Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0G006302.283ON39739719670.0
NCAS0G038702.283ON38934112751e-175
Smik_14.2962.283ON38936012711e-174
Skud_14.2982.283ON38934912661e-174
YNL035C2.283ON38934912591e-173
Suva_14.3112.283ON38934112431e-170
KAFR0H033402.283ON36733811921e-163
KNAG0H020402.283ON39934811901e-162
ZYRO0A01804g2.283ON37634411841e-162
Kpol_1003.342.283ON38834811711e-159
KLTH0G10296g2.283ON42633811741e-159
TDEL0G021402.283ON39234111581e-157
Kwal_27.115502.283ON40733811501e-156
TBLA0B059202.283ON40335311471e-155
SAKL0E07766g2.283ON39833811351e-154
KLLA0E08449g2.283ON42232811371e-154
TPHA0C033702.283ON41336110791e-145
Ecym_33212.283ON40935710781e-145
ADL218C2.283ON40333810661e-143
CAGL0G01628g2.283ON37633910491e-141
KLTH0C11550g6.9ON3981291426e-09
ACR017W6.9ON4231831283e-07
KNAG0E009806.9ON4141931213e-06
ZYRO0F00462g6.9ON3932021203e-06
Kwal_27.120708.548ON418561194e-06
KLLA0D00814g6.9ON4082061194e-06
Suva_5.126.9ON4012001185e-06
KLTH0E12694g8.548ON418561177e-06
Kpol_1041.202.401ON5152081178e-06
Skud_5.336.9ON4011981132e-05
TBLA0A071206.9ON4071761097e-05
Kpol_1045.786.9ON3921111071e-04
NDAI0K029006.9ON4381981061e-04
Suva_13.3112.401ON5101881062e-04
Ecym_30126.9ON3972001052e-04
Kpol_487.71.399ON3031691042e-04
YEL056W (HAT2)6.9ON4011341043e-04
KAFR0L003206.9ON3911931043e-04
Ecym_70428.548ON414601033e-04
CAGL0B03575g6.9ON4191291033e-04
KLTH0D05346g2.469ON5071111034e-04
SAKL0E00814g6.9ON3982081007e-04
NCAS0F019702.401ON5111901018e-04
TBLA0B092502.401ON5261841009e-04
Skud_13.2912.401ON5091861000.001
YMR131C (RRB1)2.401ON511186990.001
Smik_13.3292.401ON509186990.001
TPHA0G026502.401ON516202990.001
ZYRO0A08690g2.401ON516186980.002
TDEL0G033402.401ON514205970.002
Kwal_26.77362.469ON507111970.002
Smik_5.316.9ON427149970.002
KNAG0F038707.534ON465107970.002
TBLA0H036508.548ON419187960.002
Kwal_55.220763.22ON128659960.003
AEL250C8.548ON417173950.003
ADR242C2.401ON521204950.003
NDAI0H027502.401ON512202940.004
SAKL0H09900g8.548ON425168940.005
CAGL0K03861g2.401ON513186940.006
Skud_16.4827.534ON465117930.006
CAGL0G04345g1.247ON71178920.009
CAGL0A00561g4.119ON41251910.011
TBLA0H030601.247ON73066900.016
KLLA0F17237g2.401ON523193890.018
KLLA0E23541g8.548ON417169890.021
Kpol_1048.598.544ON850169890.025
KAFR0B003707.534ON46154870.033
KLLA0E07085g3.25ON45270860.039
Kpol_1013.377.534ON468157860.047
Kwal_27.122398.585ON31654850.047
Ecym_60672.401ON522186860.048
Sklu_YGOB_Anc_2.4012.401ON520203860.049
Skud_7.5615.104ON59362860.051
Skud_2.3218.548ON422179850.052
KLTH0F19338g3.22ON1290121860.053
Kwal_56.223456.9ON39668850.054
SAKL0H08932g8.585ON314114850.056
KAFR0A003802.401ON516190850.057
SAKL0C13332g3.22ON135359860.058
TPHA0M001906.9ON391194850.062
Kwal_47.173108.133ON55373840.080
KLLA0E04819g7.534ON459152840.081
NCAS0G011206.276ON494200840.083
YPR178W (PRP4)7.534ON465121840.085
KLTH0E13552g8.585ON31654830.085
Suva_16.5107.534ON465112830.090
KLTH0G12276g8.324ON93732840.100
NDAI0D006307.338ON30080820.11
YKR036C (CAF4)1.247ON643125830.12
KAFR0A064804.122ON568125820.16
Smik_7.1431.92ON28377800.17
Kwal_47.178272.401ON523190810.17
TPHA0J025406.239ON866165810.20
KLLA0F21406g1.247ON705133810.21
ADL186C3.22ON136159810.23
CAGL0H08932g6.239ON902161810.24
KLTH0E09394g2.401ON522222800.26
KAFR0F033404.119ON40946800.26
TDEL0H003707.534ON465107800.26
Skud_11.2711.247ON64672800.27
YGR225W (AMA1)5.104ON59362790.29
KNAG0E021802.401ON517188790.30
TPHA0B011201.247ON71964800.30
Suva_7.5185.104ON59362790.31
Smik_16.4427.534ON470117790.33
Suva_7.519na 1ON20570770.33
Kpol_1016.111.247ON66998790.33
Smik_16.795.104ON59362790.35
Ecym_20243.22ON131759790.38
Kpol_1038.203.22ON131354790.39
Kwal_26.87008.651ON38154780.40
KLLA0F19734g8.288ON113357790.41
ZYRO0F11484g7.338ON29483770.47
CAGL0J01265g2.469ON517110770.51
Kwal_56.239208.324ON93732780.52
Suva_10.3168.435ON818163770.56
ZYRO0D06556g8.288ON114753770.61
Kpol_467.202.469ON581140770.62
KLTH0D10648g8.651ON44954760.71
NCAS0I024903.95ON62644760.73
KAFR0L015207.356ON584113760.73
NDAI0C057708.585ON33554750.77
Skud_12.2858.435ON817149760.78
Suva_6.1871.247ON71472760.78
Ecym_42558.324ON93732760.83
KLLA0E20967g3.22ON132159760.83
TPHA0A003803.22ON131054760.84
NDAI0G033108.67ON885205760.88
TDEL0D013101.247ON709113760.88
Skud_10.1021.247ON70872760.90
KAFR0A006902.469ON508120750.94
CAGL0G03399g7.405ON369112741.0
KAFR0F025901.247ON70064751.0
NDAI0B051901.247ON668145751.1
ZYRO0G10406g4.119ON39137741.1
TDEL0C020807.338ON29480741.1
TDEL0B020108.435ON805126751.1
Smik_2.3358.548ON422179741.2
Suva_10.3027.338ON29780741.2
CAGL0G09845g7.534ON500107741.2
TBLA0C039904.123ON437196741.2
Skud_12.2727.338ON29780731.2
Ecym_71055.201ON48471741.3
NCAS0B078401.247ON589115741.3
Suva_4.4498.548ON424175741.3
TBLA0B043908.585ON33654731.3
YLR208W (SEC13)7.338ON29780731.3
TDEL0G046206.9ON392184741.3
TPHA0D035906.276ON59872741.4
Kpol_1041.354.77ON70198741.4
Kpol_530.257.356ON57464741.4
KLLA0E19515g7.356ON57277741.5
NCAS0A151707.534ON47454731.5
KLTH0G13068g8.288ON110136741.5
KAFR0B055808.288ON112055741.6
Kpol_530.397.338ON29480721.6
Suva_16.606.276ON52652731.7
KNAG0E024702.469ON509167731.7
Smik_12.2667.338ON29780721.7
TDEL0A024502.469ON510111731.7
Kpol_1045.337.405ON361112731.7
KNAG0F018406.239ON911161731.8
NDAI0J011808.288ON113455731.8
NCAS0B088801.37ON65981731.9
Smik_12.2798.435ON817163731.9
YLR222C (UTP13)8.435ON817163731.9
AGR180W8.435ON806208731.9
ZYRO0D03828g1.247ON72664732.1
Kwal_56.236858.288ON110239732.1
Kwal_27.9955singletonOFF13263692.1
TPHA0D005808.67ON732151722.2
YJL112W (MDV1)1.247ON71472722.2
NCAS0D046106.340ON515101722.2
Suva_2.2918.288ON115164722.3
Kwal_27.115858.435ON823177722.3
SAKL0H15532g8.324ON94132722.3
TBLA0F024007.338ON298149712.4
TDEL0A068906.276ON44753722.4
TPHA0D045307.338ON294118712.5
AGL196C8.324ON93536722.5
NCAS0F001906.9ON411102712.5
KAFR0A069906.239ON885163722.6
TPHA0F030307.356ON582114722.6
SAKL0F11506g7.356ON568110712.7
ZYRO0F14960g8.585ON31956712.8
Kwal_56.245777.333ON508121712.8
ZYRO0E07392g6.239ON897162712.9
NDAI0G025808.324ON95832712.9
TBLA0A060606.239ON888213713.4
NDAI0I021805.201ON479139703.4
NDAI0E034408.435ON857118713.4
TDEL0F045008.324ON93832713.5
CAGL0J08778g7.338ON29879703.5
NDAI0B017107.180ON45453703.6
TDEL0F041508.288ON113453713.6
Skud_7.4674.77ON70885703.7
Skud_4.3898.288ON115166713.7
NCAS0C032608.324ON98332713.7
KNAG0I010508.288ON115954713.7
ZYRO0A13068g8.548ON39754703.8
NCAS0H007007.338ON29780693.8
NCAS0C027108.435ON81580703.9
TBLA0D055601.247ON589115703.9
TDEL0C019207.356ON563111704.0
AFL157C6.276ON43898704.0
Smik_6.2484.77ON70785704.1
CAGL0M08646g5.631ON337173694.1
NCAS0A078602.469ON510106704.3
KNAG0D034604.119ON41254694.3
KLTH0E15576g1.247ON72397704.3
YLR196W (PWP1)7.356ON57676704.4
KNAG0C014101.247ON65376704.5
NCAS0B021708.548ON41478694.6
AGR207C8.585ON32048694.6
Smik_10.1261.247ON71242694.9
Kpol_1011.68.67ON762215695.0
AEL314W1.247ON715106695.0
ZYRO0E08184g6.276ON506122695.0
Smik_4.3748.288ON115266705.1
NCAS0B036908.288ON114553695.2
Smik_7.1896.176ON1115193695.2
NDAI0D047304.309ON661134695.3
TPHA0L016908.544ON832109695.3
TDEL0C023607.310ON1264167695.3
KAFR0L014407.338ON30480685.4
Suva_4.4278.585ON31548685.5
SAKL0H12760g8.435ON841114695.5
Kpol_1060.246.276ON486181695.6
TDEL0F022604.119ON42959695.6
Ecym_42808.288ON113232695.6
NDAI0F012406.276ON52452695.6
Smik_12.2567.356ON57664695.7
TBLA0A090704.119ON388124685.8
Kwal_27.111246.176ON112963695.8
Skud_12.2617.356ON58064695.9
Skud_16.326.276ON52252695.9
Smik_6.4516.276ON52352696.0
YGR145W (ENP2)4.77ON70785696.2
Ecym_70788.585ON31349686.4
TPHA0G025002.450ON945130686.9
Kwal_56.244787.310ON129646687.0
KAFR0I006408.585ON31556677.0
TPHA0G018908.626ON89185687.1
TDEL0C009408.67ON640184687.3
YBR175W (SWD3)8.585ON31548677.3
TPHA0G029402.450ON91875687.3
KLTH0H02134g7.310ON129965687.5
Ecym_21396.276ON43596687.5
TDEL0E019605.429ON45248677.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0G00630
         (397 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...   762   0.0  
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283    495   e-175
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...   494   e-174
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...   492   e-174
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...   489   e-173
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...   483   e-170
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...   463   e-163
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...   462   e-162
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...   460   e-162
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...   455   e-159
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...   456   e-159
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...   450   e-157
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...   447   e-156
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...   446   e-155
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...   441   e-154
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...   442   e-154
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...   420   e-145
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...   419   e-145
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...   415   e-143
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...   408   e-141
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    59   6e-09
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    54   3e-07
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    51   3e-06
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    51   3e-06
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    50   4e-06
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    50   4e-06
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    50   5e-06
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    50   7e-06
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    50   8e-06
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    48   2e-05
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    47   7e-05
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    46   1e-04
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      45   1e-04
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    45   2e-04
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    45   2e-04
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    45   2e-04
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    45   3e-04
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    45   3e-04
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    44   3e-04
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    44   3e-04
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    44   4e-04
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    43   7e-04
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    44   8e-04
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    43   9e-04
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    43   0.001
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    43   0.001
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    43   0.001
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    43   0.001
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    42   0.002
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    42   0.002
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    42   0.002
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    42   0.002
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    42   0.002
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    42   0.002
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    42   0.003
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    41   0.003
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    41   0.003
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    41   0.004
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    41   0.005
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    41   0.006
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    40   0.006
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    40   0.009
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    40   0.011
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    39   0.016
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    39   0.018
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    39   0.021
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    39   0.025
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    38   0.033
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    38   0.039
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    38   0.047
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    37   0.047
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    38   0.048
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    38   0.049
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    38   0.051
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    37   0.052
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    38   0.053
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    37   0.054
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    37   0.056
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    37   0.057
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    38   0.058
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    37   0.062
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    37   0.080
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    37   0.081
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    37   0.083
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    37   0.085
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    37   0.085
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    37   0.090
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    37   0.100
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    36   0.11 
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    37   0.12 
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    36   0.16 
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    35   0.17 
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    36   0.17 
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    36   0.20 
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    36   0.21 
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    36   0.23 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    36   0.24 
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    35   0.26 
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    35   0.26 
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    35   0.26 
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    35   0.27 
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    35   0.29 
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    35   0.30 
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    35   0.30 
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    35   0.31 
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    35   0.33 
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    34   0.33 
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    35   0.33 
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    35   0.35 
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    35   0.38 
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    35   0.39 
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    35   0.40 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    35   0.41 
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    34   0.47 
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    34   0.51 
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    35   0.52 
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    34   0.56 
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    34   0.61 
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    34   0.62 
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    34   0.71 
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    34   0.73 
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    34   0.73 
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    33   0.77 
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    34   0.78 
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    34   0.78 
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    34   0.83 
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    34   0.83 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    34   0.84 
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    34   0.88 
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    34   0.88 
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    34   0.90 
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    33   0.94 
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    33   1.0  
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    33   1.0  
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    33   1.1  
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    33   1.1  
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    33   1.1  
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    33   1.1  
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    33   1.2  
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    33   1.2  
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    33   1.2  
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    33   1.2  
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    33   1.2  
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    33   1.3  
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    33   1.3  
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    33   1.3  
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    33   1.3  
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    33   1.3  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    33   1.3  
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    33   1.4  
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    33   1.4  
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    33   1.4  
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    33   1.5  
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    33   1.5  
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    33   1.5  
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    33   1.6  
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    32   1.6  
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    33   1.7  
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    33   1.7  
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    32   1.7  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    33   1.7  
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    33   1.7  
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    33   1.8  
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    33   1.8  
NCAS0B08880 Chr2 complement(1703601..1705580) [1980 bp, 659 aa] ...    33   1.9  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    33   1.9  
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    33   1.9  
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    33   1.9  
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    33   2.1  
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    33   2.1  
Kwal_27.9955 s27 (136001..136399) [399 bp, 132 aa] {OFF} [contig...    31   2.1  
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    32   2.2  
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    32   2.2  
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     32   2.2  
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    32   2.3  
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    32   2.3  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    32   2.3  
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    32   2.4  
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    32   2.4  
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    32   2.5  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    32   2.5  
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    32   2.5  
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    32   2.6  
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    32   2.6  
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    32   2.7  
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    32   2.8  
Kwal_56.24577 s56 complement(1061240..1062766) [1527 bp, 508 aa]...    32   2.8  
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    32   2.9  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    32   2.9  
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    32   3.4  
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    32   3.4  
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    32   3.4  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    32   3.5  
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    32   3.5  
NDAI0B01710 Chr2 (407575..408939) [1365 bp, 454 aa] {ON} Anc_7.1...    32   3.6  
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    32   3.6  
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    32   3.7  
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    32   3.7  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    32   3.7  
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    32   3.7  
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    32   3.8  
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    31   3.8  
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    32   3.9  
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    32   3.9  
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    32   4.0  
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    32   4.0  
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    32   4.1  
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    31   4.1  
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    32   4.3  
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    31   4.3  
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    32   4.3  
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    32   4.4  
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    32   4.5  
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    31   4.6  
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    31   4.6  
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    31   4.9  
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    31   5.0  
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    31   5.0  
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    31   5.0  
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    32   5.1  
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    31   5.2  
Smik_7.189 Chr7 complement(325444..328791) [3348 bp, 1115 aa] {O...    31   5.2  
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    31   5.3  
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    31   5.3  
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    31   5.3  
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    31   5.4  
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    31   5.5  
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    31   5.5  
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    31   5.6  
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    31   5.6  
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    31   5.6  
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    31   5.6  
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    31   5.7  
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    31   5.8  
Kwal_27.11124 s27 complement(647446..650835) [3390 bp, 1129 aa] ...    31   5.8  
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    31   5.9  
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    31   5.9  
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    31   6.0  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    31   6.2  
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    31   6.4  
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    31   6.9  
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    31   7.0  
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    30   7.0  
TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.6...    31   7.1  
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    31   7.3  
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    30   7.3  
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    31   7.3  
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    31   7.5  
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    31   7.5  
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    30   7.7  
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    30   7.9  
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    30   7.9  
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    31   8.0  
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    30   8.1  
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    31   8.1  
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    30   8.2  
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    31   8.4  
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    30   8.5  
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    30   8.6  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    30   8.7  
ZYRO0G21802g Chr7 (1794478..1795557) [1080 bp, 359 aa] {ON} simi...    30   8.9  
ACR085C Chr3 complement(508364..511228) [2865 bp, 954 aa] {ON} N...    30   8.9  
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    30   9.0  
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    30   9.3  
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    30   9.4  
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    30   9.7  
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    30   9.7  
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    30   9.8  
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      30   9.9  
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    30   10.0 

