ TY+   +  +         T +Y +PE+
Sbjct: 451 ILLHQSGHVMLSDFDLSIQATGSRDPTM-KDSTYLDTKVCSDGFRTNSFVGTEEYLAPEV 509

Query: 215 INLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENA----ILHASFQFPNFPHYSDR 270
           I   +G       D W LG+ +Y++ +  TPF+    N     IL    +FP+    S  
Sbjct: 510 I---RGNGHTAAVDWWTLGILVYEMLFGCTPFKGDNSNETFSKILTEDVKFPHDKEISKH 566

Query: 271 MKSLIRITLNVQPSQR 286
            K LI+  LN   S+R
Sbjct: 567 CKDLIKRLLNKNESKR 582

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 111/235 (47%), Gaps = 36/235 (15%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLL N+ +V+   D     ++TN    +++L++EY ++G L + +  R    
Sbjct: 78  IEREIIIMKLL-NHPNVLRLYDV----WETNA---DLYLVLEYAEKGELFNLLVER--GP 127

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L ENE +    Q+  GV+  HAL   ++HRD+K EN+LL  + + K+ DFG         
Sbjct: 128 LPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA------ 179

Query: 189 TNPQEFTYVQHDIMKNTTA--QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTTP 245
                    +  +++ +     Y +PE+++   G+P     SD+W+ GV L+ L     P
Sbjct: 180 ------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLP 230

Query: 246 FEKTGEN------AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           F++   N       +    F+ P+    S   + LI   L V P +R     +L+
Sbjct: 231 FDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDILK 285

>KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} similar
           to uniprot|P48562 Saccharomyces cerevisiae YNL298W CLA4
           Involved in localizing cell growth with respect to the
           septin ring protein kinase homologous to Ste20p
           interacts with CDC42
          Length = 879

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 135/290 (46%), Gaps = 40/290 (13%)

Query: 23  RIIKYLTSGGFAQVYTAEISPIDPFIN---------SSIVCLKRVIVPDKPSLNTLRAEV 73
           R+++    G    VY AE   + P+ +          + V +K++I+  +P    +  E+
Sbjct: 589 RMVEKAGQGASGSVYLAERLQLPPYKDELEAEKNQLGNKVAIKQMILSKQPRKELIVNEI 648

Query: 74  DAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFM-----NTRLQNR 128
             MK  ++N ++V++++++    D      +++++MEY + G L D +      +  Q+ 
Sbjct: 649 LVMKDSKHN-NIVNFLEAYLKTED------DLWVVMEYMEGGSLTDIIENSPTGSSGQSP 701

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L E +I  I+ +  QG+  +H     ++HRDIK +NVLL +RG  K+ DFG    +    
Sbjct: 702 LTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTRGRVKITDFGFCAKLTD-- 757

Query: 189 TNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF-- 246
              +  T V        T  + +PE++   K    +EK D+W+LG+   ++     P+  
Sbjct: 758 KRSKRATMV-------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLESEPPYLN 807

Query: 247 EKTGENAILHASFQFPNFPH---YSDRMKSLIRITLNVQPSQRPNIYQLL 293
           E+  +   L A+   P   H    S  +K  + + L V    R +  +LL
Sbjct: 808 EEPLKALYLIATNGTPKLKHPEYLSLEIKRFLSVCLCVDVKYRASTEELL 857

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 128/271 (47%), Gaps = 35/271 (12%)

Query: 31  GGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYID 90
           G    VY A     D   N SI  +K++ +  +P    +  E+  MK  ++  ++V++ID
Sbjct: 636 GASGGVYIAN----DVSTNESI-AIKQMNLEKQPKKELIINEILVMKGSKH-PNIVNFID 689

Query: 91  SHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHA 150
           S+    D       ++++MEY + G L D +   +   L E +I  +  +   G+  +H+
Sbjct: 690 SYLLDGD-------LWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLQFLHS 739

Query: 151 LQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYR 210
               +LHRDIK +N+LL+  G+ KL DFG  C  +         T ++   M   T  + 
Sbjct: 740 KG--VLHRDIKSDNILLSINGNIKLTDFG-FCAQVNE-------TTLKRTTMVG-TPYWM 788

Query: 211 SPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF--EKTGENAILHASFQFPNFPH-- 266
           +PE+++  +  P   K DIW+LG+ + ++     P+  E       L A+   P      
Sbjct: 789 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKERE 845

Query: 267 -YSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
             SD +K  +   L+V P QR +  +LLE+V
Sbjct: 846 KLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 120/258 (46%), Gaps = 38/258 (14%)

Query: 52   IVCLKRVIVPDKPS--------LNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSY 103
            ++ +K+V VP   S        L  LR+EV  +K L ++T++V Y+      F+     Y
Sbjct: 1171 MIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDL-DHTNIVQYLG-----FENKNYVY 1224

Query: 104  EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
             +FL  EY   G +   +  RL  +  EN I  +  QV +G++ +H+ +  +LHRD+K +
Sbjct: 1225 SLFL--EYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLHSKK--ILHRDMKAD 1278

Query: 164  NVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPI 223
            N+LL   G  K+ DF    GI +   N     Y   D+    T  + +PEM++  +G   
Sbjct: 1279 NLLLDVDGICKISDF----GISKKSNN----IYSNSDMTMRGTVFWMAPEMVDTKQGY-- 1328

Query: 224  NEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQF---PNFPHYSDRM-----KSLI 275
            + K DIW+LG  + ++     P+      A +    +F   P  P  + ++     K  +
Sbjct: 1329 SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKEFL 1388

Query: 276  RITLNVQPSQRPNIYQLL 293
                 + P +RP   +LL
Sbjct: 1389 DACFEINPEKRPTADELL 1406

>Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {ON}
           complement(67104..68684) [1581 nt, 527 aa]
          Length = 526

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 114/253 (45%), Gaps = 42/253 (16%)

Query: 65  SLNTLRAEVDAMK-----LLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGL-- 117
           ++NTL  + +  K     L  N +    YI  +   F T+  +  +F+ MEY     L  
Sbjct: 266 TINTLNTDPEYQKQIFRELQFNKSFKSDYIVRYYGMF-TDESNSSIFIAMEYMGGRSLDA 324

Query: 118 --IDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKL 175
             ++ +N  L  R+ E  +  I   V +G++ +H  +  ++HRDIK +N+LL  +G  KL
Sbjct: 325 IYLNLLN--LGGRIGEKVLGKIAESVLRGLSYLHERK--VIHRDIKPQNILLNEKGQVKL 380

Query: 176 CDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVF 235
           CDFG V G      N    T+         T+ Y +PE I   +G P +   D+W+LG+ 
Sbjct: 381 CDFG-VSG---EAVNSLATTFT-------GTSFYMAPERI---QGQPYSVTCDVWSLGLT 426

Query: 236 LYKLCYYTTPFEKTGENA----------ILHASFQFPNFPH----YSDRMKSLIRITLNV 281
           L ++     PF      A          IL  S Q  + P     +S   KS I   L  
Sbjct: 427 LLEVAQAKFPFGSDKMTATIAPIELLMLILTFSPQLKDEPELNIVWSKSFKSFIEYCLKK 486

Query: 282 QPSQRPNIYQLLE 294
            PS+RP+  Q+++
Sbjct: 487 DPSERPSPRQMIQ 499

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 95/209 (45%), Gaps = 51/209 (24%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           V++ +EYC    L +++   ++ R+  +E   + SQ+   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 VLLTSRGHYKLCDFG------------SVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSP 212
           +LL  +G  KL DFG            +VCG                      T  Y +P
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGILETVCG----------------------TTVYMAP 196

Query: 213 EMINLG--KGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDR 270
           E+I     +G  I    D W+LG+ LY + +   PF++  E+ I        N P Y D 
Sbjct: 197 ELIERKPYEGYKI----DTWSLGIILYTMIHGAMPFDE--EDDIKTKYRIVNNEPFYDDN 250

Query: 271 M-----KSLIRITLNVQPSQRPNIYQLLE 294
                 K LI   L   PSQRP++ Q+L+
Sbjct: 251 FIDANGKDLIMQLLQKDPSQRPSLTQVLQ 279

>Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL045W
            (REAL)
          Length = 1106

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 83/180 (46%), Gaps = 21/180 (11%)

Query: 116  GLIDFMNT-RLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +    +  + E+E   +  QV   +  +H     ++HRDIK EN+++ S G  K
Sbjct: 938  GSIDLFDVIEFKKDMVEHEAKLVFKQVVSSIKHLH--DQGIVHRDIKDENIIVDSHGFVK 995

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGV 234
            L DFGS       P +     +V        T  Y +PE+  LG      +  DIWALGV
Sbjct: 996  LIDFGSAAYTKSGPFD----VFV-------GTMDYAAPEV--LGGSSYKGKPQDIWALGV 1042

Query: 235  FLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRP---NIYQ 291
             LY + Y   P+    E  IL    +F N  + SD   SLI+  L  +  +RP   +IYQ
Sbjct: 1043 LLYTIIYKENPYYNIDE--ILEGELRFDNAENVSDECISLIKGILTREVDKRPTIDDIYQ 1100

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 112/235 (47%), Gaps = 36/235 (15%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLL N+ +V+   D    + D+N+     ++++EY ++G L + +  R    
Sbjct: 78  IEREIIIMKLL-NHPNVLRLYD--VWETDSNL-----YMVLEYAEKGELFNLLVER--GP 127

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L ENE +    Q+  G++  HAL   ++HRD+K EN+LL  + + K+ DFG         
Sbjct: 128 LPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA------ 179

Query: 189 TNPQEFTYVQHDIMKNTTA--QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTTP 245
                    +  +++ +     Y +PE+I+   GLP +  ++D+W+ G+ L+ L     P
Sbjct: 180 ------LETEDKLLETSCGSPHYAAPEIIS---GLPYHGLETDVWSCGIILFALLTGRLP 230

Query: 246 FEKTGEN------AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           F++   N       +    F+ P     S   + LI   L V P +R    ++L+
Sbjct: 231 FDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 94/200 (47%), Gaps = 33/200 (16%)

Query: 104 EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
           E++L++EY D G L D++ +R   RL E E +    Q+ QGV+  HA    + HRD+K E
Sbjct: 190 ELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--ICHRDLKPE 245

Query: 164 NVLLTSRGH-YKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTA--QYRSPEMINLGK- 219
           N+LL  +    K+ DFG                 V + +++ +     Y SPE++ +GK 
Sbjct: 246 NLLLDKKNSTIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPEIV-MGKQ 292

Query: 220 --GLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HASFQFPNFPHYSDRMKS 273
             G P    SD+W+ G+ L+ L     PF       +L       +Q P   + S   + 
Sbjct: 293 YHGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQ--NLSKEAQD 346

Query: 274 LIRITLNVQPSQRPNIYQLL 293
           LI   L V P++R    ++L
Sbjct: 347 LIAKILTVNPAKRLTTEEIL 366

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 118/261 (45%), Gaps = 44/261 (16%)

Query: 52   IVCLKRVIVPDKPSLN--------TLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSY 103
            ++ +K+V VP   S N         LR+EV  +K L ++ ++V Y+      F+     Y
Sbjct: 1203 MMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDL-DHLNIVQYLG-----FENKNNIY 1256

Query: 104  EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
             +FL  EY   G +   +  R+  R  E+ I  + +QV +G+A +H+    +LHRD+K +
Sbjct: 1257 SLFL--EYVAGGSVGSLI--RMYGRFDESLIRHLTTQVLKGLAYLHSKG--ILHRDMKAD 1310

Query: 164  NVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPI 223
            N+LL   G  K+ DF    GI R   +     Y   D+    T  + +PEM++  +G   
Sbjct: 1311 NLLLDQDGICKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY-- 1360

Query: 224  NEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQF-----------PNFPHYSDRMK 272
            + K DIW+LG  + ++     P+       ++ A F+               P  S   +
Sbjct: 1361 SAKVDIWSLGCIVLEMFAGKRPWSNL---EVVAAMFKIGKSKSAPPIPEDTLPLISQVGR 1417

Query: 273  SLIRITLNVQPSQRPNIYQLL 293
            S +     + P +RP   +LL
Sbjct: 1418 SFLDACFEINPEERPTATELL 1438

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/340 (21%), Positives = 145/340 (42%), Gaps = 68/340 (20%)

Query: 25  IKYLTSGGF-------AQVYTAEISPIDPFINSSIVCLKRVIVP--DKPSLNTLRAEVDA 75
           +K LTSG         + + T+ ++ ID +   + + +++++ P  D  S++    E+D 
Sbjct: 51  VKSLTSGSIFGGMRRQSSMSTSNLNDIDGYDEPTDMVVRQIMCPFGDIESVSNALKEIDN 110

Query: 76  MKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQN--RLHENE 133
            +  ++  +++  +DS   +     GS  V +L+ Y   G L D ++  L +  R+ E+E
Sbjct: 111 YRYFKS-PYIMQCLDSQVIQ--RRDGSKTVLILLPYLPLGSLRDAIDRNLLDGIRMSESE 167

Query: 134 ILDIMSQVSQGVAAMH----------ALQP------------------------------ 153
           ++ +M    +G+  +H          ++ P                              
Sbjct: 168 VIRVMIGTCRGLLYLHDPTSRGNLGSSMGPQNGMDAVSMTLSDDAAMLLDGTPFEMDMLS 227

Query: 154 -------PLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
                     H +IK  N+L +S G   + + GS+  +     N +    ++    ++ T
Sbjct: 228 SHSMKMDSYAHMNIKPSNILFSSDGLPVITELGSLQKLDLKIENVKMLKSIKEWTEEHCT 287

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGE-------NAILHASF 259
             Y  PE++NL  G  ++   DIW+LG  LY L +  +PF++  +         I  A +
Sbjct: 288 VYYMPPELLNLKVGTVLDCSVDIWSLGCTLYTLLFGISPFKREEQVNEVPLKYGISKARY 347

Query: 260 QFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKI 299
            FP    YS ++ S+I   L V P+ RP + +LL ++  I
Sbjct: 348 SFPEGHVYSKKLVSVIETCLQVNPTMRPTVNELLGQLQDI 387

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 125/268 (46%), Gaps = 35/268 (13%)

Query: 31  GGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYID 90
           G    VYTA     DP      V +K++ +  +P    +  E+  MK  ++  ++V++ID
Sbjct: 659 GASGGVYTAH----DP-TREGYVAIKQMNLEKQPKKELIINEIIVMKESKHE-NIVNFID 712