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/397 (93%), Positives = 373/397 (93%)

Query: 1   MSISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNL 60
           MSISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNL
Sbjct: 1   MSISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNL 60

Query: 61  SINDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLA 120
           SINDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLA
Sbjct: 61  SINDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLA 120

Query: 121 MGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVY 180
           MGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVY
Sbjct: 121 MGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVY 180

Query: 181 DLTQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDF 240
           DLTQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDF
Sbjct: 181 DLTQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDF 240

Query: 241 GDVREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIR 300
           GDVREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIR
Sbjct: 241 GDVREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIR 300

Query: 301 DVFIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLDGDFSLESGNEV 360
           DVFIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLDGDFSLESGNEV
Sbjct: 301 DVFIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLDGDFSLESGNEV 360

Query: 361 EKSKLGVXXXXXXXXXXXXXXXXXXXXXXXXQRFKPY 397
           EKSKLGV                        QRFKPY
Sbjct: 361 EKSKLGVEKREKSKKSKSKKSKKKEKKHSKSQRFKPY 397

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score =  495 bits (1275), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 238/341 (69%), Positives = 277/341 (81%), Gaps = 2/341 (0%)

Query: 4   SPYSLLNSHSFGSNNWCFKFQPLDKAN-GLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62
           S YSL+NS SFGSNNW  K QPL   N GLL SLSNGE+H LD  T  + Q   +S  SI
Sbjct: 3   SSYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62

Query: 63  NDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122
           NDL+++N +     LF+TAT+ SVKIFDI+S    +AT+H+  NVPF SLDSRHGLLA G
Sbjct: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTK-EVATIHSQGNVPFPSLDSRHGLLACG 121

Query: 123 TELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           TEL+GVDA I IYDIRKWD P+RSL+DSHHDDVT LK+HP+DP +LLSGSTDGYTNVYDL
Sbjct: 122 TELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL 181

Query: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGD 242
           ++ +E+D+LHQV+N+ASIHSCGWLSP RIFTLSHMETFAIHELNDKS+ LKEPQP+D GD
Sbjct: 182 SEAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGD 241

Query: 243 VREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDV 302
           VREKWGCDYV+DVYPG+IA GKSQE  G+LKLIP   E I + +S+VIP AH DEVIRDV
Sbjct: 242 VREKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDV 301

Query: 303 FIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKR 343
           +IP   S ++Y+CGEDG V LWKNNNG LNVPEQ WDYSKR
Sbjct: 302 YIPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKR 342

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  494 bits (1271), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/360 (65%), Positives = 290/360 (80%), Gaps = 4/360 (1%)

Query: 3   ISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62
           ++ YSL+ S+ FGS NWC K QP  K +GLL  LSNGEI  LD+ TC+S Q+I+ S  +I
Sbjct: 1   MASYSLVESNFFGSENWCLKLQPSYK-HGLLTGLSNGEIRLLDWATCKSLQNIKASETAI 59

Query: 63  NDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122
           NDLK+++SDF  G L S+A+ ++VK+FDI +N+  IAT+ N+ N PFLSLDSRHGLLA G
Sbjct: 60  NDLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSC-IATIQNESNSPFLSLDSRHGLLACG 118

Query: 123 TELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           TELQG+DA ++IYDIRKWDTPLRSLIDSHHDDVT +KFHPSD  +LLSGSTDGYTN+YDL
Sbjct: 119 TELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178

Query: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGD 242
            Q +E+DALHQV+NYASIHSCGWLSP RI+TLSHMETFAIHELNDKS+EL+EPQPLDFGD
Sbjct: 179 KQDEEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGD 238

Query: 243 VREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDV 302
           VR+ W CDYV+D+YPG IA GK+QE  G+L+LIP   E I  +   VIP AHGDEV+RD+
Sbjct: 239 VRKAWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDI 298

Query: 303 FIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLDGDFSLESGNEVEK 362
           FI    S+++YSCGEDG+V +WK+  G LN PE FWDYS++ M+VL GD S E+   +E+
Sbjct: 299 FISAHQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEK-MNVL-GDDSKEAFTNLEE 356

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  492 bits (1266), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/349 (66%), Positives = 280/349 (80%), Gaps = 3/349 (0%)

Query: 3   ISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62
           +S YSL+ S+SFGS NWC K QP  K  GLL  LSNGEI  LD+ + QS Q I+ S  SI
Sbjct: 1   MSSYSLVESNSFGSENWCLKLQPSYKY-GLLTGLSNGEIRLLDWNSGQSLQKIKASETSI 59

Query: 63  NDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122
           NDLK+++SDF  G L S+A+ ++VK+FDI +N   +A +HN+ N PF+SLDSRHGLLA G
Sbjct: 60  NDLKVIDSDFAAGHLVSSASIDAVKVFDIRTN-ACVAKIHNEANSPFISLDSRHGLLACG 118

Query: 123 TELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           TELQG+DA + IYDIR+WD PLRS+IDSHHDDVT +KFHPSD  VLLSGSTDGYTN+YDL
Sbjct: 119 TELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178

Query: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGD 242
            Q +E+DALHQV+NYASIHSCGWLS  RI+TLSHMETFAIHELNDKS+E KEP+P DFGD
Sbjct: 179 KQDEEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGD 238

Query: 243 VREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDV 302
           +RE W CDYV+DVYPG IA GK+QEG G+L+L+P   E +  ++ +VIP AHGDEV+RDV
Sbjct: 239 IREAWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDV 298

Query: 303 FIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLDGD 351
           FI    S+L+YSCGEDGFV +WKNN G LN PE FWDYS++ ++VLD D
Sbjct: 299 FISALQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEK-LNVLDED 346

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score =  489 bits (1259), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 231/349 (66%), Positives = 281/349 (80%), Gaps = 3/349 (0%)

Query: 3   ISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62
           ++ YSL+ S+SFGS NWC K QP  K +GLL  LSNGEI  LD+ T +S Q I+ S  +I
Sbjct: 1   MASYSLVESNSFGSENWCLKLQPSYK-HGLLTGLSNGEIRLLDWSTGKSVQKIKASETAI 59

Query: 63  NDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122
           ND+K++ SDF  G L S+A+ ++VK+FDI +N+  IA + N+ N PF+SLDSRHGLLA G
Sbjct: 60  NDMKVIGSDFSAGHLVSSASIDAVKVFDIRTNDR-IAQIQNEANSPFISLDSRHGLLACG 118

Query: 123 TELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           TELQG+DA + IYDIRKWDTPLRSLIDSHHDDVT +KFHPSD  +LLSGSTDGYTN+YDL
Sbjct: 119 TELQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178

Query: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGD 242
            Q +E+DALHQV+NYASIHSCGWLSP RIFTLSHMETFAIHELNDKS+ELKEPQPLDFGD
Sbjct: 179 KQDEEEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGD 238

Query: 243 VREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDV 302
           VRE W CDYV+D+YPG IA GK+QE  G+L L+P   E +  ++ +VIP AHGDEV+RD+
Sbjct: 239 VREIWNCDYVVDIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDI 298

Query: 303 FIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLDGD 351
           FIP  HS ++YSCGEDG V +W+N  G L++PE FWDYSK+ M+VL  D
Sbjct: 299 FIPAQHSNMLYSCGEDGCVKIWENKQGPLDIPENFWDYSKK-MNVLGDD 346

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  483 bits (1243), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 226/341 (66%), Positives = 279/341 (81%), Gaps = 2/341 (0%)

Query: 3   ISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62
           ++ YSL++ +SFGS NWC K QP  K +GLL  LSNGEI  LD+ T +  Q IR S  +I
Sbjct: 1   MNSYSLVDLNSFGSENWCLKLQPAYK-HGLLTGLSNGEICLLDWNTGKPLQKIRASETAI 59

Query: 63  NDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122
           ND+KI++SDF  G+L S+A+ +SVK+FDI SN+  +A ++N+ N PFLSLDSRHGLLA G
Sbjct: 60  NDMKIIDSDFVAGNLISSASIDSVKVFDIRSNDC-VAKINNETNSPFLSLDSRHGLLACG 118

Query: 123 TELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           TELQG+DA I+IYD+RKWD PLRSL+DSHHDDVT +KFHPSD  VLLSGSTDGYTN+YDL
Sbjct: 119 TELQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL 178

Query: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGD 242
            Q DE+DALHQV+NYASIHSCGWLSP RI+TLSHMETF+IHELNDKS+ELKEPQPLDFGD
Sbjct: 179 KQDDEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFSIHELNDKSDELKEPQPLDFGD 238

Query: 243 VREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDV 302
           +R+ W CDYV+DVYPG+IA GK+QEG G+L+L+P   E I   + +VIP AHGDEV+RDV
Sbjct: 239 IRKAWNCDYVVDVYPGFIATGKTQEGAGELRLLPFKDEKIDTGNGIVIPHAHGDEVVRDV 298

Query: 303 FIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKR 343
           F+   +++++YSCGEDG V +WKN+ G LN P  FWDYS+R
Sbjct: 299 FVSEQNTDVLYSCGEDGCVKIWKNSLGCLNTPASFWDYSER 339

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score =  463 bits (1192), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 214/338 (63%), Positives = 271/338 (80%), Gaps = 2/338 (0%)

Query: 6   YSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDL 65
           YSL+   SFGS+NWC KFQPL   +GLL SLSNGE+  LD+ T    ++ ++  +SIN +
Sbjct: 3   YSLVQEQSFGSDNWCLKFQPL-YNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSM 61

Query: 66  KILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTEL 125
           K++N+D++  SLF+TAT  SVKI+DI SN+  IAT+ NDK  PFLSLDSRH +LA GTEL
Sbjct: 62  KLINNDYNNASLFATATLNSVKIYDIKSNDC-IATITNDKKSPFLSLDSRHDMLACGTEL 120

Query: 126 QGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185
           QGVDA++ IYD+R W +P++S +DSHHDD+T +KFHPSD   LLSGSTDGYTNVYDLTQQ
Sbjct: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180

Query: 186 DEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVRE 245
           +EDDAL+QV+NYASIHSCGWLSP RI+TLSHMETF+I ELND+++EL+EPQPLDFGD+R+
Sbjct: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240

Query: 246 KWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIP 305
           +W CDYVID+YPGYIA G+SQEGNG L++IP +GE +    ++ I  AH DEVIRDVFIP
Sbjct: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300

Query: 306 PSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKR 343
            +H  ++YSCGEDG V  WK+ +      E+FWDYS+R
Sbjct: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQR 338

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score =  462 bits (1190), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 216/348 (62%), Positives = 284/348 (81%), Gaps = 4/348 (1%)

Query: 3   ISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62
           +S  S + S+ FGS NWCF+ QPL KA G+L SLSNGE+H +D+ + +S    +    +I
Sbjct: 1   MSQCSQIGSYFFGSENWCFQIQPLYKA-GILTSLSNGEVHLMDWKSNKSINKFKSDETAI 59

Query: 63  NDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122
           N L+I+N+D+H  + F TA+  +VK+FD+ SN   I T+HN+   PFLSLDSR+  +A G
Sbjct: 60  NALQIVNTDWHNETRFITASMHAVKLFDVRSN-ACIGTIHNEVGAPFLSLDSRYDKIACG 118

Query: 123 TELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           TEL+GVDAQ++I+D+RK D P +SL+DSHHDD+T++KFHPSD  VLLSGSTDGYTN+YDL
Sbjct: 119 TELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL 178

Query: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGD 242
           +Q++EDD+LHQV+N+ SIHSCGW++P RI+TLSHMETFAIHELN+KS+EL EPQPLDFGD
Sbjct: 179 SQEEEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGD 238

Query: 243 VREKWGCDYVIDVYPGYIAAGKS-QEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRD 301
           +R  WGCDYV+D+YPGY+A GKS +EG G+LKLIP  GEN+ + +++ IPSAHGDEVIRD
Sbjct: 239 IRAAWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRD 298

Query: 302 VFIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLD 349
           VFIP  +SE+VYSCGEDG++N+W+NN+G LNVPE+FW+Y    M+VLD
Sbjct: 299 VFIPEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYD-IPMNVLD 345

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score =  460 bits (1184), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 212/344 (61%), Positives = 279/344 (81%), Gaps = 3/344 (0%)

Query: 6   YSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDL 65
           YSL+NS SFG+NNWC   QP  + + LL SLSNG++H LD+ T +S   I+   +++N L
Sbjct: 3   YSLVNSESFGNNNWCLNLQPAYQ-HSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKL 61

Query: 66  KILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTEL 125
           K++N+D    S ++TAT  +VKI+DI SNN  +AT+ NDKN PFLSLDSRH +LA GTEL
Sbjct: 62  KLINNDHENESTYATATMGAVKIWDIRSNNC-LATISNDKNAPFLSLDSRHNMLACGTEL 120

Query: 126 QGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185
            G DA+++IYD+RKWD+PLRSL+DSHHDD+T + FHPSDP VL+SGSTDGYTN+YDL Q 
Sbjct: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180

Query: 186 DEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVRE 245
           +E+DALHQV+N+ASIHSCGWL+P RIFTLSHMETF+IHELNDKS+E KEP+P++F DVRE
Sbjct: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240

Query: 246 KWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIP 305
            WGCDYV+D++PGY+A G SQEG G+L+++P  GE +   +++ I +AHGDEV+RDVF+P
Sbjct: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300

Query: 306 PSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLD 349
             +S+L+YSCGEDG V  W+N +G LNV ++FWDYS+  ++VLD
Sbjct: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQ-LLNVLD 343

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score =  455 bits (1171), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/348 (62%), Positives = 276/348 (79%), Gaps = 3/348 (0%)

Query: 3   ISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62
           +S YSLL+S+S G  +WC + QPL + +GLL SLSNG+++ LD+ T    ++++  N SI
Sbjct: 1   MSSYSLLHSNSLGRTDWCLELQPLYR-HGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSI 59

Query: 63  NDLKILNSDFHCGSLFSTATAESVKIFDIN-SNNGPIATLHNDKNVPFLSLDSRHGLLAM 121
           N +++L+SD+  GS+FS A  ++VK+ D+    N  +A L+N+K  PFLSLDSRHG+LA 
Sbjct: 60  NRMRVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLAC 119

Query: 122 GTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
           GTEL GVDA+I+IYDIR +D P+R L+DSHHDDVT +KFHPSDP VLLSGSTDGYTNVYD
Sbjct: 120 GTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYD 179

Query: 182 LTQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFG 241
           LTQ +E+DALHQV+NY S+HSCGWLSP RI+TLSHMETFAIHELN+KS+EL EP+PLDFG
Sbjct: 180 LTQVEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFG 239

Query: 242 DVREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRD 301
           D+R  W CDYV+DVYPGYIA GKS+E NG LK+IP + E +++ DS+ IP+AHGDEV+RD
Sbjct: 240 DIRGTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRD 299

Query: 302 VFIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLD 349
           VFI P    ++YSCGEDG V  WK  N +L VP  FWDYS + ++VLD
Sbjct: 300 VFISPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQ-INVLD 346

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score =  456 bits (1174), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 210/338 (62%), Positives = 268/338 (79%), Gaps = 2/338 (0%)

Query: 6   YSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDL 65
           YS L S  FG NNWC K QP+  + GLL SLSNG +  +D+ T +S   I+    S+ND+
Sbjct: 22  YSKLESIEFGPNNWCLKLQPIYNS-GLLTSLSNGRVELIDWATHKSILQIQTHATSVNDM 80

Query: 66  KILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTEL 125
            I+N+D   GSL +TA  ++VKI+D+ SN+  +ATL N K+ PFLSLDSRHGLL  GTEL
Sbjct: 81  VIINNDRMNGSLIATAAEDAVKIYDLKSNDC-VATLKNGKSAPFLSLDSRHGLLGCGTEL 139

Query: 126 QGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185
            GVDA++++YDIR W  PLRSL+DSHHDD+T++KFHPSDP VLLSGSTDGY N+YDLTQQ
Sbjct: 140 SGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQ 199

Query: 186 DEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVRE 245
           +EDDALHQV+N+ASIHSCGWLSP RI+TLSHMET+ IHELNDK +E  EP+P+DFGDVR+
Sbjct: 200 EEDDALHQVINFASIHSCGWLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVRK 259

Query: 246 KWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIP 305
            W C+YVIDVYPG+IA GKS+EG G+LKLIP + E   ++ ++ IPSAH DEV+RDV +P
Sbjct: 260 PWDCNYVIDVYPGFIATGKSEEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDVLVP 319

Query: 306 PSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKR 343
             H +L+YSCGEDG + +WK++ G LNVP++FW YS++
Sbjct: 320 FQHEDLLYSCGEDGSLKVWKSSAGPLNVPQEFWQYSEK 357

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score =  450 bits (1158), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 211/341 (61%), Positives = 267/341 (78%), Gaps = 2/341 (0%)

Query: 3   ISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSI 62
           ++ YS L++  FGS+NWC   QP    + LL SLSNGE+H +D+ T +S +  +  N SI
Sbjct: 1   MASYSNLHTQDFGSDNWCLGLQPF-YNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSI 59

Query: 63  NDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122
           N LKI++S+F+ GS ++ A+ +SV I D+ S +  +A+L NDKN PFLSLDSRHG+LA G
Sbjct: 60  NKLKIIDSNFNEGSSYAVASNDSVNILDVRSRD-KLASLKNDKNAPFLSLDSRHGMLACG 118

Query: 123 TELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           TEL GVDA+++IYD+R W TP+RS +DSHHDDVT ++FHPSD  VLLSGSTDGYTNVYDL
Sbjct: 119 TELSGVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDL 178

Query: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGD 242
            QQ+EDDALHQV+NYASIHSCGWLSP RIFTLSHMET A+HELNDKS+EL+EPQPLDFGD
Sbjct: 179 KQQEEDDALHQVINYASIHSCGWLSPKRIFTLSHMETLAMHELNDKSDELREPQPLDFGD 238

Query: 243 VREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDV 302
           +REKWGC YV+D+YPGY+A G SQE +  LKL+    E I  + S+VIPSAHG+EV+RDV
Sbjct: 239 IREKWGCSYVVDLYPGYVAVGSSQERSSFLKLMALENEQIETEKSLVIPSAHGEEVVRDV 298

Query: 303 FIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKR 343
            IPP +  ++YSCGEDG V +WK  +   ++   FWDYSK+
Sbjct: 299 LIPPQNCNMLYSCGEDGTVKIWKTKDTGFHIEPGFWDYSKK 339

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score =  447 bits (1150), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 205/338 (60%), Positives = 266/338 (78%), Gaps = 2/338 (0%)

Query: 6   YSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDL 65
           YS ++S +FG++NWC K QPL    GLL SLSNG +  +D+   +    I+    +I+D+
Sbjct: 3   YSKVDSINFGADNWCLKLQPL-YNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISDM 61

Query: 66  KILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTEL 125
            +LN+D + G L +TA  +SVKIFD+ S++  +ATL N+K+ PFLSLDSRHG+LA GTEL
Sbjct: 62  VVLNNDRNNGFLIATAAEDSVKIFDLRSSDT-VATLKNEKSAPFLSLDSRHGMLACGTEL 120

Query: 126 QGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185
            GVDA+++IYD++ W  PLRSL+DSHHDD+T +KFHP+DP VLLSGSTDGY N+YDLTQ 
Sbjct: 121 SGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQP 180

Query: 186 DEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVRE 245
           +EDDALHQV+N+ASIHS GW +P RI+TLSHMETF IHELNDK EE  EP P DFGD+R+
Sbjct: 181 EEDDALHQVINFASIHSSGWCAPKRIYTLSHMETFGIHELNDKLEEPTEPHPKDFGDIRQ 240

Query: 246 KWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIP 305
            WGCDYV+DVYPG+IA GKSQEG G++KLIP  GE++ +  +V IPSAHGDEV+RDV +P
Sbjct: 241 SWGCDYVVDVYPGFIATGKSQEGQGEVKLIPFTGEDLDLDSAVTIPSAHGDEVVRDVLVP 300

Query: 306 PSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKR 343
             H +++Y+CGEDG VN WK+N G LNVP++FW Y+ +
Sbjct: 301 FQHEDMLYTCGEDGCVNAWKSNRGPLNVPQEFWSYADQ 338

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score =  446 bits (1147), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 220/353 (62%), Positives = 275/353 (77%), Gaps = 10/353 (2%)

Query: 1   MSISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNL 60
           MS+ P   +N  SFGSNNWC KF+PL    GLL SLSNGEI  LD+ T Q K  I++   
Sbjct: 1   MSVIP---INLTSFGSNNWCLKFKPLYNY-GLLTSLSNGEISILDWKTNQIKDKIKIGET 56

Query: 61  SINDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLA 120
           SIND +I+N++++ GSL  TAT ESVKI+D+ SN+  I T+ N+KN PFLSLDS H ++A
Sbjct: 57  SINDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDC-IKTITNEKNSPFLSLDSLHNMMA 115

Query: 121 MGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVY 180
            GTEL GVDA++ IYDIR WDTP+RS +DSHHDD+T +KFHP+D  VL+SGSTDGYTN+Y
Sbjct: 116 CGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIY 175

Query: 181 DLTQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDF 240
           DLT+ +E+D+LHQV+NY+SIHSCGWLS  RIFTLSHMETFAIH+LNDKSE LKEP+P++F
Sbjct: 176 DLTETEEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEF 235

Query: 241 GDVREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKD--SVVIPSAHGDEV 298
           GD+R  WGC+YVIDVYPGYIA GK++E  GQLK+ P N E I + +  +++IP AHGDEV
Sbjct: 236 GDIRNDWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEV 295