Query: 91  SHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHA 150
           S+  K D       ++++MEY + G L D +   L   L E ++  +  +   G+  +H+
Sbjct: 713 SYLLKGD-------LWVIMEYMEGGSLTDVVTHCL---LTEAQVGAVCRETLSGLQFLHS 762

Query: 151 LQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYR 210
               ++HRDIK +N+LL+ RG  KL DFG  C  I    N +  T V        T  + 
Sbjct: 763 KG--VIHRDIKSDNILLSMRGDIKLTDFG-FCAQIN-ELNLKRTTMV-------GTPYWM 811

Query: 211 SPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF--EKTGENAILHASFQFPNFPH-- 266
           +PE+++  +  P   K DIW+LG+ + ++     P+  E       L A+   P+     
Sbjct: 812 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPSLKEPE 868

Query: 267 -YSDRMKSLIRITLNVQPSQRPNIYQLL 293
             SD + + +   L V P +R +   LL
Sbjct: 869 ALSDALNNFLGWCLKVNPDERASAKDLL 896

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 111/235 (47%), Gaps = 36/235 (15%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLL N+ +V+   D     ++TN    +++L++EY ++G L + +  R    
Sbjct: 78  IEREIIIMKLL-NHPNVLRLYDV----WETNT---DLYLVLEYAEKGELFNLLVER--GP 127

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L ENE +    Q+  GV+  HAL   ++HRD+K EN+LL  + + K+ DFG         
Sbjct: 128 LPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA------ 179

Query: 189 TNPQEFTYVQHDIMKNTTA--QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTTP 245
                    +  +++ +     Y +PE+++   G+P     SD+W+ GV L+ L     P
Sbjct: 180 ------LETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRLP 230

Query: 246 FEKTGEN------AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           F++   N       +    F+ P+    S   + LI   L V P +R     +L+
Sbjct: 231 FDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILK 285

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 114/235 (48%), Gaps = 36/235 (15%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLLR+  +V+S  D     ++TN     +++++EY ++G L + +  +    
Sbjct: 81  IEREIIIMKLLRH-ANVLSLYDV----WETN---SNLYMILEYAEKGELFNLLVEK--GP 130

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L E E +    Q+  G++  HAL   ++HRD+K EN+LL  + + K+ DFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA------ 182

Query: 189 TNPQEFTYVQHDIMKNTTA--QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTTP 245
                    +  +++ +     Y +PE+++   G+P +  +SD+W+ GV L+ L     P
Sbjct: 183 ------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRLP 233

Query: 246 FEKTGEN------AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           F++   N       +    F+ P+    S   + LI   L V P++R    ++L+
Sbjct: 234 FDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 109/228 (47%), Gaps = 38/228 (16%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLLR+  +V+S  D     ++TN    ++++++EY ++G L + +  R    
Sbjct: 77  IEREIIIMKLLRH-PNVLSLYDV----WETN---SKLYMILEYAEKGELFNLLVER--GP 126

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L E E +    Q+  G++  HAL   ++HRD+K EN+LL  + + K+ DFG         
Sbjct: 127 LPEKEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKLNIKIADFGMAA------ 178

Query: 189 TNPQEFTYVQHDIMKNTTA---QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTT 244
                      D M  T+     Y +PE+++   G+P +  +SD+W+ GV L+ L     
Sbjct: 179 -------LETKDKMLETSCGSPHYAAPEIVS---GVPYHGFQSDVWSCGVILFALLTGRL 228

Query: 245 PFEKTGEN------AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQR 286
           PF++   N       +    ++ P+    S   + LI   L V P QR
Sbjct: 229 PFDEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQR 276

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 128/293 (43%), Gaps = 58/293 (19%)

Query: 14  LLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEV 73
           L  VG++  +I+K +  G F +VY A   P         VCLK     DK   N +R   
Sbjct: 35  LTEVGNY--KILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNIVR--- 81

Query: 74  DAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENE 133
              ++  +      YI      ++  +   +V++ +EYC    L D + +   +R+   E
Sbjct: 82  ---EVFYHRQFDFPYI---TKLYEVIVTESKVWMALEYCPGKELYDHLLS--LHRISLLE 133

Query: 134 ILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQE 193
             ++ +Q+S  V   H++    +HRD+K+EN+LL   G+ KL DFG              
Sbjct: 134 CGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG-------------- 177

Query: 194 FTYVQHDIMKNTTAQ-------YRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF 246
           FT    + M  TT +       Y +PE+I  G+      K D W+LGV LY L   + PF
Sbjct: 178 FT---RECMTKTTLETVCGTTVYMAPELI--GRKTYDGFKIDTWSLGVILYTLITGSLPF 232

Query: 247 EKTGENAILHASFQFPN-FPHYS-----DRMKSLIRITLNVQPSQRPNIYQLL 293
           +   E       ++  N  P Y      D  K LI   L   P +RP++ Q+L
Sbjct: 233 DDDDE---AKTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 124/274 (45%), Gaps = 34/274 (12%)

Query: 28  LTSGGFAQVYTAEISPIDPFINSSI-VCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           L  G ++ VY A +   +   N +I VC K+ I+ +K  +  +  E D + +L    H+ 
Sbjct: 16  LGQGSYSTVYRA-VERSNSGRNYAIKVCSKKHIIREK-KVKYVTIEKDLLNMLAKGGHL- 72

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
                    F T      ++ ++EY   G L+  +  RL  RL E+    I +Q+   V 
Sbjct: 73  ----GIVKLFCTFHDIENLYFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQLVDTVD 126

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            MH+    ++HRD+K ENVLL+  G   + DFG+ C         ++F   +       T
Sbjct: 127 YMHS--KGVIHRDLKPENVLLSQEGRVVITDFGAAC-----TAADRKFENTKRTASFVGT 179

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAI--------LHAS 258
           A+Y SPE++   +       SDIWALG  +Y+L     PF   GEN +        L   
Sbjct: 180 AEYVSPELLLHSQ---CGFSSDIWALGCIIYQLNQGKPPFR--GENELQTFEKIVALDYK 234

Query: 259 FQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQL 292
           + F N P     + S+++  L   P +RP+  QL
Sbjct: 235 WLFSNSPQ----VVSIVQSILVTDPLKRPSAAQL 264

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 107/241 (44%), Gaps = 52/241 (21%)

Query: 100 IGSYEV-------FLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQ 152
           +G Y+V       +L++EY ++G L + +  R    L E E +    Q+   V+  HAL 
Sbjct: 90  LGLYDVWETNNNLYLILEYAEKGELFNLLVDR--GALPEREAMKCFRQIIIAVSYCHALG 147

Query: 153 PPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTA----Q 208
             ++HRD+K EN+LL S  + K+ DFG                 +Q D     T+     
Sbjct: 148 --IVHRDLKPENLLLDSDYNIKVADFGMAA--------------LQTDAALLETSCGSPH 191

Query: 209 YRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTTPFEKTGEN------AILHASFQF 261
           Y +PE+++   GLP     SD+W+ GV L+ L     PF++   N       +    F+ 
Sbjct: 192 YAAPEIVS---GLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEM 248

Query: 262 PNFPHYSDRMKSLIRITLNVQPSQRPNI-----------YQLLEEVSKIQNVPCPIPDFY 310
           P+    S   + LI   L V P+QR  I           YQ +++   I+++P    D Y
Sbjct: 249 PDDTEISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPR--EDTY 306

Query: 311 L 311
           L
Sbjct: 307 L 307

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 89/182 (48%), Gaps = 20/182 (10%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +    ++ + E+E   I  QV  G+  +H     ++HRD+K ENV++ ++G  K
Sbjct: 1199 GCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAKGFVK 1256

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLP-INEKSDIWALG 233
            L DFGS   +   P +     +V        T  Y +PE+++   G P + +  DIWA+G
Sbjct: 1257 LIDFGSAAYVNSGPFD----VFV-------GTIDYAAPEVLS---GEPYLGKPQDIWAIG 1302

Query: 234  VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
            + LY + +   PF    E  IL A  +  N    S     LI+  L   P++RP I +++
Sbjct: 1303 ILLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEIV 1360

Query: 294  EE 295
             +
Sbjct: 1361 ND 1362

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 132/271 (48%), Gaps = 35/271 (12%)

Query: 31  GGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYID 90
           G    VYTA     +   N+S V +K++ +  +P    +  E+  MK  ++  ++V++ID
Sbjct: 632 GASGGVYTA----YEVGTNAS-VAIKQMNLEKQPKKELIINEILVMKGSKHQ-NIVNFID 685

Query: 91  SHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHA 150
           S+  K D       ++++MEY + G L D +   +   L E +I  +  +  +G+  +H+
Sbjct: 686 SYVLKGD-------LWVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRETLRGLQFLHS 735

Query: 151 LQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYR 210
               ++HRDIK +N+LL+  G  KL DFG  C  I    N +  T V        T  + 
Sbjct: 736 KG--VIHRDIKSDNILLSMNGEIKLTDFG-FCAQIN-EINLKRTTMV-------GTPYWM 784

Query: 211 SPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF-EKTGENAI-LHASFQFPNFPH-- 266
           +PE+++  +  P   K DIW+LG+ + ++     P+  +T   A+ L A+   P      
Sbjct: 785 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPE 841

Query: 267 -YSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
             S  +KS +   LNV P  R +  +LL +V
Sbjct: 842 VLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 98/200 (49%), Gaps = 33/200 (16%)

Query: 104 EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
           E++L++EY D G L D++ ++   +L E+E +    Q+  G++  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 164 NVLL-TSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTA--QYRSPEMINLGK- 219
           N+LL   R   K+ DFG                 V + +++ +     Y SPE++ +GK 
Sbjct: 265 NLLLDKKRRIIKIADFGMAA------------LQVSNRLLQTSCGSPHYASPEIV-MGKC 311

Query: 220 --GLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HASFQFPNFPHYSDRMKS 273
             G P    SDIW+ G+ L+ L     PF       +L    +  +Q P++   S   K+
Sbjct: 312 YNGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKN 365

Query: 274 LIRITLNVQPSQRPNIYQLL 293
           LI   L V PS+R +  Q+L
Sbjct: 366 LISRILVVDPSKRISTEQIL 385

>NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86
          Length = 1082

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 128/300 (42%), Gaps = 45/300 (15%)

Query: 9    YHPGTLLSVGSHQARIIKY--------LTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60
            Y P T  S+GS Q RI K+        L  G + +V           +   ++  +R++V
Sbjct: 804  YTPST--SIGS-QKRIKKFSDFTVLQQLGEGAYGKVKLCIHKEKRTIVVIKMIFKERILV 860

Query: 61   PD---KPSLNTLRAEVDAMKLLRNNTH--VVSYIDSHAAKFDTNIGSYEVFLLMEYCDRG 115
                    L T+ +E+  M  L    H  +V+ +D             E +  ME    G
Sbjct: 861  DTWVRDRKLGTIPSEIQIMATLNKKPHKNIVALLDFFED---------EEYYYMETPAHG 911

Query: 116  --GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGH 172
              G ID  +   L+  + E E   I  QV  G+  +H     ++HRDIK ENV++ S+GH
Sbjct: 912  ETGSIDLFDLIELKKNMTEYEEKLIFKQVVSGLKHLH--DQGIVHRDIKDENVIVDSKGH 969

Query: 173  YKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWAL 232
             KL D+GS       P +     +V        T  Y +PE+  LG  +   +  DIWA+
Sbjct: 970  VKLIDYGSAAYTKSGPFD----VFVG-------TIDYAAPEV--LGGSVYDGKPQDIWAI 1016

Query: 233  GVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQL 292
            G+ LY + +   PF    E  I+    +F +  + S+    LI+  LN     RP + ++
Sbjct: 1017 GILLYTIIFKENPFYNIDE--IMDGELRFNDAGNTSEACIKLIKKILNRSIVDRPCVDEI 1074

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 106/224 (47%), Gaps = 26/224 (11%)

Query: 96  FDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPL 155
           F+    S   ++L EY   G L+D++       L E+        V+  +  +HA    +
Sbjct: 191 FEMCTMSNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--I 246

Query: 156 LHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMI 215
           +HRD+KIEN+++++ G  K+ DFG +  +    T  Q  T+         +  + +PE++
Sbjct: 247 VHRDLKIENIMISTSGEIKIIDFG-LSNVFD--TRKQLHTFC-------GSLYFAAPELL 296

Query: 216 NLGKGLP-INEKSDIWALGVFLYKLCYYTTPFEKTGENAILH-----ASFQFPNFPHYSD 269
              K  P I  + DIW+ GV LY L     PF+    +++LH        ++PN  H S 
Sbjct: 297 ---KANPYIGPEVDIWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPN--HLSI 350

Query: 270 RMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNVPCPIPDFYLQR 313
            + SL+   L V P +R N+ +++E    I+    P P +  +R
Sbjct: 351 EVISLLSKMLVVDPLKRANLTKVIEHPWMIRGYDFPPPSYLPKR 394

>Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W
           (REAL)
          Length = 719

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 88/195 (45%), Gaps = 18/195 (9%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           ++L MEYC  G     + TR    + E +     S+V   +  +H L    ++RD+K EN
Sbjct: 396 LYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLG--FIYRDLKPEN 453

Query: 165 VLLTSRGHYKLCDFG-SVCGIIRPPTNPQEFTYVQHDIMKN--------TTAQYRSPEMI 215
           +LL   GH  L DF  S+  I       ++ TY+   I  +         T +Y +PE+I
Sbjct: 454 ILLHQSGHVMLSDFDLSIQAIGSKNPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVI 513

Query: 216 NLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENA----ILHASFQFPNFPHYSDRM 271
              +G       D W LG+ +Y++ +  TPF+    N     IL    +FP+    S   
Sbjct: 514 ---RGNGHTAAVDWWTLGILVYEMLFGCTPFKGVNSNETFSNILAKDAKFPHGKEVSKNC 570

Query: 272 KSLIRITLNVQPSQR 286
           K LI+  LN   ++R
Sbjct: 571 KDLIKKLLNKNETKR 585

>KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.652
           YOR231W
          Length = 493

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 115/252 (45%), Gaps = 40/252 (15%)

Query: 65  SLNTLRAEVDAMK-----LLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLID 119
           ++NTL  + +  K     LL N +   +YI  +   F T+ G+  ++L MEY     L  
Sbjct: 231 TINTLNTDPEFQKQLFRELLFNKSFKSAYIVRYYGMF-TDEGNSLIYLAMEYMGGRSLDA 289

Query: 120 FMNTRLQ--NRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCD 177
                L+   R+ E  +  I   V +G++ +H  +  ++HRDIK +N+L+   G  KLCD
Sbjct: 290 VYRNLLKRGGRISEKVLGKISESVLRGLSYLH--EKKVIHRDIKPQNILINELGEVKLCD 347