Query: 299 IRDVFIPPSHSELVYSCGEDGFVNLWK--NNNGALNVPEQFWDYSKRTMHVLD 349
           IRDVFI P+    +YSCGEDG V LWK      +L +PE F+DYS R ++VLD
Sbjct: 296 IRDVFINPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLR-LNVLD 347

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score =  441 bits (1135), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 203/338 (60%), Positives = 265/338 (78%), Gaps = 2/338 (0%)

Query: 6   YSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDL 65
           YS L++ SFG  NWC + QPL    GLL SLSNG IH +D+ T +        + SI++L
Sbjct: 3   YSKLHTASFGCENWCLQLQPL-YNRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASISNL 61

Query: 66  KILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTEL 125
           K+LN++F    LF++A+ +SVKIFD+ +++  +ATLHNDK+ PFLSLDSRH +LA GTEL
Sbjct: 62  KVLNNEFTNSDLFASASKDSVKIFDVRTSSC-VATLHNDKSAPFLSLDSRHDMLACGTEL 120

Query: 126 QGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185
            GVDA+++IYDI+K   PLRS +DSHHDD+T  KFHP DP VL+SGSTDGY N+YDLT  
Sbjct: 121 SGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTNS 180

Query: 186 DEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVRE 245
           DE+DALHQV+N+AS+HSCGWL+P RI+TLSHMETFAIHELNDKS++L+EP+P++FGDVR+
Sbjct: 181 DEEDALHQVINFASVHSCGWLAPRRIYTLSHMETFAIHELNDKSDDLREPKPVEFGDVRQ 240

Query: 246 KWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIP 305
            WGCDY+I++ PG+IAAG+SQE  G+LKLI  N E +   + + IP AHGDE+IRDV IP
Sbjct: 241 PWGCDYIININPGFIAAGRSQETQGELKLIAFNDEKVDTTNVLTIPQAHGDEIIRDVLIP 300

Query: 306 PSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKR 343
              ++++YSCGEDG +N+WK+  G LN+   FWDYSKR
Sbjct: 301 DQTTDMLYSCGEDGCLNIWKSQTGPLNISRDFWDYSKR 338

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score =  442 bits (1137), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 197/328 (60%), Positives = 257/328 (78%), Gaps = 2/328 (0%)

Query: 14  FGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLKILNSDFH 73
           F  NNWC K QPL   +GL+ S+S+G +H LD+G  ++  SI+    SIND+K++NSDF 
Sbjct: 11  FEENNWCLKLQPL-YQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSINDMKVINSDFD 69

Query: 74  CGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQIN 133
            G++F+TA  + VK++DI + N  +A+L NDK  PF SLDSRH +LA GTEL+  DA+++
Sbjct: 70  TGAVFATAAEDGVKVWDIRARNN-VASLQNDKASPFFSLDSRHNMLACGTELKDYDAELH 128

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQ 193
           IYDIR W  P+RS +DSHHDD+T +KFHP D  +L+SGSTDGY N+YDLTQ DE+DALHQ
Sbjct: 129 IYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDDEEDALHQ 188

Query: 194 VMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVREKWGCDYVI 253
           V+N+ASIHSCGWL P RI++LSHMETF IHELNDKS+E+ EP+PL+FGDVR+KWGCDYVI
Sbjct: 189 VINFASIHSCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEPKPLEFGDVRDKWGCDYVI 248

Query: 254 DVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPPSHSELVY 313
           D+YP +IA GK+ E  G+LK+IP   E + V  ++VIP AHG+EVIRDV IP + + L+Y
Sbjct: 249 DIYPSFIATGKTHESQGELKIIPFQNEQVDVSSALVIPDAHGNEVIRDVLIPKNQTSLLY 308

Query: 314 SCGEDGFVNLWKNNNGALNVPEQFWDYS 341
           SCGEDG+VN+WK+   +LNVP  FWDY+
Sbjct: 309 SCGEDGYVNVWKDTTNSLNVPHNFWDYT 336

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score =  420 bits (1079), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 272/361 (75%), Gaps = 8/361 (2%)

Query: 8   LLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLKI 67
           L+N  +FG++NWC + +PL  + GLL S SNG ++ +D+ +    +   V   +IN L++
Sbjct: 5   LVNQITFGNDNWCLELKPL-YSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRV 63

Query: 68  LNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQG 127
           +N+DF  G +F+  +  SVKI+D+ + + P+AT+ NDKN  FLSL+SRH +L  GTEL G
Sbjct: 64  INNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTG 123

Query: 128 VDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
           VDA++ IYD+R +  P+R+ +DSHHDD+T +KFHPSD  +LLSGSTDGYTN+YDL Q+DE
Sbjct: 124 VDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDE 183

Query: 188 DDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVREKW 247
           D+ALHQV+NYASIHSCGWLSP RI+TLSHMETFAIHELNDKS+EL EP+PLDFGD+R +W
Sbjct: 184 DEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRGQW 243

Query: 248 GCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPP- 306
            CDYV+D+YPGY+A GKS E  G+LK+     E ++ ++ ++IP+AHGDEVIRDVFIPP 
Sbjct: 244 DCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIPPG 303

Query: 307 ---SHSELVYSCGEDGFVNLWK--NNNGALNVPEQFWDYSKRTMHVLDGDFSLESGNEVE 361
              +HS+++YSCGEDG VN+W     +  LNV + FW+ +++ + VL  D+++  G   E
Sbjct: 304 NLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQ-LDVLSDDYNMLVGRNNE 362

Query: 362 K 362
           +
Sbjct: 363 Q 363

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score =  419 bits (1078), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 204/357 (57%), Positives = 271/357 (75%), Gaps = 5/357 (1%)

Query: 6   YSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDL 65
           Y+  ++ SFGS+NWC K QPL  + GLL +LSNG +H +D+ +  S Q I V   SI+ L
Sbjct: 3   YTKCDTISFGSDNWCLKLQPL-YSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISAL 61

Query: 66  KILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTEL 125
           K+L++D   G+ F TA+ +SVKIFD+  N   +AT+ N KN PF+SLDSRHG+LA GTEL
Sbjct: 62  KVLDNDVDSGNTFVTASEDSVKIFDLRLNQC-VATVQNAKNSPFISLDSRHGMLACGTEL 120

Query: 126 QGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185
            G DA+I++YD++K D P+RS  DSHHDD+T +KFH SDP+VLLSGSTDGY NVYDL QQ
Sbjct: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180

Query: 186 DEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVRE 245
           +E++ALHQV+N+ASIHSCGWLSP RI+ LSHMETF+IHELNDKS+EL EP+PL+FGD+R+
Sbjct: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240

Query: 246 KWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIP 305
            W CDYV+D++PG I  G +QE    L+L+P + E +   +S++IP AHGDEV+RD  I 
Sbjct: 241 PWNCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH 299

Query: 306 PSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLDGDFSLESGNEVEK 362
            + SEL YS GEDG + LWK+N G+LNVP +FW+Y ++ ++VL  D ++E    VEK
Sbjct: 300 KTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEK-LNVL-HDPNIEIDMTVEK 354

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score =  415 bits (1066), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 253/338 (74%), Gaps = 2/338 (0%)

Query: 6   YSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDL 65
           Y L    SFG++NWC + +PL +A G+L +LSNG +H +D+ T +S   +     SIN L
Sbjct: 3   YILQQKVSFGADNWCLRLRPLYQA-GVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL 61

Query: 66  KILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTEL 125
           ++L+S    G++F+TA  + VK+FDI +  G +ATL +    P LSLDSRHG+LA GTEL
Sbjct: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTR-GCVATLTDANGAPALSLDSRHGMLAFGTEL 120

Query: 126 QGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185
            GVDA ++++ + +W  PLR+ +DSHHDDVT +KFHP+D  +LLSGSTDGY NVYDL Q 
Sbjct: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180

Query: 186 DEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVRE 245
           +ED+ALHQV+N+ASIHSCGWLSP RI++LSHMETFAIHELNDKSE   EPQP  FGDVRE
Sbjct: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240

Query: 246 KWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIP 305
            W CDYV+DVYPG+IAAG ++E  G+L+L+P   E +   +++V+P AHGDEV+RDV +P
Sbjct: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300

Query: 306 PSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKR 343
            S  EL+YS GEDG + +WK+  G LNVP  FWDYSK+
Sbjct: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKK 338

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score =  408 bits (1049), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 195/339 (57%), Positives = 253/339 (74%), Gaps = 10/339 (2%)

Query: 6   YSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQ-SIRVSNLSIND 64
           YSL  S +FGSNNWC K QP+   NG+L S+S+GE+H L  G   SKQ S +V   SIN 
Sbjct: 2   YSLAGSCNFGSNNWCLKLQPVH--NGILTSVSSGEVHLL--GLDLSKQDSFKVGETSINA 57

Query: 65  LKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTE 124
           L  ++      +LF+ +    VK+FD+  N   +ATL  +     LSL S HG+LA G+E
Sbjct: 58  LSRVDGQ---ENLFAASNGNKVKVFDLRENK-EVATLEQENGANVLSLGSGHGMLAYGSE 113

Query: 125 LQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ 184
            QGVDA ++++DIR W  P+RS +DSH DD+T++ FHP+D  VLLSGSTDGYTNVYDL +
Sbjct: 114 QQGVDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLE 173

Query: 185 QDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVR 244
            +E+DALHQV+NYASIHSCGWL+P RIFTLSHMETFAIHELNDKSEEL+EPQPLDFGD+R
Sbjct: 174 PEEEDALHQVINYASIHSCGWLAPRRIFTLSHMETFAIHELNDKSEELREPQPLDFGDIR 233

Query: 245 EKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFI 304
           + W C+YV+D+YPGYI+AG S+EG G L++IP   E++  KD++ I  AHGDE++RD +I
Sbjct: 234 QPWDCNYVVDIYPGYISAGVSEEGKGALRIIPFRNEHVQAKDTITISQAHGDEIVRDTYI 293

Query: 305 PPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKR 343
            PS S+++YSCGEDG V  W+N+   L++PE FWDYS +
Sbjct: 294 LPSQSDMLYSCGEDGQVKAWRNDI-KLDIPETFWDYSTK 331

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 69/129 (53%), Gaps = 19/129 (14%)

Query: 127 GVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL---- 182
           G D+Q+ +YD+RK + P+ S+   HHD VT+L+F P    +L SGS+D    ++DL    
Sbjct: 268 GTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326

Query: 183 ---TQQDEDDALHQVMNYASIH-------SCGWLSPNRIFTLSHMETFAIHELNDKSEEL 232
               Q+D DD + +++   + H       SC   SPN  + ++ +E   + ++   S++L
Sbjct: 327 AEQQQEDADDGVPELLMMHAGHKSPVNDFSC---SPNIPWLMASVEEENVVQIWKASKKL 383

Query: 233 KEPQ-PLDF 240
             P  P D+
Sbjct: 384 TSPYIPRDY 392

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 87/183 (47%), Gaps = 20/183 (10%)

Query: 17  NNWCFKFQPLDKANGLLLSLSNGEIHCL-DFGTCQSKQSIRVSNLSI-NDLKILNSDFHC 74
           N +   F P    +G LLS S+     L D    +  +SI  S+  I ND+K    +F  
Sbjct: 188 NGYGLAFNP--HISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW--HEFES 243

Query: 75  GSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLD-SRHG--LLAMGTELQGVDAQ 131
               + +  +++++ D      P+  L      PF +L  S+H   LLA      GVD+Q
Sbjct: 244 NVFGTVSEDKTLQVHDKRVRLEPVKKLPTAS--PFNTLSFSKHSRNLLAAA----GVDSQ 297

Query: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ----QDE 187
           I +YD+R   +PL  ++  H D VT ++F P    ++ S  +D    ++DLTQ    Q +
Sbjct: 298 IYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQ 356

Query: 188 DDA 190
           DDA
Sbjct: 357 DDA 359

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 90/193 (46%), Gaps = 26/193 (13%)

Query: 17  NNWCFKFQPLDKANGLLLSLSN-GEIHCLDFGTCQSKQSIRVSNLS---INDLKILNSDF 72
           N +   F PL K  G LLS S+   +   D  + +++   +  N+    +ND +  N   
Sbjct: 178 NGYGLAFNPLIK--GHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQWHN--- 232

Query: 73  HCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRH---GLLAMGTELQGVD 129
              SLF T + +S         + P+AT++  K  PF +L   H    LLA G    GV+
Sbjct: 233 FQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLLATG----GVN 286

Query: 130 AQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ----- 184
           +++ +YD R  + PL  L+  H D VT+L F   D  ++LS   D    ++D+       
Sbjct: 287 SEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQ 345

Query: 185 --QDEDDALHQVM 195
             +D +DA  +VM
Sbjct: 346 VLEDAEDATSEVM 358

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 95/202 (47%), Gaps = 24/202 (11%)

Query: 8   LLNSHSF-GSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSI-----RVSNLS 61
           LL++  F   N +   F P +K  G LLS S+     L   T +S++ I     R S++ 
Sbjct: 146 LLSTFQFHNENGYGLSFNPNEK--GKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDI- 202

Query: 62  INDLKILNSDFHCGSLFSTATAES-VKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLA 120
           +ND K  N D    ++F + + +S +++ D    +  +  +   K    L+  +    L 
Sbjct: 203 VNDCKWHNFD---QNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLF 259

Query: 121 MGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVY 180
                 G D+ + +YD R+   PL  ++  H D VT+L+FHP +  VL+S  +D  T ++
Sbjct: 260 AAA---GTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILW 315

Query: 181 DLTQ-------QDEDDALHQVM 195
           DL +        D DD   +VM
Sbjct: 316 DLAEIGAEQVPDDADDGSPEVM 337

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 39/56 (69%), Gaps = 3/56 (5%)

Query: 130 AQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLS-GSTDGYTNVYDLTQ 184
            +IN++DIR + +P+RSL   HH  V+AL+++P  PT+L + G  DG   ++DL+Q
Sbjct: 313 GRINLWDIRDFSSPIRSL--DHHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQ 366

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 52/110 (47%), Gaps = 5/110 (4%)

Query: 77  LFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRH-GLLAMGTELQGVDAQINIY 135
           L S  +A  + ++DI   + PI +L +  +V  L  +  H  +LA   +  G+   + I+
Sbjct: 306 LCSADSAGRINLWDIRDFSSPIRSLDHHGSVSALQWNPHHPTILATAGQDDGL---VKIW 362

Query: 136 DIRK-WDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ 184
           D+ +  D  L+     H   V  + + P+DP ++ S S D    ++  +Q
Sbjct: 363 DLSQPVDQELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQ 412

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 90/206 (43%), Gaps = 20/206 (9%)

Query: 17  NNWCFKFQPLDKANGLLLSLSN-GEIHCLDFGTCQSK---QSIRVSNLSINDLKILNSDF 72
           N +   F P    +G LLS S+ G +   D  +  +K   Q+  V    +ND K    +F
Sbjct: 171 NGYGLAFNP--TVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKW--HEF 226

Query: 73  HCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSR-HGLLAMGTELQGVDAQ 131
              SLF T + ++  I    +++  I  L        L+   R   LLA      G D+ 
Sbjct: 227 QS-SLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAA----GTDSN 281

Query: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL----TQQDE 187
           + +YD+R+   PL S+   H D VT+L+F P    +L S  +D    ++DL     +Q  
Sbjct: 282 VYLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQP 340

Query: 188 DDALHQVMNYASIHSCGWLSPNRIFT 213
           DDA   V     +H  G  SP   F+
Sbjct: 341 DDAYDGVPELFMMHG-GHRSPVNEFS 365

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 89/200 (44%), Gaps = 26/200 (13%)

Query: 17  NNWCFKFQPLDKANGLLLSLSNGEIHCL-DF-GTCQSKQSIRV-SNLS---INDLKILNS 70
           N +   F PL    GLLLS S+     L D  G   S + IR  S+L    +ND K  N 
Sbjct: 162 NGYALSFSPL--VEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNF 219

Query: 71  DFHCGSLFSTATAESV-KIFDINSNNGPIATLHNDKNVPFLSLDSRH---GLLAMGTELQ 126
           +     LF T + +S+ KI D+   N    T    +  PF +L   H    LLA      
Sbjct: 220 N---KDLFGTVSEDSLLKINDLRVENTTTGTAKCPE--PFNTLAFSHHSSNLLAAA---- 270

Query: 127 GVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ-- 184
           G D+ + +YD+R    PL  +   H D VT L+F P    V++S  +D    ++DL Q  
Sbjct: 271 GTDSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIG 329

Query: 185 --QDEDDALHQVMNYASIHS 202
             Q  DDA   V     +H+
Sbjct: 330 AEQTPDDAEDGVPELIMVHA 349

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 40/56 (71%), Gaps = 3/56 (5%)

Query: 130 AQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTD-GYTNVYDLTQ 184
            +IN++DIR +  PL++L+  H+D ++ L+++P +PTVL +G  D G   ++DL+Q
Sbjct: 313 GRINLWDIRNFTQPLKTLL--HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQ 366

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 100/208 (48%), Gaps = 24/208 (11%)

Query: 19  WCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRVSN-LSINDLKILNSDFHC 74
           +   + PL ++  LL    +G+++     T +    KQ   VSN  SI D++   ++   
Sbjct: 282 YALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTE--- 338

Query: 75  GSLFSTATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDA 130
            ++F+TA  +  ++++D  S      I+T  ++ +V  +S + + G LLA G +    + 
Sbjct: 339 ATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDD----NG 394

Query: 131 QINIYDIRKWD------TPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ 184
              ++D+R++        P+ +  D H   +T++ FHP+D +++   S D    ++DL+ 
Sbjct: 395 TWGVWDLRQFSPSNENAQPV-AQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSV 453

Query: 185 QDEDDALHQVMNYASIHSCGWLSPNRIF 212
           + +D+ + Q    A       + P  +F
Sbjct: 454 EADDEEIKQ--QTAETKELAQIPPQLLF 479

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 66/162 (40%), Gaps = 13/162 (8%)

Query: 55  IRVSNLSINDLKILNSDF-HCGSLFSTATAESVKIFDI------NSNNGPIATLHNDKNV 107
           +RVS  + +  ++L +     G ++    A   + FD        +   PI T+ N  NV
Sbjct: 220 LRVSPFASSGQEVLTATMSENGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNV 279

Query: 108 PFLSLDSRHGLLAMGTELQGVDAQINIYDIR----KWDTPLRSLIDSHHDDVTALKFHPS 163
              +LD    L+  G  L G D    +Y  +    KW T  +    S++  +  +++  +
Sbjct: 280 EGYALD-WSPLIRSGALLTG-DCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRT 337

Query: 164 DPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGW 205
           + TV  +   DGY  V+D   +    A+    +   ++   W
Sbjct: 338 EATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISW 379

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 91/198 (45%), Gaps = 22/198 (11%)

Query: 17  NNWCFKFQPLDKANGLLLSLSNGE-IHCLDF-GTCQSKQSIRVSNLSINDLKILNSDFHC 74
           N +   F PL K  G LLS S+   +   D  G   S   IR  +   +D+ + +S +H 
Sbjct: 162 NGYALSFSPLIK--GHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDI-VNDSKWHN 218

Query: 75  --GSLFSTATAESV-KIFDINSNNGPIATLHNDKNVPFLSLDSRH---GLLAMGTELQGV 128
               LF T + +S+ KI DI + N  I T    +  PF +L   H    +LA      G+
Sbjct: 219 FNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQ--PFNTLAFSHHSSNILAAA----GM 272

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ---- 184
           D+ + +YD+R    PL  +   H D VT L+F P    V++S  +D    ++DL Q    
Sbjct: 273 DSHVYLYDLRNMKEPLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAE 331

Query: 185 QDEDDALHQVMNYASIHS 202
           Q  DDA   V     +H+
Sbjct: 332 QTPDDAEDGVPELIMVHA 349

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 82/176 (46%), Gaps = 19/176 (10%)

Query: 17  NNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLKILNSDFHCGS 76
           N +   F PLDK   LL S  +G +   +        +++ +++ IND++   + F+  +
Sbjct: 171 NGYGLAFNPLDKG-KLLSSSDDGSVAYWNIQKSIPLLTLQETSI-INDVRW--NQFN-QN 225

Query: 77  LFSTATAES-VKIFDINSNNGPIATLHNDK-------NVPFLSLDSRHGLLAMGTELQGV 128
           LF   T  S + + D+ +NN  +  + N         N    S  S + + A G      
Sbjct: 226 LFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE----- 280

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ 184
           D+ I +YD R  + PL   +  H D VT+L FH  +  +++SG +D    V+DL Q
Sbjct: 281 DSLIYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 56/111 (50%), Gaps = 9/111 (8%)

Query: 77  LFSTATAES-VKIFDINSNNGPIATLHNDKNVPFLSLDSRHG--LLAMGTELQGVDAQIN 133
           LF + + +S +K+ D  S +  I T+        L+  S+H   L A      G+D  I 
Sbjct: 214 LFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAF-SKHSANLFAAA----GLDTNIY 268

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ 184
           +YD R+   PL  ++  H D +T L+FHP +  +L+SG  D    ++DL +
Sbjct: 269 LYDRRQTTKPLH-VMAGHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 88/198 (44%), Gaps = 21/198 (10%)

Query: 17  NNWCFKFQPLDKANGLLLSLSN-GEIHCLDF--GTCQSKQSIR----VSNLSINDLKILN 69
           N +   F P DK  G LLS S+ G I   D    +  +K+ ++    V N  +ND K   
Sbjct: 198 NGYGLSFNPNDK--GKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKW-- 253

Query: 70  SDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLD-SRHGLLAMGTELQGV 128
           ++F+     S +   ++++ D    N  I ++      PF +L  S+H    M     G 
Sbjct: 254 NEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTD--PFNTLAFSKHSQYLMAA--AGT 309

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL----TQ 184
           D+ + +YD R    PL S+ + H D +T L+F P    VL+S   D    ++D+     +
Sbjct: 310 DSLVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAE 368

Query: 185 QDEDDALHQVMNYASIHS 202
           Q  DDA         IH+
Sbjct: 369 QIPDDAEDGAPEVIMIHA 386

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 142 TPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIH 201
           + L S +  H ++   L F+P+D   LLSGS DG   ++D+ Q++   A   +  + S+H
Sbjct: 186 SALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDI-QENSTLAKKPLKIWDSVH 244

Query: 202 S-----CGW--LSPNRIFTLSHMETFAIHELNDK 228
           +     C W   + N   ++S   T  +H+  ++
Sbjct: 245 NDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQ 278

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 92/188 (48%), Gaps = 23/188 (12%)

Query: 21  FKFQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRVSN-LSINDLKILNSDFHCGS 76
             + PL K   LL    +G+I+     T +    KQS  VSN  SI D++   ++    +
Sbjct: 278 LDWSPLIKTGALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTE---ST 334

Query: 77  LFSTATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDAQI 132
           +F+TA  +  ++I+D  S      I+   ++ +V  +S   + G LLA G +    +   
Sbjct: 335 VFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGTW 390

Query: 133 NIYDIRKWDTPLRS-------LIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185
            ++D+R++ TP  +         D H   +T++ F+P D +++  GS D    ++DL+ +
Sbjct: 391 GVWDLRQF-TPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVE 449

Query: 186 DEDDALHQ 193
            +D+ + Q
Sbjct: 450 ADDEEIKQ 457

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 72/162 (44%), Gaps = 13/162 (8%)

Query: 55  IRVSNLSINDLKIL------NSDFHCGSLFSTATAESVKIFDI-NSNNGPIATLHNDKNV 107
           ++VS  ++++ ++L      N D +   L + + A S   + I  S   PI T+ N  NV
Sbjct: 214 LKVSPFAVSNQEVLTATMSENGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNV 273

Query: 108 PFLSLDSRHGLLAMGTELQGVDAQINIYDIRK----WDTPLRSLIDSHHDDVTALKFHPS 163
               LD    L+  G  L G D    IY  ++    W T  +S   S+++ +  +++  +
Sbjct: 274 EGYGLD-WSPLIKTGALLSG-DCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRT 331

Query: 164 DPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGW 205
           + TV  + + DGY  ++D   +    A+    +   ++   W
Sbjct: 332 ESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 373

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 91/200 (45%), Gaps = 23/200 (11%)

Query: 17  NNWCFKFQPLDKANGLLLSLSNGEIHCL-DFGTCQSKQSIRVSNLSI-NDLKILNSDFHC 74
           N +   F P  +  G LLS S+     L D  +     SI +++  I ND K    D   
Sbjct: 162 NGYGLAFNP--QIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFD--- 216

Query: 75  GSLFSTATAE-SVKIFDINS--NNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQ 131
            ++F T + + ++++ D  S  N+  +  +    N    S  S++ + A GT     D +
Sbjct: 217 ENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGT-----DTR 271

Query: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT-------Q 184
           + +YD+R+   PL ++   H D VT+++F      +L S  +D    ++DLT       Q
Sbjct: 272 VYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQ 330

Query: 185 QDEDDALHQVMNYASIHSCG 204
           +D DD + ++M   + H   
Sbjct: 331 EDADDGVPELMMMHAGHRSA 350

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 79/169 (46%), Gaps = 24/169 (14%)

Query: 33  LLSLSNGEIHCLDF-----GTCQSKQSIRVSNLSINDLKILNSDFHCGSLFSTATAESVK 87
           ++ +S G  H + F     G C   ++I+ S+  +N L I N       L + A  ++VK
Sbjct: 3   VILVSAGYDHTIRFWEALTGVC--SRTIQHSDSQVNRLTITNDK----KLLAAAGHQNVK 56

Query: 88  IFDINSNN-GPIATLHNDK-NVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLR 145
           ++DIN+ N  P+A+    + NV  LS  + +  +   +E    D  I ++D+R   +P  
Sbjct: 57  LYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSE----DGTIKVWDVR---SPSV 109

Query: 146 SLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQV 194
                H+  V  +  HP+    L+S   DG   ++DL    E+   HQ+
Sbjct: 110 PRTYKHNAPVNEVAIHPNQGE-LISCDRDGNIRIWDL---GENQCTHQL 154

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 64/134 (47%), Gaps = 15/134 (11%)

Query: 77  LFSTATAESV-KIFDINSNNGPIATLHNDKNVPFLSLDSRH---GLLAMGTELQGVDAQI 132
           LF T + +S+ KI D+ +NN  I T+   +  PF +L   H    LLA      G+D+ +
Sbjct: 223 LFGTVSEDSLLKINDVRANNTTIDTVKCPQ--PFNTLAFSHHSSNLLAAA----GMDSYV 276