Query: 178 FGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLY 237
           FG V G      N    T+         T+ Y +PE I   +G P +   D+W+LG+ + 
Sbjct: 348 FG-VSG---EAVNSLATTFT-------GTSFYMAPERI---QGQPYSVTCDVWSLGLTIL 393

Query: 238 KLCYYTTPF--EKTGENA----------ILHASFQFPNFPH----YSDRMKSLIRITLNV 281
           ++     PF  +K  +NA          IL  + +  + P     +SD  KS I   L  
Sbjct: 394 EVAKGKFPFDSDKVQDNANIAPIELLVLILTFTPELKDEPENDIFWSDSFKSFIEYCLKK 453

Query: 282 QPSQRPNIYQLL 293
            P  RP+  Q+L
Sbjct: 454 DPGDRPSPRQML 465

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 132/280 (47%), Gaps = 35/280 (12%)

Query: 19  SHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKL 78
           S   R +  +  G    VYTA     +   N+S V +K++ +  +P    +  E+  MK 
Sbjct: 326 SRMYRNLIKIGQGASGGVYTA----YELGTNAS-VAIKQMNLEKQPKKELIINEILVMKG 380

Query: 79  LRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIM 138
            ++ +++V++IDS+  K D       ++++MEY + G L D +   +   L E +I  + 
Sbjct: 381 SKH-SNIVNFIDSYLLKGD-------LWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVC 429

Query: 139 SQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQ 198
            +  +G+  +H+    ++HRDIK +N+LL+  G  KL DFG  C  I    N +  T V 
Sbjct: 430 RETLKGLQFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFG-FCAQIN-EVNLKRTTMV- 484

Query: 199 HDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF--EKTGENAILH 256
                  T  + +PE+++  +  P   K DIW+LG+ + ++     P+  E       L 
Sbjct: 485 ------GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLI 535

Query: 257 ASFQFPNF---PHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
           A+   P      + SD +K  +   L V P  R N  +LL
Sbjct: 536 ATNGTPKLKDPENLSDTLKEFLGWCLKVDPEDRANAAELL 575

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 107/225 (47%), Gaps = 38/225 (16%)

Query: 72  EVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHE 131
           E+  MKLL N+ +V+   D     ++TN     +++++EY ++G L + +  R    L E
Sbjct: 87  EIIIMKLL-NHPNVLRLYDV----WETN---SSLYMVLEYVEKGELFNLLVDR--GPLPE 136

Query: 132 NEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNP 191
           NE +    Q+  G++  HAL   ++HRD+K EN+LL  + + K+ DFG            
Sbjct: 137 NEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA--------- 185

Query: 192 QEFTYVQHDIMKNTTA---QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTTPFE 247
                   D +  T+     Y +PE+++   GLP +  +SD+W+ G+ L+ L     PF+
Sbjct: 186 ----LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGIILFALLTGRLPFD 238

Query: 248 KTGEN------AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQR 286
           +   N       +    F+ P+    S   + LI   L V P+ R
Sbjct: 239 EEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAAR 283

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 121/278 (43%), Gaps = 41/278 (14%)

Query: 24  IIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVI----VPDKPSLNTLRAEVDAMKLL 79
           I + L  G F +VY     P      S ++C  +V+    + +       + E+D    L
Sbjct: 120 IGRKLGKGKFGKVYCVRHKP------SGLICALKVMNKMEIVNFNVQKQFKREIDIQYHL 173

Query: 80  RNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMS 139
            +      Y   H +K         V+L+MEY   G L   +  +    +++    + + 
Sbjct: 174 NHKNLTKLYAFFHDSK--------NVYLVMEYLIGGELYKLL--KKNGPMNDITASNYVY 223

Query: 140 QVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQH 199
           Q++  +  MH  +  ++HRD+K EN+L+      KL DFG     I  P N +  T    
Sbjct: 224 QMTDALNYMHKRK--IIHRDLKPENILIGFNNQIKLTDFGWS---IYNPNNQKRKTLC-- 276

Query: 200 DIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEK-TGENA---IL 255
                 T  Y SPE+I+       +E  D+WALG+  Y+L     PFE+ T E     I 
Sbjct: 277 -----GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIA 328

Query: 256 HASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
            +  +FP  P+ S   + LI   L V PS+R N+ Q++
Sbjct: 329 KSDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 130/283 (45%), Gaps = 42/283 (14%)

Query: 24  IIKYLTSGGFAQVYTAEISPIDPFINSSI-VCLKRVIVPDKPSLNTLRAEVDAMKLLRNN 82
            ++ L  G ++ V+ A +   +   N +I VC K+ I+ ++  +  +  E D + LL   
Sbjct: 12  FLEKLGQGSYSTVFRA-VERANGLRNYAIKVCSKKHIIRER-KVKYVTVEKDLLNLLAGG 69

Query: 83  TH---VVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMS 139
            H   V  +   H    DT+     ++ ++E+   G L+  +  R   RL E     I S
Sbjct: 70  GHPGVVRLFCTFH----DTD----NLYYVLEFVSGGELLGLV--RRMGRLPEEWCRRIAS 119

Query: 140 QVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVC----GIIRPPTNPQEFT 195
           Q+   V  MHA    ++HRD+K ENVLL+  G   + DFG+ C    G   P    +  +
Sbjct: 120 QLVDTVDYMHAKG--VIHRDLKPENVLLSQEGRIVITDFGAACCASEGGSAPGAADRAAS 177

Query: 196 YVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGE---- 251
           +V        TA+Y SPE++   +    +  SD+WALG  +Y+L     PF    E    
Sbjct: 178 FVG-------TAEYVSPELLLHSQ---CSFGSDVWALGCIIYQLTQGAPPFRGDTELQSF 227

Query: 252 NAILHASFQFPNFPHYSD--RMKSLIRITLNVQPSQRPNIYQL 292
             I+   +++     Y+    + +L++  L + P QRP+  QL
Sbjct: 228 EKIVALDYRW----VYAAPPLIVALVQSILVLDPLQRPSAKQL 266

>NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {ON}
           Anc_6.262 YPL236C
          Length = 406

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 80/155 (51%), Gaps = 11/155 (7%)

Query: 157 HRDIKIENVLLTSRGHYKLCDFGSVC-GIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMI 215
           HR+IK  N+L +S G   + D  S     I   T  Q   + +  I    +  + SPE++
Sbjct: 251 HRNIKPSNILFSSDGSQVISDLSSTSKSNIHLKTGKQILDFKEW-IDSCCSVPFMSPELL 309

Query: 216 NLGKGLPINEKSDIWALGVFLYKLCYYTTPFEK----TGENA---ILHASFQFPNF--PH 266
           +L  G  I+EK DIW+LG  +Y +    +PFE+    TG++    IL A+F FP     H
Sbjct: 310 DLKMGSKIDEKVDIWSLGCTIYTIILGVSPFEREVQLTGKSIRMLILSANFTFPEGMERH 369

Query: 267 YSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQN 301
            S  +   I+  L V P++RP I QLL ++  +Q+
Sbjct: 370 ASRELIDTIKQCLQVDPTKRPTINQLLNDLQALQS 404

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 87/184 (47%), Gaps = 20/184 (10%)

Query: 114  RGGLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGH 172
              G ID  +    +  + E+E   I  QV+ G+  +H+L   ++HRDIK ENV++ S+G+
Sbjct: 1129 ESGCIDLFDLIEFRTDMTEDEAKLIFKQVASGLQHLHSLG--IVHRDIKDENVIIDSKGY 1186

Query: 173  YKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWA 231
             K+ DFGS   +   P           D+   T   Y +PE++    G P   K  DIWA
Sbjct: 1187 VKIIDFGSAAYVKNGP----------FDVFVGTI-DYAAPEVL---AGNPYEGKPQDIWA 1232

Query: 232  LGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQ 291
            LG+ LY + +   PF    E  I+  +  F N    +     LI+  L     +RP+I +
Sbjct: 1233 LGILLYTIIFKENPFYNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDINE 1290

Query: 292  LLEE 295
            +  +
Sbjct: 1291 VFSD 1294

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 133/280 (47%), Gaps = 38/280 (13%)

Query: 22  ARIIKYLTSGGFAQVYTA-EISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLR 80
           A ++K +  G    VYTA EI       N S V +K++ +  +P    +  E+  MK  R
Sbjct: 623 ANLVK-IGQGASGGVYTAYEIG-----TNVS-VAIKQMNLEKQPKKELIINEILVMKGSR 675

Query: 81  NNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQ 140
           +  ++V++IDS+  K D       ++++MEY + G L D +   +   L E +I  +  +
Sbjct: 676 H-PNIVNFIDSYVLKGD-------LWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRE 724

Query: 141 VSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHD 200
              G+  +H+    +LHRDIK +N+LL+  G  KL DFG  C  I    N +  T V   
Sbjct: 725 TLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQIN-ELNLKRTTMVG-- 778

Query: 201 IMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF--EKTGENAILHAS 258
                T  + +PE+++  +  P   K DIW+LG+ + ++     P+  E       L A+
Sbjct: 779 -----TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 830

Query: 259 FQFPNF---PHYSDRMKSLIRITLNVQPSQRPNIYQLLEE 295
              P      + S  +K  +   L V+P +R +  +LL +
Sbjct: 831 NGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHD 870

>AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAR019C
           (CDC15)
          Length = 902

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 92/195 (47%), Gaps = 22/195 (11%)

Query: 102 SYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIK 161
           S+E+++L+EYC RG L D +    +  L E +    + Q  +G+  +H     ++HRDIK
Sbjct: 86  SHELYILLEYCIRGSLRDLIK---KEALSEAKAKTYVRQTLRGLQYLH--DQGVIHRDIK 140

Query: 162 IENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGL 221
             N+LLT  G  KL DFG     +    N    TY         +  + +PE++ LGKG 
Sbjct: 141 AANLLLTENGVVKLADFG-----VSTRVNNMAMTYA-------GSPNWMAPEVM-LGKG- 186

Query: 222 PINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFP--HYSDRMKSLIRITL 279
             +  SDIW+LG  + +L     PF      A  +A      +P  H S   K+ + +  
Sbjct: 187 -ASTVSDIWSLGATVVELLTGNPPFYNLVNEAACYAIVNDVYYPPEHLSAECKAFMELCF 245

Query: 280 NVQPSQRPNIYQLLE 294
                +RP  +QLL+
Sbjct: 246 QKNMFKRPQAHQLLQ 260

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 82/176 (46%), Gaps = 20/176 (11%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +    +  + E E   I+ QV  G+  +H     ++HRDIK ENV++ S+G  K
Sbjct: 1192 GCIDLFDLIEFKTNMTECEAKLIVKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1249

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWALG 233
            + DFGS   +   P +     +V        T  Y +PE++    G P   K  DIWA+G
Sbjct: 1250 IIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLG---GNPYEGKPQDIWAIG 1295

Query: 234  VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNI 289
            + LY + +   PF    E  IL    +F N    S+    LI+  LN    +RP I
Sbjct: 1296 ILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTI 1349

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 130/294 (44%), Gaps = 58/294 (19%)

Query: 14  LLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEV 73
           L  VG++  +I+  +  G F +VY A+  P       + V LK     DK   N +R   
Sbjct: 32  LKEVGNY--KILDQIGEGSFGKVYLAQHRPT-----HTKVVLKS---SDKNDPNIVR--- 78

Query: 74  DAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENE 133
              ++  +      YI      ++  I   +V++ +EYC    L D + +   +R+  +E
Sbjct: 79  ---EVFYHRQFDYPYI---TKLYEVIITETKVWMALEYCPGKELYDRVLS--MHRVPTDE 130

Query: 134 ILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQE 193
            + + +Q+  GV   H+L    +HRD+K+EN+LL   G  KL DFG              
Sbjct: 131 CVQLFAQIVGGVHYAHSLN--CVHRDLKLENILLDKSGDAKLTDFG-------------- 174

Query: 194 FTYVQHDIMKNTTAQ-------YRSPEMINLGK--GLPINEKSDIWALGVFLYKLCYYTT 244
           FT    + M  TT +       Y +PE+I      G  I    DIW+LGV LY +   + 
Sbjct: 175 FT---RECMTKTTLETICGTTVYMAPELIERKSYDGFKI----DIWSLGVILYTMINGSM 227

Query: 245 PFEKTGEN----AILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
           PF++  E      I+H + Q       +D  K LI   L   P+ RP + Q+L+
Sbjct: 228 PFDEDDETKTEWKIVHQTPQLNENIVTAD-AKDLILRLLAKNPNDRPTVEQILK 280

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 80/175 (45%), Gaps = 18/175 (10%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +    +  + E E   I  QV  G+  +H     ++HRDIK ENV++ S+G  K
Sbjct: 1188 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1245

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGV 234
            + DFGS   +   P +     +V        T  Y +PE+  LG      +  DIWA+G+
Sbjct: 1246 IIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEV--LGGNPYEGQPQDIWAIGI 1292

Query: 235  FLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNI 289
             LY + +   PF    E  IL    +F N    S+    LI+  LN +   RP I
Sbjct: 1293 LLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRRVPNRPTI 1345

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 133/311 (42%), Gaps = 59/311 (18%)

Query: 26  KYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHV 85
           K +  G FA VY    S  DP    ++  + +  + +K  L  L  E+  +K L N+ H+
Sbjct: 136 KEIGKGSFAVVYRG-YSNEDPNFKLAVKSVPKSKLKNKKILENLEIEISILKKL-NHKHI 193

Query: 86  VSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTR--------LQNRLHEN----- 132
           V+ ID    K D         L+MEYC  G L   +  R        L N++ +      
Sbjct: 194 VNLIDCQRNKND-------FLLIMEYCSLGDLTFLIKKRNELIINHPLLNQIFQKFPSPN 246

Query: 133 ------EILDIMSQVSQGVAAMHALQPP-LLHRDIKIENVLLTS--------RGHYKLCD 177
                  I  +++ + Q  +A+  L+   L+HRDIK +N+LL++        +   KL  
Sbjct: 247 PDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYTDYHDQQTFKKLGY 306

Query: 178 FGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQ--------YRSPEMINLGKGLPINEKSDI 229
            G  C    P     +F + +   + NT+          Y +PE++N  K    N K+D+
Sbjct: 307 IGISC---LPILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILNYQK---YNAKADL 358

Query: 230 WALGVFLYKLCYYTTPFEKTGENAIL------HASFQFPNFPHYSDRMKSLIRITLNVQP 283
           W++G  LY++ Y   PF+      +L      + +  FP++    D MK LI   L   P
Sbjct: 359 WSVGTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEIDDDMKFLISRLLKFDP 418

Query: 284 SQRPNIYQLLE 294
            +R +  +  E
Sbjct: 419 IKRMSFQEFFE 429

>Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 82/181 (45%), Gaps = 18/181 (9%)

Query: 116  GLIDFMNT-RLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +    +  + E+E   +  QV   +  +H     ++HRDIK ENV++ S G  K
Sbjct: 933  GSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHG--QGIVHRDIKDENVIVDSHGFVK 990

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGV 234
            L DFGS   I   P +     +V        T  Y +PE+  LG      +  DIWALGV
Sbjct: 991  LIDFGSAAYIKSGPFD----VFV-------GTMDYAAPEV--LGGSSYKGKPQDIWALGV 1037

Query: 235  FLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
             LY + Y   P+    E  IL    +F      S+    LI+  L  +  +RP I ++ E
Sbjct: 1038 LLYTIIYKENPYYNIDE--ILEGELRFDKSEKVSEECIGLIKRILTREVDKRPTIDEIYE 1095

Query: 295  E 295
            +
Sbjct: 1096 D 1096

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 124/284 (43%), Gaps = 38/284 (13%)

Query: 16  SVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDA 75
           SV  H  ++I     G +  VY A     D      +V +K V+  +   LN + AE+  
Sbjct: 22  SVQYHLKQVIG---RGSYGVVYKAINKHTD-----QVVAIKEVVYENDEELNDIMAEISL 73

Query: 76  MKLLRNNTHVVSYIDSHAAKFDTNI-GSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEI 134
           +K L +N  V         K+   I  SYE+++L+EYC  G L   + +R    L ENE 
Sbjct: 74  LKNLNHNNIV---------KYHGFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENES 123

Query: 135 LDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEF 194
              ++Q   G+  +H     ++HRDIK  N+LL++    KL DFG     +    N    
Sbjct: 124 KTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSAL 176

Query: 195 TYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAI 254
           T          T  + +PE++   +G   +  SDIW+LG  + ++     P+    +  I
Sbjct: 177 TLAG-------TLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANI 226

Query: 255 LHASFQFPNFP--HYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
            +A      +P   +S+ +K  +         +RP   QLL+ V
Sbjct: 227 YYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHV 270

>YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putative
           serine/threonine protein kinase implicated in the
           regulation of phospholipid asymmetry through the
           activation of phospholipid translocases (flippases)
           Lem3p-Dnf1p/Dnf2p; similar to Fpk1p
          Length = 720

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 88/197 (44%), Gaps = 22/197 (11%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           ++L MEYC  G     + TR    + E +     S+V   +  +H L    ++RD+K EN
Sbjct: 397 LYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLG--FIYRDLKPEN 454

Query: 165 VLLTSRGHYKLCDFG---SVCGIIRPPTNPQEFTYVQHDIMKN--------TTAQYRSPE 213
           +LL   GH  L DF       G  +P    ++ TY+   I  +         T +Y +PE
Sbjct: 455 ILLHQSGHVMLSDFDLSIQATGSKKPTM--KDSTYLDTKICSDGFRTNSFVGTEEYLAPE 512

Query: 214 MINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENA----ILHASFQFPNFPHYSD 269
           +I   +G       D W LG+ +Y++ +  TPF+    N     IL    +FP+    S 
Sbjct: 513 VI---RGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFPHDKEVSK 569

Query: 270 RMKSLIRITLNVQPSQR 286
             K LI+  LN   ++R
Sbjct: 570 NCKDLIKKLLNKNEAKR 586

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 88/190 (46%), Gaps = 33/190 (17%)

Query: 101  GSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDI 160
            GS ++F L+E+               + + E EI  +  QV  GV  +H     ++HRDI
Sbjct: 1213 GSIDLFDLIEFT--------------SNMTEFEIKLLFKQVVSGVKHLH--DQGIVHRDI 1256

Query: 161  KIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKG 220
            K EN+++ ++G  K+ DFGS   +   P +     +V        T  Y +PE++    G
Sbjct: 1257 KDENIIVDNKGFIKIIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLG---G 1302

Query: 221  LPINEK-SDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITL 279
             P   K  DIWALG+ LY + +   PF    E  IL    +F +  + S     LI++ L
Sbjct: 1303 NPYEGKPQDIWALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLIL 1360

Query: 280  NVQPSQRPNI 289
            N    +RP I
Sbjct: 1361 NRNVFKRPTI 1370

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 85/179 (47%), Gaps = 20/179 (11%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +   L+  + E+E   I  QV+ G+  +H     ++HRDIK EN+++ ++G  K
Sbjct: 1106 GSIDLFDLIELKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVK 1163

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWALG 233
            L DFGS   +   P           D+   T   Y +PE++    G P   K  DIWA+G
Sbjct: 1164 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---GDPYEGKPQDIWAIG 1209

Query: 234  VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQL 292
            V LY + +   PF    E  IL    +  +    S+   +LIR  LN    +RP I ++
Sbjct: 1210 VLLYTIIFKENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPTIEEI 1266

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 131/291 (45%), Gaps = 44/291 (15%)

Query: 9   YHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNT 68
           +    L  VG++  +I K +  G F +VY A   P         V LK     DK   N 
Sbjct: 31  FSSSELTEVGNY--KIQKQIGEGSFGKVYLATHRPT-----KQKVVLK---TGDKSDPNV 80

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +R      ++  +      YI      ++  +   +V++ +EYC    L D + ++  +R
Sbjct: 81  VR------EVFYHRQFDYPYI---TKLYEVIVTETKVWMALEYCPGKELYDHLLSK--SR 129

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L   E  ++ +Q++  V   H L    +HRD+K+ENVLL   G+ KL DFG         
Sbjct: 130 LPTLECAELFAQITGAVHYAHTLN--CVHRDLKLENVLLDKNGNAKLTDFGFT------- 180

Query: 189 TNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYTTPFE 247
              +  T    + +  TT  Y +PEMI   +  P +  K DIW+LGV LY L     PF+
Sbjct: 181 --RESMTKAVLETVCGTTV-YMAPEMI---QHKPYDGFKVDIWSLGVILYTLLCGCLPFD 234

Query: 248 KTGENAILHASFQFPNFPHYSDRM-----KSLIRITLNVQPSQRPNIYQLL 293
           +  ++ +L       + P   +R+     ++LI   L+  P++RPN   +L
Sbjct: 235 E--DDDLLTKQKIINDTPVIDERITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 127/273 (46%), Gaps = 41/273 (15%)

Query: 31  GGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYID 90
           G    VYTA     D     + V +K++ +  +P    +  E+  MK  ++  ++V++ID
Sbjct: 560 GASGGVYTAYEVGTD-----ASVAIKQMNLEKQPKKELIINEIIVMKDSKH-PNIVNFID 613

Query: 91  SHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHA 150
           S   K D       ++++ME+ + G L D +   +   L E +I  +  +  +G+  +H+
Sbjct: 614 SFLLKGD-------LWVIMEFMEGGSLTDVVTHCI---LTEGQIGTVCRETLRGLQFLHS 663

Query: 151 LQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNT---TA 207
               ++HRDIK +N+LL+ +G  KL DFG  C  I            +H++ + T   T 
Sbjct: 664 NG--VIHRDIKSDNILLSMKGDIKLTDFG-FCAQIN-----------EHNLKRTTMVGTP 709

Query: 208 QYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF--EKTGENAILHASFQFPNFP 265
            + +PE+++  +  P   K DIW+LG+ + ++     P+  E       L A+   P   
Sbjct: 710 YWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIESEPPYLNETPLRALYLIATNGTPKLK 766

Query: 266 H---YSDRMKSLIRITLNVQPSQRPNIYQLLEE 295
                SD +   +   L V P +R +   LLE+
Sbjct: 767 EPELLSDVLNDFLSWCLKVNPDERASASTLLED 799

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (46%), Gaps = 20/182 (10%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +    +  + E E   I  QV  G+  +H     ++HRDIK ENV++ S+G  K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVK 1300

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWALG 233
            + DFGS   +   P +     +V        T  Y +PE+++   G P   K  DIWALG
Sbjct: 1301 IIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEVLS---GEPYEGKPQDIWALG 1346

Query: 234  VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
            + LY + +   PF    E  IL    +F +    ++    LI+  L  Q   RP I ++ 
Sbjct: 1347 ILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIF 1404

Query: 294  EE 295
            ++
Sbjct: 1405 DD 1406

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 134/307 (43%), Gaps = 49/307 (15%)

Query: 9    YHPGTLLSVGSHQARIIKY-LTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLN 67
            +  G ++  GS  A  +   +T+G    V   E+ P     N ++V           +++
Sbjct: 1140 WMKGEMIGKGSFGAVFLAMNITTGEMMAVKQVEV-PKYGLQNETVVN----------TVD 1188

Query: 68   TLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQN 127
             LR EV  +K L ++ ++V Y+      F+   G Y +FL  EY   G +   +  R+  
Sbjct: 1189 ALRLEVSTLKDL-DHLNIVQYLG-----FEAKNGIYSLFL--EYVAGGSVGSLI--RMYG 1238

Query: 128  RLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRP 187
            R  +  I  +  QV QG++ +H+    +LHRD+K +N+LL   G  K+ DF    GI R 
Sbjct: 1239 RFDDILIRHLTIQVLQGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISRK 1292

Query: 188  PTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFE 247
              +     Y   ++    T  + +PEM++  +G   + K DIW+LG  + ++     P+ 
Sbjct: 1293 SND----IYSNSEMTMKGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWS 1346

Query: 248  KTGENAILHASFQF-----------PNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEE- 295
                  ++ A F+               P  S+  K  +     + P +RP   +LL   
Sbjct: 1347 NF---EVVAAMFKIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLLSHP 1403

Query: 296  VSKIQNV 302
             SK+ N+
Sbjct: 1404 FSKVNNL 1410

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 125/283 (44%), Gaps = 36/283 (12%)

Query: 16  SVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDA 75
           SV  H  ++I     G +  VY A     D      +V +K ++  +   LN + AE+  
Sbjct: 22  SVQYHLKQVIG---RGSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEISL 73

Query: 76  MKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEIL 135
           +K L N+ ++V Y      K      SYE+++L+EYC  G L   + +R    L ENE  
Sbjct: 74  LKNL-NHHNIVKY-HGFIRK------SYELYILLEYCANGSLRRLI-SRSSTGLSENESK 124

Query: 136 DIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFT 195
             ++Q   G+  +H     ++HRDIK  N+LL++    KL DFG     +    N    T
Sbjct: 125 TYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALT 177

Query: 196 YVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL 255
                     T  + +PE++   +G   +  SDIW+LG  + ++     P+    +  I 
Sbjct: 178 LAG-------TLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIY 227

Query: 256 HASFQFPNFP--HYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296
           +A      +P   +S+ +K  +         +RP   QLL+ V
Sbjct: 228 YAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHV 270

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 119/270 (44%), Gaps = 44/270 (16%)

Query: 52   IVCLKRVIVPDKPSLN--------TLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSY 103
            ++ +K+V VP   S N         LR+EV  +K L ++ ++V Y+      F+     Y
Sbjct: 1200 MMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHLNIVQYLG-----FENKDNIY 1253

Query: 104  EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
             +FL  EY   G +   +  R+  R  E  I  + +QV +G+A +H+    +LHRD+K +
Sbjct: 1254 SLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLHSKG--ILHRDMKAD 1307

Query: 164  NVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPI 223
            N+LL   G  K+ DF    GI R   +     Y   D+    T  + +PEM++  +G   
Sbjct: 1308 NLLLDQDGICKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY-- 1357

Query: 224  NEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQF-----------PNFPHYSDRMK 272
            + K DIW+LG  + ++     P+       ++ A F+               P  S   +
Sbjct: 1358 SAKVDIWSLGCIVLEMFAGKRPWSNL---EVVAAMFKIGKSKSAPPIPEDTLPLISQVGR 1414

Query: 273  SLIRITLNVQPSQRPNIYQLLEEVSKIQNV 302
              +     + P +RP   +LL     + NV
Sbjct: 1415 GFLDACFEINPEKRPTATELLSHRFSVVNV 1444

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 131/270 (48%), Gaps = 35/270 (12%)

Query: 31  GGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYID 90
           G    VYTA     +   N+S V +K++ +  +P    +  E+  MK  ++  ++V++ID
Sbjct: 675 GASGGVYTA----YEVGTNAS-VAIKQMNLEKQPKKELIINEILVMKASKH-ANIVNFID 728

Query: 91  SHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHA 150
           S+  + D       ++++MEY + G L D +   +   L E +I  +  +  +G+  +H+
Sbjct: 729 SYLLRGD-------LWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLHS 778

Query: 151 LQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYR 210
               ++HRDIK +N+LL+  G  KL DFG  C  I    N +  T V        T  + 
Sbjct: 779 KG--VIHRDIKSDNILLSMTGEIKLTDFG-FCAQIN-EINLKRTTMV-------GTPYWM 827

Query: 211 SPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF-EKTGENAIL----HASFQFPNFP 265
           +PE+++  +  P   K DIW+LG+ + ++     P+  +T   A+     + + +  +  
Sbjct: 828 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDAD 884

Query: 266 HYSDRMKSLIRITLNVQPSQRPNIYQLLEE 295
             SD +K  +   L+V P +R    +LL +
Sbjct: 885 SLSDDLKGFLGWCLHVDPDERATASELLSD 914

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 94/201 (46%), Gaps = 33/201 (16%)

Query: 104 EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
           E++L++EY D G L D++ ++   +L E E +    Q+ +GV   H+    + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICHRDLKPE 289

Query: 164 NVLL-TSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTA--QYRSPEMINLGK- 219
           N+LL   R   K+ DFG                 V + ++K +     Y SPE++ +GK 
Sbjct: 290 NLLLDKKRKLIKIADFGMAA------------LQVSNTLLKTSCGSPHYASPEIV-MGKT 336

Query: 220 --GLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HASFQFPNFPHYSDRMKS 273
             G P    SD+W+ G+ L+ L     PF       +L    +  +Q PN+   S   K 
Sbjct: 337 YNGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LSKDAKD 390

Query: 274 LIRITLNVQPSQRPNIYQLLE 294
           LI   L V P  R    Q+LE
Sbjct: 391 LISRILLVNPKARLTTEQILE 411

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 111/235 (47%), Gaps = 38/235 (16%)

Query: 85  VVSYIDSHA---AKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQV 141
           V+  + SHA   A F+      E++L++EY D G L D++ +R   +L E E +    Q+
Sbjct: 166 VIMKLISHANVMALFEVWENKSELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQI 223