Query: 133 NIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ----QDED 188
            +YD+R    PL  +   H D V  L+F      V++S  +D    ++DL Q    Q  D
Sbjct: 277 YLYDLRNMKEPLHHM-SGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPD 335

Query: 189 DALHQVMNYASIHS 202
           DA   V     +H+
Sbjct: 336 DAEDGVPELIMVHA 349

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 88/193 (45%), Gaps = 25/193 (12%)

Query: 17  NNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRV----SNLSINDLKILNSDF 72
           N +   F P+ K   LL +  +G I   D    +S+  +       N  IND+K  + D 
Sbjct: 153 NGYGLSFNPISKGQ-LLSAADDGYIAMYDIN-AESEDPVETWQSTDNCIINDIKWHHFD- 209

Query: 73  HCGSLFSTATAE--SVKIFDINSNNGPIATLHNDKNVPFLSLD-SRHGLLAMGTELQGVD 129
              +LF T + E  ++ I+D+ + +  + ++  ++  PF SL  S+H          G D
Sbjct: 210 --ATLFGTVSEEKNTLSIYDLRTKDK-VTSIEMEQ--PFNSLAFSKHSKNLFSA--AGTD 262

Query: 130 AQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ----- 184
             + +YD+R     L S+   H   VT L+FH S   +L+S S D    ++DL +     
Sbjct: 263 QNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQ 321

Query: 185 --QDEDDALHQVM 195
             +D  DA  ++M
Sbjct: 322 VNEDAQDATPELM 334

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDED 188
           ++I+D    D+P+++    H D+   L F+P     LLS + DGY  +YD+  + ED
Sbjct: 132 VSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 39/60 (65%), Gaps = 3/60 (5%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLS-GSTDGYTNVYDLTQQDE 187
           +  +NI DIR+ + P+++   SH D V+ ++++P  PTV+ S G  DG   ++DL Q+D+
Sbjct: 307 EGTLNICDIRQLEHPVKTW--SHLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQEDD 364

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 68/129 (52%), Gaps = 19/129 (14%)

Query: 62  INDLKILNSDFHCGSLFSTATAES-VKIFDINSNNGPIATLHN-DKNVPFLSLD----SR 115
           IND+K  +S+ H   +F + + +S +K+FD  S+      +HN +   P+ +L     S 
Sbjct: 230 INDVKWHSSEAH---IFGSVSEDSTMKLFDKRSSQ----IIHNINTKKPYNTLAFSPFSS 282

Query: 116 HGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDG 175
           +   A GT     D  + +YDIR    PL ++   H D VTA++F P++  +L S  +D 
Sbjct: 283 NLFAAAGT-----DNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDR 336

Query: 176 YTNVYDLTQ 184
            T V+DL +
Sbjct: 337 RTIVWDLQE 345

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 54/111 (48%), Gaps = 7/111 (6%)

Query: 78  FSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDAQINIYD 136
           F+  ++  V++F   +    I T    K+V + +   + G LLAMG        +++IYD
Sbjct: 55  FAITSSTRVQLFSSRTRQ-VIKTFSRFKDVVYSASFRQDGKLLAMG----DATGRVSIYD 109

Query: 137 IRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
                T L S+  S H    A KFHP+D   L++ S D    V+D+TQ  E
Sbjct: 110 SYNPRTQLVSIAASSHPTHVA-KFHPADSRTLVTASDDRVVRVWDITQAQE 159

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 99/208 (47%), Gaps = 25/208 (12%)

Query: 7   SLLNSHSFGSNN-WCFKFQPLDKANGLLLSLSN-GEIHCLD-FGTCQS-KQSIRVSNLSI 62
           +L++ H+F  +N +   F P  +  G LLS S+ G I   +  GT  S  +++      +
Sbjct: 152 ALVSEHAFHKDNGYGLSFNP--RTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIV 209

Query: 63  NDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHN-DKNVPFLSLD-SRHG--L 118
           ND      +F+     S +  ++++I D  +N    +T+H    + PF +LD S+H   L
Sbjct: 210 NDCTW--HEFNENLFGSVSEDKTLQIHDKRTN----STVHRLTLSSPFNTLDFSKHSQNL 263

Query: 119 LAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTN 178
            A      G D+ + +YD+R     L ++   H D VT+L+F P    +L S  +D    
Sbjct: 264 FAAA----GTDSLVYLYDLRNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVL 318

Query: 179 VYDLTQ----QDEDDALHQVMNYASIHS 202
           ++DL Q    Q ++DA   V     +H+
Sbjct: 319 LWDLMQIGSEQAQEDAADGVPELMMMHA 346

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 92/190 (48%), Gaps = 23/190 (12%)

Query: 19  WCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRVSN-LSINDLKILNSDFHC 74
           +   + PL K   LL    +G+I+     T +    KQ   V+N  SI D++   ++   
Sbjct: 277 YALDWSPLTKTGALLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTE--- 333

Query: 75  GSLFSTATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDA 130
            ++F++A  +  ++I+D  S      I+   ++ +V  +S   + G LLA G +    + 
Sbjct: 334 STVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDD----NG 389

Query: 131 QINIYDIRKWD-------TPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
              ++D+R++         P+ +  D H   +T++ F+P D +++  GS D    ++DL+
Sbjct: 390 TWGVWDLRQFSPENAGSVQPV-AQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLS 448

Query: 184 QQDEDDALHQ 193
            + +D+ + Q
Sbjct: 449 VEADDEEIKQ 458

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 47/113 (41%), Gaps = 6/113 (5%)

Query: 97  PIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIR----KWDTPLRSLIDSHH 152
           PI T+ N  NV   +LD    L   G  L G D    IY  +    KW T  +    +++
Sbjct: 264 PIHTVKNHGNVEGYALD-WSPLTKTGALLTG-DCSGQIYFTQRHTSKWITDKQPFTVANN 321

Query: 153 DDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGW 205
             +  +++  ++ TV  S   DGY  ++D   +    A+    +   ++   W
Sbjct: 322 QSIEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 374

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 91/184 (49%), Gaps = 20/184 (10%)

Query: 23  FQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRV-SNLSINDLKILNSDFHCGSLF 78
           + PL K+  LL    +GEI      T +    KQS  V +N SI D++   ++    ++F
Sbjct: 297 WSPLIKSGALLTGDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDIQWSKTE---QTVF 353

Query: 79  STATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIY 135
           +TA  +  ++I+D  S      I+T  ++ +V  +S + +   L    + +GV     ++
Sbjct: 354 ATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLASGDDKGV---WGVW 410

Query: 136 DIRKWD------TPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDD 189
           D+R++       +P+ +  D H   +T++ F+P D + +   S D    ++DL+ + +D+
Sbjct: 411 DLRQFSPSQENASPV-AQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDE 469

Query: 190 ALHQ 193
            + Q
Sbjct: 470 EIKQ 473

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 91/186 (48%), Gaps = 23/186 (12%)

Query: 23  FQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRVSN-LSINDLKILNSDFHCGSLF 78
           + PL K   LL    +G+I+     T +    KQ   VSN  SI D++   ++    ++F
Sbjct: 279 WSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTE---STVF 335

Query: 79  STATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDAQINI 134
           +TA  +  ++I+D  S      I+   ++ +V  +S   + G LLA G +    +    +
Sbjct: 336 ATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGTWGV 391

Query: 135 YDIRKWDTPLRS-------LIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
           +D+R++ TP  +         D H   +T++ F+P D +++  GS D    ++DL+ + +
Sbjct: 392 WDLRQF-TPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEAD 450

Query: 188 DDALHQ 193
           D+ + Q
Sbjct: 451 DEEIKQ 456

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 68/162 (41%), Gaps = 13/162 (8%)

Query: 55  IRVSNLSINDLKIL------NSDFHCGSLFSTATAESVKIFDIN-SNNGPIATLHNDKNV 107
           ++VS  + ++ ++L      N D +   L   + A S   + I+ S   PI T+ +  NV
Sbjct: 213 LKVSPFAASNQEVLTATMSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNV 272

Query: 108 PFLSLDSRHGLLAMGTELQGVDAQINIYDIRK----WDTPLRSLIDSHHDDVTALKFHPS 163
               LD    L+  G  L G D    IY  ++    W T  +    S++  +  +++  +
Sbjct: 273 EGYGLD-WSPLIKTGALLSG-DCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRT 330

Query: 164 DPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGW 205
           + TV  +   DGY  ++D   +    A+    +   ++   W
Sbjct: 331 ESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 372

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 91/186 (48%), Gaps = 23/186 (12%)

Query: 23  FQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRVSN-LSINDLKILNSDFHCGSLF 78
           + PL K   LL    +G+I+     T +    KQ   VSN  SI D++   ++    ++F
Sbjct: 281 WSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTE---STVF 337

Query: 79  STATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDAQINI 134
           +TA  +  ++I+D  S      I+   ++ +V  +S   + G LLA G +    +    +
Sbjct: 338 ATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGTWGV 393

Query: 135 YDIRKWDTPLRS-------LIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
           +D+R++ TP  +         D H   +T++ F+P D +++  GS D    ++DL+ + +
Sbjct: 394 WDLRQF-TPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEAD 452

Query: 188 DDALHQ 193
           D+ + Q
Sbjct: 453 DEEIKQ 458

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 69/162 (42%), Gaps = 13/162 (8%)

Query: 55  IRVSNLSINDLKIL------NSDFHCGSLFSTATAESVKIFDI-NSNNGPIATLHNDKNV 107
           ++VS  +I++ ++L      N D +  +L   + A S   + I  S   PI T+ N  NV
Sbjct: 215 LKVSPFAISNQEVLTATMSENGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNV 274

Query: 108 PFLSLDSRHGLLAMGTELQGVDAQINIYDIRK----WDTPLRSLIDSHHDDVTALKFHPS 163
               LD    L+  G  L G D    IY  ++    W T  +    S++  +  +++  +
Sbjct: 275 EGYGLD-WSPLIKTGALLSG-DCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRT 332

Query: 164 DPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGW 205
           + TV  +   DGY  ++D   +    A+    +   ++   W
Sbjct: 333 ESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 374

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 91/186 (48%), Gaps = 23/186 (12%)

Query: 23  FQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRVSN-LSINDLKILNSDFHCGSLF 78
           + PL K   LL    +G+++     T +    KQ   VSN  SI D++   S+    ++F
Sbjct: 279 WSPLIKTGSLLSGDCSGQVYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRSE---STVF 335

Query: 79  STATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDAQINI 134
           +TA  +  ++I+D  S      I+   ++ +V  +S   + G LLA G +    +    +
Sbjct: 336 ATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGTWGV 391

Query: 135 YDIRKWDTPLRS-------LIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
           +D+R++ TP  +         D H   +T++ F+P D +++  GS D    ++DL+ + +
Sbjct: 392 WDLRQF-TPSNADSVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEAD 450

Query: 188 DDALHQ 193
           D+ + Q
Sbjct: 451 DEEIKQ 456

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 69/162 (42%), Gaps = 13/162 (8%)

Query: 55  IRVSNLSINDLKIL------NSDFHCGSLFSTATAESVKIFDI-NSNNGPIATLHNDKNV 107
           ++VS  ++++ ++L      N D +   L   + A +   + I  S   PI T+ N  NV
Sbjct: 213 LKVSPFAVSNQEVLTATMSENGDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNV 272

Query: 108 PFLSLDSRHGLLAMGTELQGVDAQINIYDIRK----WDTPLRSLIDSHHDDVTALKFHPS 163
               LD    L+  G+ L G D    +Y  ++    W T  +    S++  +  +++  S
Sbjct: 273 EGYGLD-WSPLIKTGSLLSG-DCSGQVYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRS 330

Query: 164 DPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGW 205
           + TV  +   DGY  ++D   +    A+    +   ++   W
Sbjct: 331 ESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 372

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 93/202 (46%), Gaps = 20/202 (9%)

Query: 23  FQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRV-SNLSINDLKILNSDFHCGSLF 78
           + PL K   LL    +G ++     T +    K    V +N SI D++   ++    ++F
Sbjct: 287 WSPLIKTGALLTGDCSGMVYLTQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTE---STVF 343

Query: 79  STATAES-VKIFDINSNNGP--IATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIY 135
           +TA  +  ++I+D  S      I+T+ ++ +V  +S + + G L    + +G      I+
Sbjct: 344 ATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGT---WGIW 400

Query: 136 DIRKWDTPLRSLI-----DSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDA 190
           D+R++       +     D H   +T++ F+P D +++   S D    ++DL+ + +D+ 
Sbjct: 401 DLRQFSPNSEKALPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEE 460

Query: 191 LHQVMNYASIHSCGWLSPNRIF 212
           + Q    A I     + P  +F
Sbjct: 461 IKQ--QKAEIKELEQIPPQLLF 480

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 90/186 (48%), Gaps = 23/186 (12%)

Query: 23  FQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRVSN-LSINDLKILNSDFHCGSLF 78
           + PL K   LL    +G+I      T +    KQ    +N  S+ D++   ++    ++F
Sbjct: 286 WSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTE---STVF 342

Query: 79  STATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDAQINI 134
           +T+  +  V+I+D  S      I+T  ++ +V  +S + + G LLA G +    +    +
Sbjct: 343 ATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDD----NGSWGV 398