Query: 142 SQGVAAMHALQPPLLHRDIKIENVLLTSRG-HYKLCDFGSVCGIIRPPTNPQEFTYVQHD 200
            +GV+  H+    + HRD+K EN+LL  +    K+ DFG +  +  P           + 
Sbjct: 224 VEGVSYCHSFN--ICHRDLKPENLLLDKKNKKIKIADFG-MAALELP-----------NK 269

Query: 201 IMKNTTA--QYRSPEMINLGK---GLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL 255
           ++K +     Y SPE++ +G+   G P    SD+W+ G+ L+ L     PF       +L
Sbjct: 270 LLKTSCGSPHYASPEIV-MGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLL 324

Query: 256 ----HASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEE--VSKIQNVPC 304
                  +Q P   + S   ++LI   L + P +R    ++LE   + K  N+P 
Sbjct: 325 LKVQSGKYQMPM--NLSLEARNLISKILVIDPEKRITTQEILEHPLIKKYDNLPV 377

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/261 (26%), Positives = 118/261 (45%), Gaps = 44/261 (16%)

Query: 52   IVCLKRVIVPDKPSLN--------TLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSY 103
            ++ +K+V VP   S N         LR+EV  +K L ++ ++V Y+      F+     Y
Sbjct: 1206 MMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHLNIVQYLG-----FENKNSIY 1259

Query: 104  EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
             +FL  EY   G +   +  R+  R  E+ I  + +QV +G+A +H+    +LHRD+K +
Sbjct: 1260 SLFL--EYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLRGLAYLHSKG--ILHRDMKAD 1313

Query: 164  NVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPI 223
            N+LL   G  K+ DF    GI R   +     Y   D+    T  + +PEM++  +G   
Sbjct: 1314 NLLLDQDGICKISDF----GISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY-- 1363

Query: 224  NEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQF-----------PNFPHYSDRMK 272
            + K DIW+LG  + ++     P+       ++ A F+               P  +   +
Sbjct: 1364 SAKVDIWSLGCIVLEMFAGKRPWSNL---EVVAAMFKIGKSKSAPPIPEDTLPLITRVGR 1420

Query: 273  SLIRITLNVQPSQRPNIYQLL 293
            S +     + P +RP   +LL
Sbjct: 1421 SFLDACFEIDPEKRPTATKLL 1441

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 121/270 (44%), Gaps = 26/270 (9%)

Query: 28  LTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVS 87
           L  G ++ V  A  + ID     ++  L +  +  +  +  +  E +A++ + N+  +V 
Sbjct: 185 LGDGAYSTVMLA--TSIDSKKQYAVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVK 242

Query: 88  YIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAA 147
                   F T      ++ L+EYC  G  +  M  +    L+E       +QV   +  
Sbjct: 243 L-------FFTFQDESSLYFLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDY 293

Query: 148 MHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTA 207
           +H     ++HRDIK EN+LL      KL DFG+   I+   TN  +F  +        TA
Sbjct: 294 LHT--NGIIHRDIKPENILLDKEFKIKLTDFGT-AKILDSSTN-NKFDLLTRSKSFVGTA 349

Query: 208 QYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGE----NAILHASFQF-P 262
           +Y +PE++N      ++ + D+WA G  LY++     PF+ T E      ++   + F  
Sbjct: 350 EYVAPELLNDSF---VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTA 406

Query: 263 NFPHYSDRMKSLIRITLNVQPSQRPNIYQL 292
            FP     ++ L++  L    +QRP+I Q+
Sbjct: 407 GFPLI---IRDLVKKILVKDLNQRPSISQI 433

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 120/259 (46%), Gaps = 38/259 (14%)

Query: 52   IVCLKRVIVPDKPS-----LNT---LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSY 103
            ++ +K++ VP   S     LNT   +++EV  +K L ++ ++V Y+      F+     Y
Sbjct: 1160 MMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDL-DHLNIVQYLG-----FEMKHNIY 1213

Query: 104  EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
             +FL  EY   G +   +  R+  R  +  I  + +QV +G++ +H+    +LHRD+K +
Sbjct: 1214 SLFL--EYVAGGSVGSLI--RMYGRFDDKLIRHLTNQVLEGLSYLHSQG--ILHRDMKAD 1267

Query: 164  NVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPI 223
            N+LL   G  K+ DFG         +   E  Y   ++    T  + +PEM++  +G   
Sbjct: 1268 NLLLDQDGICKISDFG--------ISKKSEDIYSNSEMTMRGTVFWMAPEMVDTKQGY-- 1317

Query: 224  NEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRIT----- 278
            N K DIW+LG  + ++     P+        ++   Q  + P   +  K LI  T     
Sbjct: 1318 NAKVDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKIGQSKSAPPIPEDTKDLISPTAKNFL 1377

Query: 279  ---LNVQPSQRPNIYQLLE 294
                ++ P +RP   QLLE
Sbjct: 1378 NQCFHIDPKERPTAGQLLE 1396

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 84/176 (47%), Gaps = 20/176 (11%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +   L+  + E+E   +  QV+ G+  +H  +  ++HRDIK ENV++ +RG  K
Sbjct: 1091 GSIDLFDLIELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVK 1148

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWALG 233
            + DFGS   + R P           D+   T   Y +PE++    G P   K  D+WA+G
Sbjct: 1149 IIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLG---GDPYEGKPQDVWAVG 1194

Query: 234  VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNI 289
            V LY + Y   PF    E  IL    +       S+   +LI   LN   ++RP +
Sbjct: 1195 VLLYTIIYKENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTV 1248

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 122/279 (43%), Gaps = 43/279 (15%)

Query: 31   GGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPS--------LNTLRAEVDAMKLLRNN 82
            G F  VY              ++ +K+V VP   S        L  L++EV  +K L ++
Sbjct: 1155 GSFGSVYLGLN-----VTTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDL-DH 1208

Query: 83   THVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVS 142
             ++V Y+      F+     Y +FL  EY   G +   +  RL  R  E+ I  +  QV 
Sbjct: 1209 VNIVQYLG-----FENKNHVYSLFL--EYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVL 1259

Query: 143  QGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIM 202
            +G+A +H+    +LHRD+K +N+LL   G  K+ DF    GI +   N     Y   D+ 
Sbjct: 1260 RGLAYLHSKG--ILHRDMKADNLLLDVDGICKISDF----GISKKSNN----IYSNSDMT 1309

Query: 203  KNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQF- 261
               T  + +PEM++  +G   + K DIW+LG  + ++     P+      A +    +F 
Sbjct: 1310 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFK 1367

Query: 262  --PNFPHYSDRM-----KSLIRITLNVQPSQRPNIYQLL 293
              P  P  + ++     KS +     + P +RP    LL
Sbjct: 1368 SAPPIPEDTQKLLSAEAKSFLDACFEIDPEKRPTADDLL 1406

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 80/175 (45%), Gaps = 18/175 (10%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +    +  + E E   I  QV  G+  +H     ++HRDIK ENV++ S+G  K
Sbjct: 1188 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1245

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGV 234
            + DFGS   +   P +     +V        T  Y +PE+  LG      +  DIWA+G+
Sbjct: 1246 IIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEV--LGGNPYEGQPQDIWAIGI 1292

Query: 235  FLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNI 289
             LY + +   PF    E  IL    +F N    S+    LI+  LN    +RP I
Sbjct: 1293 LLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTI 1345

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 82/178 (46%), Gaps = 18/178 (10%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +    +  + E E   I  QV   +  +H     ++HRDIK ENV++ S+G  K
Sbjct: 1129 GCIDLFDLIEFKTNMSEVETKLIFMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQGFIK 1186

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGV 234
            L DFGS   +   P +     +V        T  Y +PE+  LG    + +  DIWA+G+
Sbjct: 1187 LIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEV--LGGEPYVGKPQDIWAIGI 1233

Query: 235  FLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQL 292
             LY + +   PF    E  IL A  +F       +    LI+  L   P++RP I ++
Sbjct: 1234 LLYTIIFKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTIDEI 1289

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 136/280 (48%), Gaps = 38/280 (13%)

Query: 22  ARIIKYLTSGGFAQVYTA-EISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLR 80
           A ++K +  G    VYTA EI       N S V +K++ +  +P    +  E+  MK  +
Sbjct: 600 ANLVK-IGQGASGGVYTAYEIG-----TNVS-VAIKQMNLEKQPKKELIINEILVMKGSK 652

Query: 81  NNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQ 140
           +  ++V++IDS+  K D       ++++MEY + G L D +   +   L E +I  +  +
Sbjct: 653 H-PNIVNFIDSYVLKGD-------LWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRE 701

Query: 141 VSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHD 200
              G+  +H+    +LHRDIK +N+LL+  G  KL DFG  C  I    N +  T V   
Sbjct: 702 TLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQIN-ELNLKRTTMVG-- 755

Query: 201 IMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF-EKTGENAI-LHAS 258
                T  + +PE+++  +  P   K DIW+LG+ + ++     P+  +T   A+ L A+
Sbjct: 756 -----TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 807

Query: 259 FQFPNF---PHYSDRMKSLIRITLNVQPSQRPNIYQLLEE 295
              P      + S  +K  +   L V+P +R +  +LL +
Sbjct: 808 NGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHD 847

>NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa]
           {ON} Anc_3.229
          Length = 509

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 98/200 (49%), Gaps = 23/200 (11%)

Query: 104 EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
           +++LL++Y   G L  F + + Q  L E+ +    +++S  +  +H     +++RD+K E
Sbjct: 209 KLYLLLQYIPGGEL--FFHLKEQGTLDEDTVAFYAAEISCALKFLH--DKGIVYRDLKPE 264

Query: 164 NVLLTSRGHYKLCDFG-SVCGIIRPPTNPQEFTYVQ---------HDIMKNTTAQYRSPE 213
           N LL  +GH  L DFG S   + +   NP E T +          H I+   T +Y +PE
Sbjct: 265 NCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTSLNEPSEDLSTLHSII--GTPEYCAPE 322

Query: 214 MINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH---ASFQFPNFPHY-SD 269
           ++   +GLP N+  D ++LG  +Y +     P+       IL+      Q P  P+Y S+
Sbjct: 323 IL---QGLPYNKNCDWYSLGCLIYDMLSGKPPYTGANHKVILNKIQKDKQGPKIPYYLSE 379

Query: 270 RMKSLIRITLNVQPSQRPNI 289
            MK ++   L    S+R ++
Sbjct: 380 GMKDMLNWLLKKDQSKRWDV 399

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 95/204 (46%), Gaps = 30/204 (14%)

Query: 101 GSY----EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLL 156
           GSY    +++++MEYC  G L   +      ++ E  +  I+ ++   +  +H  +  ++
Sbjct: 89  GSYLYDTKLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRKLLIALVYIH--KDNVI 143

Query: 157 HRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMK-NTTAQYRSPEMI 215
           HRDIK  NVL+T+ GH KLCDFG             + T   H       T  + +PE+I
Sbjct: 144 HRDIKAANVLITNEGHVKLCDFGVAA----------QLTAANHKRQTMAGTPYWMAPEVI 193

Query: 216 NLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFP------HYSD 269
              +G+  N K+DIW+LG+  Y++     P+      A+        + P      +YS 
Sbjct: 194 M--EGVYYNTKADIWSLGITAYEIATGNPPYCDV--EALRAMQLITKSKPPRLEGRNYSP 249

Query: 270 RMKSLIRITLNVQPSQRPNIYQLL 293
            +K  I + L+  P +RP    LL
Sbjct: 250 LLKEFIALCLDEDPEERPTAEDLL 273

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 104/222 (46%), Gaps = 22/222 (9%)

Query: 96  FDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPL 155
           F+    S   ++L EY   G L+D++       L E+        ++  +  +HA    +
Sbjct: 230 FEMCTMSNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--I 285

Query: 156 LHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMI 215
           +HRD+KIEN+++++ G  K+ DFG +  +  P T    F           +  + +PE++
Sbjct: 286 VHRDLKIENIMISTSGEIKIIDFG-LSNMFDPRTQLHTFC---------GSLYFAAPELL 335

Query: 216 NLGKGLP-INEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFP--NFP-HYSDRM 271
              K  P +  + D+W+ GV LY L     PF+    +++LH   +    ++P H S  +
Sbjct: 336 ---KASPYVGPEVDVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVDYPQHLSIEV 391

Query: 272 KSLIRITLNVQPSQRPNIYQLLEEVSKIQNVPCPIPDFYLQR 313
            SL+   L V P +R ++ Q++E    I+    P P +   R
Sbjct: 392 ISLLSKMLVVDPRKRASLKQVVEHHWMIRGYDFPAPSYVPNR 433

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 128/291 (43%), Gaps = 38/291 (13%)

Query: 16  SVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDA 75
           SV  H  ++I     G +  VY A     D      +V +K ++      LN + AE+  
Sbjct: 22  SVQYHLKQVIG---RGSYGVVYKAINKHTD-----QVVAIKEIVYESDEELNDIMAEISL 73

Query: 76  MKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEIL 135
           +K L N+ ++V Y   H         SYE+++L+EYC  G L   + +R    L ENE  
Sbjct: 74  LKNL-NHDNIVKY---HGFI----RKSYELYILLEYCANGSLRRLI-SRSSTGLSENESK 124

Query: 136 DIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFT 195
             ++Q   G+  +H     ++HRDIK  N+LL++    KL DFG     +    N    T
Sbjct: 125 SYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-----VSTIVNSSALT 177

Query: 196 YVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL 255
                     T  + +PE++   +G   +  SDIW+LG  + ++     P+    +  I 
Sbjct: 178 LAG-------TLNWMAPEILG-NRG--ASTLSDIWSLGATVVEMLTKNPPYHNLTDANIY 227

Query: 256 HASFQFPNFP--HYSDRMKSLIRITLNVQPSQRPNIYQLLEE--VSKIQNV 302
           +A      +P   +S+ +K  +         +RP   QLL+   ++  +NV
Sbjct: 228 YAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTADQLLKHAWITSTENV 278

>KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.192
           YGR052W
          Length = 384

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 108/227 (47%), Gaps = 35/227 (15%)

Query: 28  LTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLL-RNNTHVV 86
           + SG F+ VY A  S ++ +     V LK VI   K S   +  E   MKLL RN+ ++ 
Sbjct: 8   IQSGSFSTVYKAWSSTLEQY-----VALK-VIPKKKYSSEGMDNEYKIMKLLGRNHPNIC 61

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQN------RLHENEILDIMSQ 140
           S +D +         SY V +++EYC+ G L DF++   +        L + +  ++++Q
Sbjct: 62  SMLDFYEDD------SYYV-VVLEYCECGDLYDFLDIAKKQGDPYSPALIQLDFRNLINQ 114

Query: 141 VSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHD 200
           +   +   H+L   + HRDIK EN+LLT  G+ KL D+G         T+ +   Y    
Sbjct: 115 LFSAINYAHSLG--IAHRDIKPENILLTKDGNIKLADWG------HATTDAKSKEY---- 162

Query: 201 IMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFE 247
                T  YR PE  N G       KSD W++GV +  L +   PF+
Sbjct: 163 --HIGTDNYRGPETFN-GTESYDTIKSDYWSIGVTMLYLIFGQCPFK 206

>Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar to
           Ashbya gossypii AER223C
          Length = 893

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 92/196 (46%), Gaps = 22/196 (11%)

Query: 102 SYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIK 161
           S+E+++L+EYC RG L D +    +  L E +    + Q  +G+  +H     ++HRDIK
Sbjct: 86  SHELYILLEYCIRGSLRDLIK---KEALSEAKAKVYVKQTVRGLQYLH--DQGVIHRDIK 140

Query: 162 IENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGL 221
             N+LLT  G  KL DFG     +         TY         +  + +PE++ LGKG 
Sbjct: 141 AANLLLTENGIVKLADFG-----VSTRVTNMAMTYA-------GSPNWMAPEVM-LGKG- 186

Query: 222 PINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFP--HYSDRMKSLIRITL 279
             +  SDIW+LG  + +L     PF      A  +A      +P  H S + K+ I    
Sbjct: 187 -ASTVSDIWSLGATVVELLTGNPPFHNLVNEAACYAIVNDVYYPPEHLSTQCKNFIERCF 245

Query: 280 NVQPSQRPNIYQLLEE 295
                +RP  +QLL++
Sbjct: 246 QKNMFKRPQAHQLLQQ 261

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/295 (28%), Positives = 126/295 (42%), Gaps = 62/295 (21%)

Query: 14  LLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEV 73
           L  VG++  +I+K +  G F +VY A   P         VCLK     DK   N +R   
Sbjct: 35  LTEVGNY--KILKQIGEGSFGKVYLALHRP-----THRKVCLK---TSDKNDPNIVR--- 81

Query: 74  DAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENE 133
              ++  +      YI      ++  +   +V++ +EYC    L D  +     RL   E
Sbjct: 82  ---EVFYHRQFDFPYI---TKLYEVIVTESKVWMALEYCPGKELYD--HLLSLRRLSLLE 133

Query: 134 ILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQE 193
             ++ +Q+S  V   H++    +HRD+K+EN+LL   G+ KL DFG              
Sbjct: 134 CGELFAQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDFG-------------- 177

Query: 194 FTYVQHDIMKNTTAQ-------YRSPEMINLG--KGLPINEKSDIWALGVFLYKLCYYTT 244
           FT    + M  TT +       Y +PE+I      G  I    DIW+LGV LY L     
Sbjct: 178 FT---RECMTKTTLETVCGTTVYMAPELIERKTYDGFKI----DIWSLGVILYTLITGYL 230

Query: 245 PFEKTGENAILHASFQFPN-FPHYS-----DRMKSLIRITLNVQPSQRPNIYQLL 293
           PF+   E   +   ++  N  P Y      D  K LI   L   P +RP++ Q+L
Sbjct: 231 PFDDDDE---VKTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W
            (REAL)
          Length = 1357

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 80/175 (45%), Gaps = 18/175 (10%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +    +  + E E   I  QV  G+  +H     ++HRDIK ENV++ S+G  K
Sbjct: 1189 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1246

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGV 234
            + DFGS   +   P +     +V        T  Y +PE+  LG      +  DIWA+G+
Sbjct: 1247 IIDFGSAAYVKSGPFD----VFV-------GTIDYAAPEV--LGGNPYEGQPQDIWAIGI 1293

Query: 235  FLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNI 289
             LY + +   PF    E  IL    +F N    S+    LI+  LN    +RP I
Sbjct: 1294 LLYTVVFKENPFYNIDE--ILEGDLKFNNAEGVSEDCIELIKSILNRCVPKRPTI 1346

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 94/201 (46%), Gaps = 33/201 (16%)

Query: 104 EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
           E++L++EY + G L D++  R   +L E E +    Q+ QGV+  H     + HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPE 193

Query: 164 NVLLTSRGH-YKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTA--QYRSPEMINLGK- 219
           N+LL  +    K+ DFG                   + +++ +     Y SPE++ +G+ 
Sbjct: 194 NLLLDKKNKTVKIADFGMAA------------LETTNRLLETSCGSPHYASPEIV-MGQK 240

Query: 220 --GLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HASFQFPNFPHYSDRMKS 273
             G P    SD+W+ G+ L+ L     PF       +L    H  +Q P+  + S   K 
Sbjct: 241 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPS--NVSKEAKD 294

Query: 274 LIRITLNVQPSQRPNIYQLLE 294
           LI   L V P +R  + ++LE
Sbjct: 295 LISKILVVDPEKRITVDKILE 315

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 82/181 (45%), Gaps = 18/181 (9%)

Query: 116  GLIDFMNT-RLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +    +  + E+E   +  QV   +  +H     ++HRDIK ENV++ S G  K
Sbjct: 933  GSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--NQGIVHRDIKDENVIVDSHGFVK 990

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGV 234
            L DFGS   +   P +     +V        T  Y +PE+  LG      +  DIWALGV
Sbjct: 991  LIDFGSAAYVKSGPFD----VFV-------GTMDYAAPEV--LGGSSYKGKPQDIWALGV 1037

Query: 235  FLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLE 294
             LY + Y   P+    E  IL    +F      S+    LI+  L  +  +RP I ++ E
Sbjct: 1038 LLYTIIYKENPYYNIDE--ILEGELRFDKAEKVSEGCIGLIKRILTREVDKRPTIDEIYE 1095

Query: 295  E 295
            +
Sbjct: 1096 D 1096

>ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL007C (STE20)
          Length = 971

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 115/225 (51%), Gaps = 32/225 (14%)

Query: 23  RIIKYLTSGGFAQVYTA-EISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRN 81
           R +  +  G    VYTA EI       N+S V +K++ +  +P    +  E+  MK  R+
Sbjct: 684 RNLVKIGQGASGGVYTAYEIG-----TNAS-VAIKQMNLEKQPKKELIINEILVMKGSRH 737

Query: 82  NTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQV 141
           N ++V++IDS+  K D       ++++MEY + G L D +   +   L E +I  +  + 
Sbjct: 738 N-NIVNFIDSYLLKGD-------LWVIMEYMEGGSLTDVVTHCI---LTEGQIAAVSRET 786

Query: 142 SQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDI 201
            +G+  +H+    ++HRDIK +N+LL+  G+ KL DFG  C  I   TN +  T V    
Sbjct: 787 LRGLHFLHSKG--VIHRDIKSDNILLSMDGNIKLTDFG-FCAQIN-ETNLKRTTMV---- 838

Query: 202 MKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF 246
               T  + +PE+++  +  P   K DIW+LG+ + ++     P+
Sbjct: 839 ---GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 877

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 84/176 (47%), Gaps = 20/176 (11%)

Query: 116  GLIDFMN-TRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYK 174
            G ID  +   L+  + E E   +  Q++ GV  +H     ++HRDIK ENV++ ++G  K
Sbjct: 1157 GSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGCVK 1214

Query: 175  LCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWALG 233
            L DFGS   + R P           D+   T   Y +PE++   +G P   K  DIWA+G
Sbjct: 1215 LIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVL---EGDPYEGKPQDIWAIG 1260

Query: 234  VFLYKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNI 289
            V LY + Y   PF    E  IL    +       S+   +LI + L+   S+RP +
Sbjct: 1261 VLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTV 1314

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 117/257 (45%), Gaps = 51/257 (19%)

Query: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128
           +  E+  MKLL ++ +V+S  D     ++TN     ++L++EY ++G L + +  R    
Sbjct: 66  IEREIVVMKLL-SHPNVLSLYDV----WETN---NNLYLILEYAEKGELFNLLVDR--GP 115

Query: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188
           L E E +    Q+   ++  HAL   ++HRD+K EN+LL +  + K+ DFG         
Sbjct: 116 LPEKEAVKCFRQIIIAISYCHALG--IVHRDLKPENLLLDNDYNIKIADFGMAA------ 167

Query: 189 TNPQEFTYVQHDIMKNTTA----QYRSPEMINLGKGLPINE-KSDIWALGVFLYKLCYYT 243
                   +Q D     T+     Y +PE+++   GLP     SD+W+ GV L+ L    
Sbjct: 168 --------LQTDARLLETSCGSPHYAAPEIVS---GLPYRGFASDVWSCGVILFALLTGR 216

Query: 244 TPFEKTGENA------ILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNI-------- 289
            PF++   N       +    F+ P+    S   ++LI   L V P+QR           
Sbjct: 217 LPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQNLISRILVVDPTQRMKTRDILTHPL 276

Query: 290 ---YQLLEEVSKIQNVP 303
              YQ + +   I+N+P
Sbjct: 277 LKKYQTIRDSKSIRNLP 293

>KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1551

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 133/295 (45%), Gaps = 39/295 (13%)

Query: 27   YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLN----TLRAEVDAMKLLRNN 82
            ++ SG F  VY+A    +D      I+ +K + + D  S+     +L+ E+  M++L N+
Sbjct: 1264 FIGSGSFGTVYSA--VNLDT---GDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL-NH 1317

Query: 83   THVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMS-QV 141
             ++V Y      +   NI        ME+C+   L   +      R+ +  +  + + Q+
Sbjct: 1318 PNIVQYYGVEVHRDKVNI-------FMEFCEGSSLASLLE---HGRIEDEMVTQVYTLQL 1367

Query: 142  SQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSV-----CGIIRPPTNPQEFTY 196
             +G+A +H  Q  ++HRDIK EN+LL   G  K  DFG+       G  R   +    + 
Sbjct: 1368 LEGLACLH--QSGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKST 1425

Query: 197  VQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEK-TGENAIL 255
               D++   T  Y +PE +  G+G       DIW+LG  + ++     P+     E AI+
Sbjct: 1426 GGKDMIG--TPMYMAPETVT-GQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEWAIM 1482

Query: 256  H--ASFQFPNFP---HYSDRMKSLIRITLNVQPSQRPNIYQLLEE--VSKIQNVP 303
            +  A+   P FP     S   +  I   L    ++R    +LL +  +S+I+N+ 
Sbjct: 1483 YHVAAGHLPQFPTKSEISSAGRKFISRCLIQDANKRATAMELLLDPWISQIRNIA 1537

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 127/298 (42%), Gaps = 66/298 (22%)

Query: 14  LLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEV 73
           L+ VG++  RI+K +  G F +VY A   P         V LK     DK   N +R   
Sbjct: 35  LIEVGNY--RILKQIGEGSFGKVYLALHRPT-----HRKVVLK---TSDKNDPNIVR--- 81

Query: 74  DAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENE 133
              ++  +      YI      ++  +   +V++ +EYC    L D +      R+   E
Sbjct: 82  ---EVFYHRQFDYPYI---TKVYEIIVTETKVWMALEYCPGKELYDHL--LFSKRIPIAE 133

Query: 134 ILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFG------------SV 181
             ++ +Q+   V   H+L    +HRD+K+EN+LL   G  KL DFG            +V
Sbjct: 134 CTELFAQIVGAVYYAHSLN--CVHRDLKLENILLDKHGRAKLTDFGFTRECMTRSTLETV 191

Query: 182 CGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGK--GLPINEKSDIWALGVFLYKL 239
           CG                      T  Y +PE+I      G  I    DIWALGV LY +
Sbjct: 192 CG----------------------TTVYMAPELIERKSYDGFKI----DIWALGVILYTM 225

Query: 240 CYYTTPFEKTGE-NAILHASFQFPNFPH--YSDRMKSLIRITLNVQPSQRPNIYQLLE 294
            Y   PF++  E         + P+F +   S+ +K LI+  L   P++RP I ++L+
Sbjct: 226 IYGAMPFDEDDEVKTKWKIVNEDPDFTNNISSNDVKDLIKKLLKKDPTERPTIREILK 283

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 132/280 (47%), Gaps = 38/280 (13%)

Query: 22  ARIIKYLTSGGFAQVYTA-EISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLR 80
           A ++K +  G    VYTA EI       N S V +K++ +  +P    +  E+  MK  +
Sbjct: 621 ANLVK-IGQGASGGVYTAYEIG-----TNVS-VAIKQMNLEKQPKKELIINEILVMKGSK 673

Query: 81  NNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQ 140
           +  ++V++IDS+  K D       ++++MEY + G L D +   +   L E +I  +  +
Sbjct: 674 H-PNIVNFIDSYVLKGD-------LWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRE 722

Query: 141 VSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHD 200
              G+  +H+    +LHRDIK +N+LL+  G  KL DFG  C  I    N +  T V   
Sbjct: 723 TLSGLEFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQIN-ELNLKRTTMVG-- 776

Query: 201 IMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF--EKTGENAILHAS 258
                T  + +PE+++  +  P   K DIW+LG+ + ++     P+  E       L A+
Sbjct: 777 -----TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT 828

Query: 259 FQFPNF---PHYSDRMKSLIRITLNVQPSQRPNIYQLLEE 295
              P      + S  +K  +   L V+P  R +  +LL +
Sbjct: 829 NGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHD 868

>AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YCR073C
            (SSK22) and YNR031C (SSK2)
          Length = 1483

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 129/282 (45%), Gaps = 38/282 (13%)

Query: 27   YLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLN----TLRAEVDAMKLLRNN 82
            ++  G F  VY+A    +D      I+ +K +   D+ ++     ++R E+  +++L N+
Sbjct: 1196 FIGGGSFGSVYSA--VNLD---TGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEML-NH 1249

Query: 83   THVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMS-QV 141
             +VV Y      +   NI        MEYC+ G L   +      R+ +  +  + S Q+
Sbjct: 1250 PNVVQYYGVEVHRDRVNI-------FMEYCEGGSLASLL---AHGRIEDEMVTQVYSLQM 1299

Query: 142  SQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDI 201
             +G+A +H  +  + HRDIK EN+LL   G  K  DFG+    +      ++    QH  
Sbjct: 1300 LEGLAYLH--ESGVDHRDIKPENILLDFNGIIKYVDFGAAK--VLASNGSKKLNLEQH-- 1353

Query: 202  MKN----TTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEK-TGENAILH 256
            M+      T  Y SPE I+ G G       DIW+LG  + ++     P+     + AI++
Sbjct: 1354 MEGEKMIGTPMYMSPEAIS-GTGYGKFGSDDIWSLGCVILEMVTGRRPWANLDNQWAIIY 1412

Query: 257  --ASFQFPNFPHYSDRMKSLIRI---TLNVQPSQRPNIYQLL 293
              A+ Q P FP  ++  ++ I+     L   P+QR    +LL
Sbjct: 1413 QVAAGQIPMFPSKNEMSQAGIKFLSRCLIQDPNQRSTAVELL 1454

>TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86
           YAL017W
          Length = 959

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 84/181 (46%), Gaps = 24/181 (13%)

Query: 117 LIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLC 176
           L D ++++    L E E   I  Q+   V   H L   + HRDIK +NV++ SRGH KL 
Sbjct: 794 LFDIIDSK--QELSEIEYKLIFKQIVSAVKHSHTL--GIAHRDIKEQNVIIDSRGHCKLI 849

Query: 177 DFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWALGVF 235
           DFGS             +T++   +    T  Y +PE I   + +    K  DIWALGV 
Sbjct: 850 DFGSAV-----------YTHMGPFLSFTGTIDYSAPETI---RAMAYEGKPQDIWALGVL 895

Query: 236 LYKLCYYTTPFEKTGENAILHASFQF--PNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
           LY L +   PF+   E  IL A   F  P+ P  S    +LI   L +Q   RP I  + 
Sbjct: 896 LYTLIFKQLPFKNVEE--ILEAKLNFSNPSIP-ISKECMNLIERMLELQVRNRPFIEDVY 952

Query: 294 E 294
           E
Sbjct: 953 E 953

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 72/270 (26%), Positives = 130/270 (48%), Gaps = 35/270 (12%)

Query: 31  GGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYID 90
           G    VYTA     +   N+S V +K++ +  +P    +  E+  MK  ++  ++V++ID
Sbjct: 664 GASGGVYTA----YELGTNAS-VAIKQMNLEKQPKKELIINEIMVMKGSKHR-NIVNFID 717

Query: 91  SHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHA 150
           S+  K D       ++++MEY + G L D +   +   L E +I  +  +   G+  +H+
Sbjct: 718 SYLLKGD-------LWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLAGLQFLHS 767

Query: 151 LQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYR 210
               ++HRDIK +N+LL+  G  KL DFG  C  I    N +  T V        T  + 
Sbjct: 768 KG--VIHRDIKSDNILLSMTGEIKLTDFG-FCAQIN-EINLKRTTMV-------GTPYWM 816

Query: 211 SPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF--EKTGENAILHASFQFPNFP--- 265
           +PE+++  +  P   K DIW+LG+ + ++     P+  E       L A+   P      
Sbjct: 817 APEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPD 873

Query: 266 HYSDRMKSLIRITLNVQPSQRPNIYQLLEE 295
           +  + +++ +   L V+P QR +  QLL++
Sbjct: 874 NLGEELQNFLDWCLTVEPDQRASSSQLLKD 903

>KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {ON}
           Anc_3.229 YBR028C
          Length = 502

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 98/203 (48%), Gaps = 20/203 (9%)

Query: 104 EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
           +++L+++Y   G L  F + + +  L E+ +    +++S  +  +H     +++RD+K E
Sbjct: 201 KLYLILQYIPGGEL--FFHLKERGTLDEDTVAFYAAEISVALKFLH--DNGIVYRDLKPE 256

Query: 164 NVLLTSRGHYKLCDFG-------SVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMIN 216
           N LL+ RGH  L DFG       +V        N  E  Y  H I+   T +Y +PE++ 
Sbjct: 257 NCLLSQRGHLVLTDFGLSKEAVDNVSDNESTELNSPEDIYTLHSII--GTPEYAAPEIL- 313

Query: 217 LGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH---ASFQFPNFPHY-SDRMK 272
             +GLP N+  D ++LG  L+ +     P+  T    IL+      Q P  P Y SD MK
Sbjct: 314 --QGLPYNKNCDWYSLGCLLFDMLVGKPPYTGTNHKVILNKIQKDKQGPRIPFYLSDGMK 371

Query: 273 SLIRITLNVQPSQRPNIYQLLEE 295
            ++   L    ++R ++ +   E
Sbjct: 372 DMLNWLLKKDKTKRWDVDKYWSE 394

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 132/307 (42%), Gaps = 35/307 (11%)

Query: 62  DKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFM 121
           D   +  ++ E+  +  L+  +++  Y  S+    DT++     +++ME+C  G L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLK--DTSL-----WIIMEHCAGGSLRSLL 111

Query: 122 NTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSV 181
                 ++ E  I  IM ++   +  +H     ++HRDIK  NVL+T+ G+ KLCDFG  
Sbjct: 112 R---PGKIDEKYIGVIMRELLVALKCIHKDN--VIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 182 CGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCY 241
             + +        T ++   M   T  + +PE+I   +G+  + K DIW+LG+  Y++  
Sbjct: 167 AQVNQ--------TSLRRQTMAG-TPYWMAPEVIM--EGVYYDTKVDIWSLGITTYEIAT 215

Query: 242 YTTPFEKTGENAILHASFQFPNFP------HYSDRMKSLIRITLNVQPSQRPNIYQLLEE 295
              P+      A+        + P       YS  +K  I + L+  P +R +   LL+ 
Sbjct: 216 GNPPYCDV--EALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKS 273

Query: 296 --VSKIQNVPCPIPDFYLQRKLXXXXXXXXXXDVVMNVP--IPSYPVAIPAITNNNGSYN 351
             +   +  P  I    + R L           +  ++P   PS P   P  + N G   
Sbjct: 274 KFIRAHKATPTSILKELISRYLLFRDKNKNKYKIEGSIPENEPSKPSEAPKPSQNGGGDE 333

Query: 352 YNMSIAS 358
              SIAS
Sbjct: 334 AQKSIAS 340

>ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {ON}
           some similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466W
          Length = 890

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 128/274 (46%), Gaps = 31/274 (11%)

Query: 28  LTSGGFAQVYTAEISPIDP-FINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVV 86
           L +G +++VY A +   DP  + +  VC KR I+ +   +  +  E + + LL    H  
Sbjct: 18  LGNGSYSRVYKA-VDRSDPQRVYAVKVCSKRHIIHEN-KVKYVTIEKNTLNLLARANHP- 74

Query: 87  SYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVA 146
             +  H+   D       ++ ++++   G L+  +N R+  +  E      ++Q+     
Sbjct: 75  GIVKLHSTFHDEE----NLYFVLDFAAGGELLSLLN-RV-GKFTEPCARHFIAQLIDTTE 128

Query: 147 AMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTT 206
            +H+    ++HRD+K ENVLL   G   + DFG+   I +  T     ++V        T
Sbjct: 129 FIHSQG--VIHRDLKPENVLLHRDGRLMVTDFGTATNITKENTE-GGASFV-------GT 178

Query: 207 AQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILH-----ASFQF 261
           A+Y SPE++   +       SD+WALG  LY+      PF   GEN  LH      + ++
Sbjct: 179 AEYVSPELLLYNQ---CQFASDVWALGCMLYQFIEGVPPFR--GENE-LHTFEKIVALEY 232

Query: 262 PNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEE 295
           P   +    + SL+R  L + PSQRP++  + ++
Sbjct: 233 PWANNNKGGVVSLVRRILTLDPSQRPSLTSIKQD 266

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 97/204 (47%), Gaps = 28/204 (13%)

Query: 101 GSY----EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLL 156
           GSY     ++++MEYC  G L   +      ++ E  I  IM +V   +  +H  +  ++
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLVALKCIH--KDNVI 141

Query: 157 HRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMIN 216
           HRDIK  NVL+T+ G+ KLCDFG    + +        T ++   M   T  + +PE+I 
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQVNQ--------TSLRRQTMAG-TPYWMAPEVIM 192

Query: 217 LGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFP------HYSDR 270
             +G+  + K DIW+LG+  Y++     P+ +    A+        + P       YS  
Sbjct: 193 --EGVYYDTKVDIWSLGITTYEIATGNPPYCEV--EALRAMQLIIKSKPPRLEGRSYSPS 248

Query: 271 MKSLIRITLNVQPSQRPNIYQLLE 294
           +K  I + L+  P +R +   LL+
Sbjct: 249 LKEFIALCLDEDPKERLSADDLLK 272

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 125/295 (42%), Gaps = 62/295 (21%)

Query: 14  LLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEV 73
           L  VG++  +I+K +  G F +VY A   P         VCLK     DK   N +R   
Sbjct: 35  LTEVGNY--KILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNIVR--- 81

Query: 74  DAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENE 133
              ++  +      YI      ++  +   +V++ +EYC    L D  +     R+   E
Sbjct: 82  ---EVFYHRQFDFPYI---TKLYEVIVTESKVWMALEYCPGKELYD--HLLSLRRISLLE 133

Query: 134 ILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQE 193
             ++ +Q+S  V   H++    +HRD+K+EN+LL   G+ KL DFG              
Sbjct: 134 CGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG-------------- 177

Query: 194 FTYVQHDIMKNTTAQ-------YRSPEMINLG--KGLPINEKSDIWALGVFLYKLCYYTT 244
           FT    + M  TT +       Y +PE+I      G  I    DIW+LGV LY L     
Sbjct: 178 FT---RECMTKTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGYL 230

Query: 245 PFEKTGENAILHASFQFPN-FPHYS-----DRMKSLIRITLNVQPSQRPNIYQLL 293
           PF+   E       ++  N  P Y      D  + LI   L   P +RP++ Q+L
Sbjct: 231 PFDDDDE---AKTKWKIVNEEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVL 282

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 97/197 (49%), Gaps = 27/197 (13%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           V++ +EYC    L D++   L+ R+  +E   + +Q+   V   H+LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLLTSRGHYKLCDFGSV--CGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLP 222
           +LL   G+  L DFG    C            T  Q + +  TT  Y +PE+I   +   
Sbjct: 159 ILLDKNGYAMLTDFGFTRECA-----------TKTQLETVCGTTV-YMAPELIK--REAY 204

Query: 223 INEKSDIWALGVFLYKLCYYTTPFE-----KTGENAILHASFQFPNFPHYSDRMKSLIRI 277
              K D W+LG+ LY + +   PF+     +TG   I+H      +  + S + K LI  
Sbjct: 205 DGYKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLK-IMHEEPAVLD-EYTSPQAKDLIVR 262

Query: 278 TLNVQPSQRPNIYQLLE 294
            L+   +QRPN+ ++L+
Sbjct: 263 LLDKNAAQRPNLNEVLQ 279

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 91/200 (45%), Gaps = 33/200 (16%)

Query: 104 EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
           E+FL++EY D G L D++ +R   RL E E +    Q+ +G A  H     + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLKPE 186

Query: 164 NVLLTSRG-HYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTA--QYRSPEMINLGK- 219
           N+LL  +    K+ DFG                   + +++ +     Y SPE++ +GK 
Sbjct: 187 NLLLDKKNKRIKIADFGMAA------------LQTSNKLLETSCGSPHYASPEIV-MGKN 233

Query: 220 --GLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HASFQFPNFPHYSDRMKS 273
             G P    SD+W+ G+ L+ L     PF       +L       +Q P     S   + 
Sbjct: 234 YNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--SVSSGAQD 287

Query: 274 LIRITLNVQPSQRPNIYQLL 293
           LI   L V P +R +I ++L
Sbjct: 288 LISRILVVDPDKRISINEIL 307

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 93/198 (46%), Gaps = 28/198 (14%)

Query: 104 EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
           +++++MEYC  G L   +      ++ E  +  I+  +   VA ++  +  ++HRDIK  
Sbjct: 94  KLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRNLL--VALLYIHKDNVIHRDIKAA 148

Query: 164 NVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQH--DIMKNTTAQYRSPEMINLGKGL 221
           NVL+T+ GH KLCDFG             + T   H    M   T  + +PE+I   +G+
Sbjct: 149 NVLITNGGHVKLCDFGVAA----------QLTTANHKRQTMAG-TPYWMAPEVIM--EGV 195

Query: 222 PINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFP------HYSDRMKSLI 275
             N K+DIW+LG+  Y++     P+      A+        + P      +YS  +K  I
Sbjct: 196 YYNTKADIWSLGITTYEIATGNPPYCDV--EALRAMQLITKSKPPRLEGRNYSPLLKEFI 253

Query: 276 RITLNVQPSQRPNIYQLL 293
            + L+  P  RP   +LL
Sbjct: 254 ALCLDEDPEARPTAEELL 271

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 120/255 (47%), Gaps = 41/255 (16%)

Query: 49  NSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLL 108
           NSS+V       PD  S    R E+  MKLL N+ +V+   D     ++TN     ++++
Sbjct: 61  NSSMVS----STPDSLSYGIER-EIIIMKLL-NHPNVLRLYDV----WETN---NNLYMV 107

Query: 109 MEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLT 168
           +EY ++G L + +  +    L ENE +    Q+  G++  HAL   ++HRD+K EN+LL 
Sbjct: 108 LEYAEKGELFNLLVEK--GPLPENEAIRFFRQIIIGMSYCHAL--GIVHRDLKPENILLD 163

Query: 169 SRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTA--QYRSPEMINLGKGLPINE- 225
            + + K+ DFG                  +  +++ +     Y +PE+++   GLP +  
Sbjct: 164 HKLNIKIADFGMAA------------LETEDKLLETSCGSPHYAAPEIVS---GLPYHGL 208

Query: 226 KSDIWALGVFLYKLCYYTTPFEKTGEN------AILHASFQFPNFPHYSDRMKSLIRITL 279
           ++D+W+ GV L+ L     PF++   N       +    F+ P     S   + L+   L
Sbjct: 209 ETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKIL 268

Query: 280 NVQPSQRPNIYQLLE 294
            V P +R    ++L+
Sbjct: 269 VVDPEKRIKSREILK 283

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 96/204 (47%), Gaps = 28/204 (13%)

Query: 101 GSY----EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLL 156
           GSY     +++++EYC  G L   +      ++ E  I  IM +V   +  +H     ++
Sbjct: 93  GSYLKDTTLWIIIEYCAGGSLRTLLR---PGKIDEKYIGIIMREVLIALKYIHKDN--VI 147

Query: 157 HRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMIN 216
           HRDIK  NVL+T+ GH KLCDFG    + +        + ++   M   T  + +PE+I 
Sbjct: 148 HRDIKAANVLITNEGHVKLCDFGVAAQLNQ--------SSLKRQTMAG-TPYWMAPEVIM 198

Query: 217 LGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQFPNFP------HYSDR 270
             +G+  + K DIW+LG+  Y++     P+      A+        + P      HYS  
Sbjct: 199 --EGVSYDTKVDIWSLGITTYEIATGNPPYCDV--EALRAMQLITKSKPPRLEGRHYSPM 254

Query: 271 MKSLIRITLNVQPSQRPNIYQLLE 294
           +K  I + L+  P +R +   LL+
Sbjct: 255 LKEFIALCLDEDPKERLSADDLLK 278

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 123/283 (43%), Gaps = 49/283 (17%)

Query: 31   GGFAQVYTAEISPIDPFINSSIVCLKRVIVPD--------KPSLNTLRAEVDAMKLLRNN 82
            G F  VY +            ++ +K+V VP         K  +  L++EV  +K L ++
Sbjct: 1160 GSFGAVYLSL-----NITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-DH 1213

Query: 83   THVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVS 142
             ++V Y+    ++   NI  Y +FL  EY   G +   +  RL  R  E  I  + +QV 
Sbjct: 1214 LNIVQYL---GSEIRGNI--YSLFL--EYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVL 1264

Query: 143  QGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIM 202
             G+  +H+    +LHRD+K +N+LL   G  K+ DF    GI +   N     Y   D+ 
Sbjct: 1265 SGLKYLHS--KGILHRDMKADNLLLDEDGICKISDF----GISKKSKN----IYSNSDMT 1314

Query: 203  KNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQF- 261
               T  + +PEM++  +G   + K DIW+LG  + ++     P+       ++ A FQ  
Sbjct: 1315 MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNL---EVVAAMFQIG 1369

Query: 262  -----PNFPH-----YSDRMKSLIRITLNVQPSQRPNIYQLLE 294
                 P  P       S + K  +     + P +RP    LLE
Sbjct: 1370 KSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLE 1412

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 93/193 (48%), Gaps = 21/193 (10%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           V++++EYC    L + +    + RL   E   + SQ++  V   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 165 VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPIN 224
           VLL   GH KL DFG    +          T  Q + +  TT  Y +PE+I   +     
Sbjct: 159 VLLDGNGHAKLTDFGFTREMA---------TRSQLETICGTTV-YMAPELIE--RKCYDG 206

Query: 225 EKSDIWALGVFLYKLCYYTTPFEKTGEN----AILHASFQFPNFPHYSDRMKSLIRITLN 280
            K DIW+LG+ LY +     PF++  +      I++    F N    SD    LI+  L 
Sbjct: 207 FKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDF-NQEWISDDAIDLIQGMLR 265

Query: 281 VQPSQRPNIYQLL 293
             P++R ++ Q+L
Sbjct: 266 KNPNERISLAQVL 278

>YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protein
           ser/thr kinase required for vesicle formation in
           autophagy and the cytoplasm-to-vacuole targeting (Cvt)
           pathway; structurally required for phagophore assembly
           site formation; during autophagy forms a complex with
           Atg13p and Atg17p
          Length = 897

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 75/314 (23%), Positives = 135/314 (42%), Gaps = 59/314 (18%)

Query: 14  LLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEV 73
           + S G++ A   K +  G FA VY   ++  D   + +I  + R  + +K  L  L  E+
Sbjct: 18  MASAGNYTAE--KEIGKGSFATVYRGHLTS-DKSQHVAIKEVSRAKLKNKKLLENLEIEI 74

Query: 74  DAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQ------- 126
             +K +++  H+V  ID      D        +L+MEYC  G L   +  R +       
Sbjct: 75  AILKKIKH-PHIVGLIDCERTSTD-------FYLIMEYCALGDLTFLLKRRKELMENHPL 126

Query: 127 ---------------NRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTS-- 169
                          N LH   +L  + Q++  +  + +    L+HRDIK +N+LL++  
Sbjct: 127 LRTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRS--KNLVHRDIKPQNLLLSTPL 184

Query: 170 RGHYKLCDFGSV--CGIIRPPT-NPQEFTYVQHDIMKNTTAQ--------YRSPEMINLG 218
            G++    F  +   GI   P     +F + +   + NT+          Y +PE++N  
Sbjct: 185 IGYHDSKSFHELGFVGIYNLPILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILNYQ 242

Query: 219 KGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL------HASFQFPNFPHYSDRMK 272
           K    N K+D+W++G  ++++C  T PF  +    +       +    FP++ +    +K
Sbjct: 243 K---YNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELK 299

Query: 273 SLIRITLNVQPSQR 286
            LI   L   P+QR
Sbjct: 300 ELICSLLTFDPAQR 313

>Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON}
           similar to Ashbya gossypii ADR167W
          Length = 896

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 85/194 (43%), Gaps = 27/194 (13%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           ++L MEYC  G     + TR    + E++     S+V+  +  +H +    ++RD+K EN
Sbjct: 555 LYLCMEYCMGGEFFRALQTRKTKCISEDDARFYASEVTAALEYLHLMG--FIYRDLKPEN 612

Query: 165 VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKN-------------TTAQYRS 211
           +LL   GH  L DF  +    + P NPQ     Q  ++                T +Y +
Sbjct: 613 ILLHQSGHIMLSDF-DLSVQAKGPRNPQVKGNAQSSLVDTKICSDGFRTNSFVGTEEYIA 671

Query: 212 PEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENA------ILHASFQFPNFP 265
           PE+I   +G       D W LG+  Y++ +  TPF+  GEN       IL     FPN  
Sbjct: 672 PEVI---RGNGHTASVDWWTLGILTYEMLFGFTPFK--GENTNQTFSNILKVEATFPNNN 726

Query: 266 HYSDRMKSLIRITL 279
             S   K LI+  L
Sbjct: 727 EISRTCKDLIKKLL 740

>KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.192
           YGR052W
          Length = 438

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 109/234 (46%), Gaps = 39/234 (16%)

Query: 25  IKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNTLRAEVDAMKLLRNNTH 84
           IK L +G F+ VY A  S  + +     V LK V+  DK S   +  E+  M+ L  NTH
Sbjct: 11  IKKLQTGTFSTVYKAWSSERNEY-----VALK-VMPKDKISEEAMLNEIKVMQKL-GNTH 63

Query: 85  --VVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQN------RLHENEILD 136
             + S +  H    D +       L ++YC+ G + DF++   Q        L + +  +
Sbjct: 64  PNICSMLSFHE---DESC----CILELQYCECGDMYDFLDIAKQQGDPVSPSLLQLDFQN 116

Query: 137 IMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTY 196
           I++Q+   V   H+L   + HRDIK ENVLLT  G+ KL D+G   G     +   EF  
Sbjct: 117 IVNQLFSAVQYAHSL--GIAHRDIKPENVLLTKEGNVKLADWGH--GTF--DSRSYEFNI 170

Query: 197 VQHDIMKNTTAQYRSPEMINLGKGL-PINEKSDIWALGVFLYKLCYYTTPFEKT 249
                    T  YRSPE      G  P+   +D W++GV L  L + TTPF+  
Sbjct: 171 --------GTDHYRSPETFYSEDGYDPV--LADYWSVGVTLLFLIFGTTPFKSA 214

>AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YJL095W (BCK1)
          Length = 1423

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 119/281 (42%), Gaps = 47/281 (16%)

Query: 31   GGFAQVYTAEISPIDPFINSSIVCLKRVIVP-----DKPSLNTLRAEVDAMKLLRNNTH- 84
            G F  VY              ++ +K+V VP     D+ ++N   A +  +  L++  H 
Sbjct: 1133 GSFGAVYLGL-----NVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDHL 1187

Query: 85   -VVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQ 143
             +V Y+      F+     Y +FL  EY   G +   +  RL     E  I  + +QV +
Sbjct: 1188 NIVQYLG-----FENKNCIYSLFL--EYVAGGSVGSLI--RLYGHFDEQLIRFLTTQVLE 1238

Query: 144  GVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMK 203
            G+A +H     +LHRD+K +N+LL + G  K+ DF    GI R   N     Y   ++  
Sbjct: 1239 GLAYLHLRG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNN----IYSNSEMTM 1288

Query: 204  NTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAILHASFQF-- 261
              T  + +PEM++  +G   + K DIW+LG  + ++     P+       ++ A FQ   
Sbjct: 1289 RGTVFWMAPEMVDTTQGY--SAKVDIWSLGCVVLEMFAGKRPWSNL---EVVAAMFQIGK 1343

Query: 262  ---------PNFPHYSDRMKSLIRITLNVQPSQRPNIYQLL 293
                        PH S   ++ +     + P +RP    LL
Sbjct: 1344 SKSAPPIPEDTLPHISQDGRAFLDDCFMIDPEERPTADTLL 1384

>Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C
           (REAL)
          Length = 511

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 105/230 (45%), Gaps = 33/230 (14%)

Query: 81  NNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGL-IDFMNT-RLQNRLHENEILDIM 138
           N +   +YI  +   F T+  S  +++ MEY     L   + N  R   R+ E  I  I 
Sbjct: 270 NKSFKSNYIVQYYGMF-TDEQSSSIYIAMEYMGGRSLEATYKNLLRRGGRISERVIGKIA 328

Query: 139 SQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQ 198
             V +G++ +H  +  ++HRDIK +N+LL  +G  KLCDFG V G      N    T+  
Sbjct: 329 ESVLRGLSYLH--ERKIIHRDIKPQNILLNEKGEVKLCDFG-VSG---EAVNSLAMTFT- 381

Query: 199 HDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPF--EKTGENA--- 253
                  T+ Y +PE I   +G P +   D+W+LG+ L ++     PF  EK  +N    
Sbjct: 382 ------GTSFYMAPERI---QGQPYSVTCDVWSLGLTLLEVAGGKFPFKSEKITQNVAPI 432

Query: 254 -----ILHASFQFPNFPH----YSDRMKSLIRITLNVQPSQRPNIYQLLE 294
                IL  S    + P     +S   KS I   L    S+RP+  Q+L+
Sbjct: 433 ELLTMILTFSPHLKDEPELDICWSKTFKSFIEYCLKKDASERPSPRQMLK 482

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 87/179 (48%), Gaps = 23/179 (12%)

Query: 117 LIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLC 176
           L DF+  +  +++ E E   I  Q+  G+  +H L   ++HRDIK EN+++ S G  ++ 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 177 DFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEK-SDIWALGVF 235
           DFGS       P   Q F         + T  Y SPE++   KG P   K  D+WALG+ 
Sbjct: 822 DFGSAAYATNGPF--QVF---------HGTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 236 LYKLCYYTTPFEKTGENAILHASFQF--PNFPHYSDRMKSLIRITLNVQPSQRPNIYQL 292
           LY + +  TPF    E  I+    +    +  + SD+ + LI   L+ +   RP I ++
Sbjct: 868 LYIITFKQTPFNSVAE--IIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 96/198 (48%), Gaps = 25/198 (12%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           ++ L+EY   G  +  M  +    L+E+      +Q+   +  +H+    ++HRDIK EN
Sbjct: 241 LYFLLEYAPNGDFLSIM--KKYGSLNEDCACYYSAQIIDAIDFLHS--KGIVHRDIKPEN 296

Query: 165 VLLTSRGHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNT-----TAQYRSPEMINLGK 219
           +LL      KL DFG+   I+ P  N    T   +D++  +     TA+Y SPE++N   
Sbjct: 297 ILLDKDFKVKLTDFGT-AKILEPKPN----TTDSYDLLSRSKSFVGTAEYVSPELLNDNY 351

Query: 220 GLPINEKSDIWALGVFLYKLCYYTTPFEKTGE----NAILHASFQF-PNFPHYSDRMKSL 274
              ++ + DIWA G  L+++     PF+ T E      ++   + F   FP     ++ L
Sbjct: 352 ---VDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV---VRDL 405

Query: 275 IRITLNVQPSQRPNIYQL 292
           ++  L  QP+QR  I Q+
Sbjct: 406 VKGILIKQPAQRLTIPQI 423

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 92/198 (46%), Gaps = 29/198 (14%)

Query: 104 EVFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIE 163
           E+FL++EY D G L D++ +R   +L E E +    Q+ +GV+  H+    + HRD+K E
Sbjct: 193 ELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSFN--ICHRDLKPE 248

Query: 164 NVLLTSR-GHYKLCDFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGK--- 219
           N+LL  +    K+ DFG     +     P +       +    +  Y SPE++ +GK   
Sbjct: 249 NLLLDKKINTIKIADFGMAALEL-----PNKLL-----VTSCGSPHYASPEIV-MGKSYH 297

Query: 220 GLPINEKSDIWALGVFLYKLCYYTTPFEKTGENAIL----HASFQFPNFPHYSDRMKSLI 275
           G P    SD+W+ G+ L+ L     PF       +L       FQ P   + S   + LI
Sbjct: 298 GSP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMPQ--NISLEAEDLI 351

Query: 276 RITLNVQPSQRPNIYQLL 293
              L V P +R  I  +L
Sbjct: 352 SRILVVDPEKRIQINDIL 369

>KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {ON}
           Anc_6.371 YCR091W
          Length = 908

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 84/198 (42%), Gaps = 21/198 (10%)

Query: 105 VFLLMEYCDRGGLIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIEN 164
           ++L MEYC  G     + TR    + E +     S+V   +  +H L    ++RD+K EN
Sbjct: 569 LYLCMEYCLGGEFFRALQTRQTKCICEEDARFYTSEVIAALEYLHLLG--FIYRDLKPEN 626

Query: 165 VLLTSRGHYKLCDFG----SVCGIIRPPTNPQEFTYVQHDIMKN--------TTAQYRSP 212
           +LL   GH  L DF     +V     P     + + +   +  +         T +Y SP
Sbjct: 627 ILLHRSGHIMLSDFDLSIQAVTNTKSPVVTTAQKSLIDTKVFSDGFRTNSFVGTEEYISP 686

Query: 213 EMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEKTGENA----ILHASFQFPNFPHYS 268
           E+I   KG       D W LG+ LY++ Y  TPF+          IL     FPN    S
Sbjct: 687 EVI---KGNGHTAAVDWWTLGILLYEMLYGFTPFKGNDTKETFVHILKKDVTFPNSNDVS 743

Query: 269 DRMKSLIRITLNVQPSQR 286
              K L++  LN   S+R
Sbjct: 744 RTCKDLMKKLLNKNESKR 761

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,792,439
Number of extensions: 2754995
Number of successful extensions: 16846
Number of sequences better than 10.0: 1926
Number of HSP's gapped: 16129
Number of HSP's successfully gapped: 1972
Length of query: 621
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 505
Effective length of database: 40,180,143
Effective search space: 20290972215
Effective search space used: 20290972215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)