Query: 135 YDIRKWDTPLRS-------LIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
           +D+R++ +P  S         D H   +T++ F+P D +V+   S D    ++DL+ + +
Sbjct: 399 WDLRQF-SPANSEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEAD 457

Query: 188 DDALHQ 193
           DD + Q
Sbjct: 458 DDEIQQ 463

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 65/161 (40%), Gaps = 11/161 (6%)

Query: 55  IRVSNLSINDLKILNSDF-HCGSLFSTATAESVKIFDI------NSNNGPIATLHNDKNV 107
           ++VS  + +  ++L +     G ++        K F+        ++   I T+ N  NV
Sbjct: 220 LKVSPFATHGQEVLTATMCENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNV 279

Query: 108 PFLSLDSRHGLLAMGTELQG-VDAQINIYD--IRKWDTPLRSLIDSHHDDVTALKFHPSD 164
               LD    L+  G  L G    QI +      KW T  +    +++  V  +++ P++
Sbjct: 280 EGYGLD-WSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTE 338

Query: 165 PTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGW 205
            TV  +  TDGY  ++D   +    A+    +   ++   W
Sbjct: 339 STVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISW 379

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 95/205 (46%), Gaps = 25/205 (12%)

Query: 23  FQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRVSN-LSINDLKILNSDFHCGSLF 78
           + PL K   LL    +G+++     T +    KQ    SN  SI D++   ++    ++F
Sbjct: 284 WSPLIKTGALLTGDCSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQWSRTE---STVF 340

Query: 79  STATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDAQINI 134
           +T+  +  ++I+D  S      I+T  +  +V  +S + + G LLA G +    D +  +
Sbjct: 341 ATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDD----DGRWGV 396

Query: 135 YDIRKWD-------TPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
           +D+R+          P+ +  D H   +T++ F+P D +++   S D    ++DL+ + +
Sbjct: 397 WDLRQLSPNNSENVQPV-AQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEAD 455

Query: 188 DDALHQVMNYASIHSCGWLSPNRIF 212
           D+ + Q    A       + P  +F
Sbjct: 456 DEEIKQ--QAAETKELQQIPPQLLF 478

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 48/117 (41%), Gaps = 6/117 (5%)

Query: 93  SNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIR----KWDTPLRSLI 148
           S   P+ T+ N  NV    LD    L+  G  L G D    +Y  +    KW T  +   
Sbjct: 263 SAKKPLHTIRNHGNVEGYGLD-WSPLIKTGALLTG-DCSGQVYLTQRHTSKWVTDKQPFT 320

Query: 149 DSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGW 205
            S++  +  +++  ++ TV  +   DGY  ++D   +    A+    +   ++   W
Sbjct: 321 FSNNKSIEDIQWSRTESTVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISW 377

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 53/111 (47%), Gaps = 7/111 (6%)

Query: 78  FSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDAQINIYD 136
           F+  ++  V++F   +    I T    K+V + +   + G LLAMG        ++++YD
Sbjct: 55  FAITSSTRVQLFSSRTRQ-VIKTFSRFKDVVYSASFRQDGKLLAMG----DATGRVSVYD 109

Query: 137 IRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
                  L S+  S H    A KFHP+D   L++ S D    V+D+TQ  E
Sbjct: 110 SYNPRAQLVSIAASSHPTHVA-KFHPADSRTLVTASDDRVVRVWDITQAQE 159

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 71/149 (47%), Gaps = 18/149 (12%)

Query: 62  INDLKILNSDFHCGSLFSTATAESV-KIFDINSNNGPIATLHNDKNVPFLSLDSRH---G 117
           +ND+K  N +     LF T + +S+ KI D+ ++N  I  +   +  PF +L   H    
Sbjct: 237 VNDIKWHNFN---EKLFGTVSEDSLLKINDVRAHNITIDAVKCPQ--PFNTLAFSHHSSN 291

Query: 118 LLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYT 177
           LLA      G+D+ + +YD+R    PL  +   H D VT ++F      V++S  +D   
Sbjct: 292 LLAAA----GMDSHVYLYDLRNMREPLHHM-SGHEDAVTNIEFSTHVDGVVVSSGSDNRL 346

Query: 178 NVYDLTQ----QDEDDALHQVMNYASIHS 202
            ++DL Q    Q  DDA   V     +H+
Sbjct: 347 IMWDLKQIGAEQTPDDAEDGVPELIMVHA 375

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 6/107 (5%)

Query: 75  GSLFSTATAESVK-IFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQIN 133
           G+L  +   +S+  ++D+ S    +    + K V  +   S    LA G    G D  +N
Sbjct: 320 GALICSGGLDSLAMVWDLRSGKNIVTLQGHAKPVYCVDWSSNSHQLATG----GGDGVVN 375

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVY 180
           ++D+RK + P   L+ +H   V++L+F  +   VL+SG  D   NVY
Sbjct: 376 VWDLRKLEQPATKLL-AHKSIVSSLRFERNRGDVLVSGGYDRALNVY 421

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 83/187 (44%), Gaps = 22/187 (11%)

Query: 20  CFKFQPLDKANGLLLSL-SNGEIHCLDFGTCQSKQSIRVSN---------LSINDLKILN 69
           C       +  G LLS  SNG IH  DF    S ++  ++N         L  N++  +N
Sbjct: 198 CLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLGCNEVTWMN 257

Query: 70  SDFHCGSLFSTATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHGLLAMGTELQ 126
                 S+F+T    + + +FD         I   +++  +     +  + +L    +  
Sbjct: 258 GH---NSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLASGDSN 314

Query: 127 GVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHP-SDPTVLLSGSTDGYTNVYDLTQQ 185
           G+   IN++DIRK + P+R+L   H   ++ +++ P  +  +   G  DG   ++D++ +
Sbjct: 315 GI---INLWDIRKLNKPIRNLY--HGSSISTIEWSPLMNEMIASGGQEDGLVKLWDISNE 369

Query: 186 DEDDALH 192
           +E   +H
Sbjct: 370 EEPIFIH 376

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 127 GVDAQINIYDIRKWDT---PLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           G    ++IYDI K +T   PL +++  H   + ++ F+ +  ++L+SGS DG   V+DL
Sbjct: 185 GTSTSVSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQDGCIKVWDL 243

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 76/173 (43%), Gaps = 14/173 (8%)

Query: 28  KANGLLLSLSNGEIHCLDFGTCQSKQ-SIRVSNLSINDLKILNSDF-----HCGSLFSTA 81
           KA  +  S SNG I   D    Q  Q +I    L I   K   +D      H   L +  
Sbjct: 205 KAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAGTNDVSWMVHHSSILAACG 264

Query: 82  TAESVKIFDINSNNG--PIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRK 139
            + ++ + D  + +   P     +   +  L  +  + +L    +  G    I ++D R 
Sbjct: 265 ESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNG---GIALWDCRA 321

Query: 140 WDTPLRSLIDSHHDDVTALKFHPSDPTVL-LSGSTDGYTNVYDLTQQDEDDAL 191
           +  PL   + +H D V+AL+++P+ PT++  +G  DG   ++D +++ ED  L
Sbjct: 322 FSKPLS--VFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWDTSREPEDSLL 372

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 96/204 (47%), Gaps = 24/204 (11%)

Query: 23  FQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRV-SNLSINDLKILNSDFHCGSLF 78
           + PL K   LL    +G +      + +    KQ   V +N SI D+K   S+    ++F
Sbjct: 292 WSPLIKTGALLTGDCSGRVFLTQRTSSKWITDKQPFTVDNNKSIEDIKWSPSE---NTVF 348

Query: 79  STATAES-VKIFDINSNN-GPIATLH-NDKNVPFLSLDSRHG-LLAMGTELQGVDAQINI 134
           +T   +  V+I+DI S    P  ++  +D +V  +S + +   LLA G +    +    +
Sbjct: 349 ATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDD----NGTWGV 404

Query: 135 YDIRKWD------TPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDED 188
           +D+R++       +P+ +  D H   +T++ F+P D +++   S D    ++DL+ + +D
Sbjct: 405 WDLRQFSNQQGGVSPV-AQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADD 463

Query: 189 DALHQVMNYASIHSCGWLSPNRIF 212
           + + Q    A +     + P  +F
Sbjct: 464 EEIKQ--QAAEVKELQQIPPQLLF 485

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 92/202 (45%), Gaps = 20/202 (9%)

Query: 5   PYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRVSN-L 60
           P   + SH      +   + P  +   LL    +G+I+     T +    KQ   VSN  
Sbjct: 265 PIHTIKSHG-NVEGYALDWSPSIQTGALLTGDCSGQIYFTQRHTSKWVTDKQPFTVSNNK 323

Query: 61  SINDLKILNSDFHCGSLFSTATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG 117
           SI D++   ++   G++F++A  +  ++I+D  S      I+   ++ +V  +S   + G
Sbjct: 324 SIEDIQWSRTE---GTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLG 380

Query: 118 LLAMGTELQGVDAQINIYDIRKWDTPLRSLI------DSHHDDVTALKFHPSDPTVLLSG 171
            L    +  GV     ++D+R++     + +      D H   +T++ F+P D +++   
Sbjct: 381 YLLASGDDNGV---WGVWDLRQFSPDTANSVQPVAQYDFHKGAITSISFNPLDESIVAVA 437

Query: 172 STDGYTNVYDLTQQDEDDALHQ 193
           S D    ++DL+ + +D+ + Q
Sbjct: 438 SEDNTVTLWDLSVEADDEEIKQ 459

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 73/168 (43%), Gaps = 17/168 (10%)

Query: 73  HCGSLFSTATAESVKIFDINSNNGPIA----TLHNDKNVPFLSLDSRHGLLAMGTELQGV 128
           H   L     + S+ + D  +  G ++    T H+ + +     +  + +L    +  G 
Sbjct: 262 HASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTG- 320

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSG-STDGYTNVYDLTQQDE 187
             ++N++DIR  +TPL+SL   H   ++  +++P+  T+L +   +DG   ++D+ Q+  
Sbjct: 321 --RVNLWDIRDLETPLKSL--DHGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPG 376

Query: 188 DDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEP 235
           ++ L        +H    L  N I    H         ND S +L  P
Sbjct: 377 EELLF-------VHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRP 417

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 94/186 (50%), Gaps = 23/186 (12%)

Query: 23  FQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRV-SNLSINDLKILNSDFHCGSLF 78
           + PL K+  LL    +G+I+     T +    KQ+  V +N SI D++   ++    ++F
Sbjct: 283 WSPLIKSGALLSGDCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTE---STVF 339

Query: 79  STATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDAQINI 134
           +TA  +  ++++D  S      I+   ++ +V  +S + + G LLA G +    +    +
Sbjct: 340 ATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDD----NGSWGV 395

Query: 135 YDIRKWDTPLRSL-------IDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
           +D+R++ TP  +         + H   +T++ F+P + +++  GS D    ++DL+ + +
Sbjct: 396 WDLRQF-TPDNAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEAD 454

Query: 188 DDALHQ 193
           D+ + Q
Sbjct: 455 DEEIKQ 460

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 47/113 (41%), Gaps = 6/113 (5%)

Query: 97  PIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIR----KWDTPLRSLIDSHH 152
           P+ T+ N  NV    LD    L+  G  L G D    IY  +    KW T  ++    ++
Sbjct: 266 PVHTIRNHGNVEGYGLD-WSPLIKSGALLSG-DCSGQIYLTQRHTSKWVTDKQAYSVGNN 323

Query: 153 DDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGW 205
             +  +++  ++ TV  +   DGY  V+D   +    A+    +   ++   W
Sbjct: 324 KSIEDIQWSKTESTVFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISW 376

>Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 56/117 (47%), Gaps = 7/117 (5%)

Query: 67  ILNSDFHC-GSLFSTATAESVK-IFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTE 124
           + +  F C GSL  +   +++  I+DI S N  +    + K V  ++  +    +A G  
Sbjct: 310 VFSLSFQCDGSLVCSGGMDTLSMIWDIRSGNKVMTLTGHSKPVYTVAWSTNGYQVATG-- 367

Query: 125 LQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSD-PTVLLSGSTDGYTNVY 180
             G D  IN++DIR+ D    S I +H + VT ++F   D    L+S   D   NVY
Sbjct: 368 --GGDGLINVWDIRQRDGGQVSQILAHRNIVTQVQFSKGDGGKKLVSSGYDNLINVY 422

>CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112w MDV1
          Length = 711

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 44/78 (56%), Gaps = 10/78 (12%)

Query: 106 NVPFL-SLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSD 164
           N P + S+ S    LA GT+    D  I ++D+R  +  +  +++ H D +T+LKF   D
Sbjct: 563 NTPIIGSIQSFDAALATGTK----DGLIRLWDMRTGE--VVRVLEGHMDAITSLKF---D 613

Query: 165 PTVLLSGSTDGYTNVYDL 182
            T ++SGS DG   ++DL
Sbjct: 614 ATTIISGSLDGTIRLWDL 631

>CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004c
          Length = 412

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 3/51 (5%)

Query: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           IN+YD  +W + L SL+ +H  DVT +K  PS+  VLLSGSTD    V+ L
Sbjct: 123 INVYD-HEWMSKL-SLVGAHVSDVTTVKIFPSNA-VLLSGSTDMQLKVWSL 170

>TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {ON}
           Anc_1.247 YKR036C
          Length = 730

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 38/66 (57%), Gaps = 9/66 (13%)

Query: 119 LAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTN 178
           LA GT+    D  I ++D+R  +   R LI  H D +T+LKF   D   ++SGS DG T 
Sbjct: 594 LATGTK----DGIIRLWDLRSGEIA-RKLI-GHQDAITSLKF---DTNNIISGSLDGSTR 644

Query: 179 VYDLTQ 184
           ++DL Q
Sbjct: 645 IWDLRQ 650

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 92/193 (47%), Gaps = 27/193 (13%)

Query: 16  SNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRVSN-LSINDLKILNSD 71
           +N+W     P+ K   +L    +G++      T +    KQ+  V+N  SI DL+   ++
Sbjct: 290 ANDWS----PIIKTGAMLSGDCSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTE 345

Query: 72  FHCGSLFSTATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQG 127
               ++F++   +  ++I+D  S      I+   ++ +V  +S   + G LLA G +   
Sbjct: 346 ---STVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDD--- 399

Query: 128 VDAQINIYDIRKWDTPLRSLIDS-------HHDDVTALKFHPSDPTVLLSGSTDGYTNVY 180
            D    ++D+R++ TP  +   S       H   +T++ F+P D +++   S D    ++
Sbjct: 400 -DGTWGVWDLRQF-TPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLW 457

Query: 181 DLTQQDEDDALHQ 193
           DL+ + +D+ + Q
Sbjct: 458 DLSVEADDEEIKQ 470

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 75/169 (44%), Gaps = 18/169 (10%)

Query: 32  LLLSLSNGEIHCLDFGTC-QSKQSIRVSNLS-------INDLKILNSDFHCGSLFSTATA 83
           L    SNG++   D     +SKQ + +           +ND+  + +  H   L S   +
Sbjct: 201 LATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVN--HTSILASCGES 258

Query: 84  ESVKIFDINSNNGPIATLHNDKN---VPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKW 140
             + + DI  +   + TLH   +   +  +  + ++ ++    + QG   Q+ I+DIR +
Sbjct: 259 NVIGLIDIRQDT-KMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQG---QLKIWDIRDF 314

Query: 141 DTPLRSLIDSHHDDVTALKFHPSDPTVLLSG-STDGYTNVYDLTQQDED 188
             P++       D ++A++++P  P +L +     G   ++D + + ED
Sbjct: 315 KEPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWDASGEQED 363

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 82/169 (48%), Gaps = 16/169 (9%)

Query: 19  WCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLKILNSDFHCGSLF 78
           W  +F P    N L  + SN +   L   +C     +RV    +ND+  ++   +   +F
Sbjct: 620 WDVEFSP--SCNNLFATASNDQTARL--WSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIF 675

Query: 79  STATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDI- 137
           + ++ ++V+++DIN+ +     + ++  V  LS+      ++ G++    D  I I+DI 
Sbjct: 676 TGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGKWISTGSD----DGIITIWDIG 731

Query: 138 --RKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ 184
             RK    L+++       + +L ++P + T+L+SG  D    V+DL +
Sbjct: 732 SGRK----LKNMRGHGKSSIHSLSYNP-EGTLLVSGGADQSVRVWDLNK 775

>KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}
           Anc_7.534 YPR178W
          Length = 461

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 127 GVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVY 180
           G D  INI+DIRK  T L + I +H++ ++ L+F   D   L+S S D   N+Y
Sbjct: 366 GGDGLINIWDIRK--TNLVNTILAHNNIISDLRFAKQDSKCLVSCSYDKKINIY 417

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDED 188
           D    +YDIR+    L S+ D    D   L++HP D TV   G  DG    +DL+Q+++ 
Sbjct: 271 DKTCKVYDIRQQAKELFSVRDD--VDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQENQP 328

Query: 189 DALHQVMNYA 198
           +     + YA
Sbjct: 329 NKPTHNIPYA 338

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 72/157 (45%), Gaps = 21/157 (13%)

Query: 75  GSLFSTATAESVKI-FDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQIN 133
           GSL +TA A+ V I +D+ S    ++ + + K + + S  S++G     +     D  I 
Sbjct: 322 GSLIATAGADKVGIIWDLRSGKNILSLVGHAKPI-YCSDWSQNGYQXXXSG----DGTIK 376

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL-------TQQD 186
           I+D+RK D      I +H + VT LKF   +   L+S S D   NV+         T Q 
Sbjct: 377 IWDLRKVDDV--ETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQG 434

Query: 187 EDDALHQV---MNYASIHSCGWLSPNRIFTLSHMETF 220
            +D +  +    +Y +I S GW   +R   L  ME  
Sbjct: 435 HNDKILSIDISSDYQTIVSGGW---DRSVKLWSMEAI 468

>Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa]
           {ON} YBR175W (SWD3) - YBR175W [contig 22] FULL
          Length = 316

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 128 VDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
           +D  I I+DI    T LR+L  +H + V ++   P DP++L SGS DG   ++D
Sbjct: 119 MDESIKIWDILS-GTLLRTL-SAHSEPVVSIDLPPFDPSILSSGSYDGLIRIFD 170

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 89/186 (47%), Gaps = 23/186 (12%)

Query: 23  FQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRV-SNLSINDLKILNSDFHCGSLF 78
           + PL K   +L    +G ++       +    KQ   V +N SI D++   ++    ++F
Sbjct: 292 WSPLIKTGSILTGDCSGRVYLTQRTASRWVTDKQPFTVGNNKSIEDIQWSRAEM---TVF 348

Query: 79  STATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDAQINI 134
           +T   +  ++I+D  S      ++ + +D +V  +S + + G LLA G +         +
Sbjct: 349 ATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDD----SGTWGV 404

Query: 135 YDIRKWD-------TPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
           +D+R++        TP+ +  + H   +T++ F+P D +++   S D    ++DL+ + +
Sbjct: 405 WDLRQFSAQNTEKTTPV-AQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEAD 463

Query: 188 DDALHQ 193
           D+ + Q
Sbjct: 464 DEEIKQ 469

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 94/203 (46%), Gaps = 22/203 (10%)

Query: 5   PYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRVSN-L 60
           P   + SH      +   + PL K   LL    +G+++     T +    K+   V+N  
Sbjct: 273 PIHTIKSHG-NVEGYALDWSPLIKTGALLTGDCSGQVYLTQRHTSKWISDKEPFTVANNQ 331

Query: 61  SINDLKILNSDFHCGSLFSTATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG 117
           S+ D++   ++    ++F++   +  ++++D  S      I+   ++ +V  +S   + G
Sbjct: 332 SVEDIQWSRTE---STVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIG 388

Query: 118 -LLAMGTELQGVDAQINIYDIRKW------DTPLRSLIDSHHDDVTALKFHPSDPTVLLS 170
            LLA G +    +    ++D+R++      +T   +  D H   +T++ F+P D +++  
Sbjct: 389 YLLASGDD----NGTWGVWDLRQFSPSNSNNTSPVAQYDFHKGAITSISFNPLDESIVAV 444

Query: 171 GSTDGYTNVYDLTQQDEDDALHQ 193
            S D    ++DL+ + +D+ + Q
Sbjct: 445 ASEDNTVTLWDLSVEADDEEIKQ 467

>Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 110 LSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLL 169
           +SL+   GLLA+G    G D   +++DI   D P++  +  H   V A+ F P   ++L 
Sbjct: 396 ISLNEHSGLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 170 SG 171
           +G
Sbjct: 452 TG 453

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 81/179 (45%), Gaps = 28/179 (15%)

Query: 47  GTCQSKQSIRVSNLSINDLKILNSDFHCGSLF-STATAESVKIFDIN--SNNGPIATLHN 103
           G  Q  +++  S + IN+   L  +    +L  S+ +   ++++DI   S++ PI     
Sbjct: 185 GVIQDVETMDTSLVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPII---- 240

Query: 104 DKNVPFLSLDS-------------RHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDS 150
             +VP +S+DS                L A  TE   V    ++ D+R     L+S    
Sbjct: 241 --DVPLMSIDSDGSSVNDVTWMPTHDSLFAACTERNAV----SLLDLRTKKEKLKSNCKI 294

Query: 151 HHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGWLSPN 209
           H   V + KF+  +  +L S  ++G  N++D+   +E + +  + + AS+ +  W SPN
Sbjct: 295 HGGGVNSCKFNYKNSLILASADSNGRLNLWDIRNMNE-NPIATMEHGASVSTLEW-SPN 351

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 92/218 (42%), Gaps = 24/218 (11%)

Query: 115 RHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTD 174
           R   ++   E++ + +   I D+   DT   SL+D   ++ T+L ++     +LLS  ++
Sbjct: 168 RQSKISHPFEIKLLGSHGVIQDVETMDT---SLVDI--NEATSLAWNLQQEALLLSSHSN 222

Query: 175 GYTNVYDLTQQDEDDALHQV------MNYASIHSCGWLSPNRIFTLSHMETFAIH--ELN 226
           G   V+D+ Q   D+ +  V       + +S++   W+  +     +  E  A+   +L 
Sbjct: 223 GQIQVWDIKQYSHDNPIIDVPLMSIDSDGSSVNDVTWMPTHDSLFAACTERNAVSLLDLR 282

Query: 227 DKSEELKEPQPLDFGDVREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKD 286
            K E+LK    +  G V     C +  +     I A  S + NG+L L      N    +
Sbjct: 283 TKKEKLKSNCKIHGGGVN---SCKF--NYKNSLILA--SADSNGRLNLWDIRNMN----E 331

Query: 287 SVVIPSAHGDEVIRDVFIPPSHSELVYSCGEDGFVNLW 324
           + +    HG  V    + P   + L  +  EDG V LW
Sbjct: 332 NPIATMEHGASVSTLEWSPNFDTVLATAGQEDGLVKLW 369

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 51/121 (42%), Gaps = 25/121 (20%)

Query: 65  LKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTE 124
           L + N D    SL  T T ++  I D+       A  HN KN                  
Sbjct: 145 LDLFNIDQKAASL-RTTTRKTSTISDVK------AGFHNYKNY---------------VA 182

Query: 125 LQGVDAQINIYDIRKW---DTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
           + G    ++IYDI +    D P   ++  H   + ++ F+ +  ++L+SGS DG   V+D
Sbjct: 183 ICGTSTSVSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCIKVWD 242

Query: 182 L 182
           L
Sbjct: 243 L 243

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 127 GVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL---- 182
           G DA + ++D RK    L S+   H + VT+L+F      +L SG +D    ++DL    
Sbjct: 266 GTDAMVYLFDSRKPTEALHSM-SGHQEAVTSLEFAHHKDGILCSGGSDRRVLLWDLFQIG 324

Query: 183 TQQDEDDA 190
           T+Q E+DA
Sbjct: 325 TEQQEEDA 332

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
           D  I I+DI+   T   S+   H D V   K+H SDP +  S S D +  ++D
Sbjct: 181 DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233

>SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar to
           uniprot|P38123 Saccharomyces cerevisiae YBR175W SWD3
           Subunit of the COMPASS complex which methylates histone
           H3 on lysine 4 and is required in transcriptional
           silencing near telomeres
          Length = 314

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 49/114 (42%), Gaps = 10/114 (8%)

Query: 74  CGSLFSTATAESVKIFDINSNNGPIATLHN--DKNVPFLSL--DSRHGLLAMGTELQGVD 129
           C S  S   A +   F I  N+     LH       P LSL   S+  LL   +    +D
Sbjct: 63  CWSPDSQCIATASDDFTIEINHITYGRLHRLVGHTAPVLSLVYTSKGNLLCSAS----MD 118

Query: 130 AQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
             I I+D+      L   I +H + V ++     DP++L SGS DG   ++D T
Sbjct: 119 ESIKIWDVLT--GTLLKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTT 170

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 91/190 (47%), Gaps = 23/190 (12%)

Query: 19  WCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRV-SNLSINDLKILNSDFHC 74
           +   + PL K   LL    +G+I+     T +    KQ   V +N S+ D++   ++   
Sbjct: 282 YALDWSPLIKTGALLTGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKSVEDIQWSRTE--- 338

Query: 75  GSLFSTATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDA 130
            ++F++   +  V+I+D  S      ++   ++ +V  +S + + G LLA G +    + 
Sbjct: 339 ATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDD----NG 394

Query: 131 QINIYDIRKWDTPLR-------SLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
              ++D+R++ TP         +  D H   +T++ F+P + +++   S D    ++DL+
Sbjct: 395 SWGVWDLRQF-TPDNINNVQPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLS 453

Query: 184 QQDEDDALHQ 193
            + +D+ + Q
Sbjct: 454 VEADDEEIKQ 463

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 6/117 (5%)

Query: 93  SNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIY----DIRKWDTPLRSLI 148
           S+  P+ T+ N  NV   +LD    L+  G  L G D    IY    +  KW T  +   
Sbjct: 265 SSKRPVHTIKNHGNVEGYALD-WSPLIKTGALLTG-DCSGQIYLTQRNTSKWVTDKQPFT 322

Query: 149 DSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGW 205
             ++  V  +++  ++ TV  S   DGY  ++D   +    AL    +   ++   W
Sbjct: 323 VGNNKSVEDIQWSRTEATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISW 379

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 127 GVDAQINIYDIRKW---DTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           G    +++YDI K    D PL + +  H   + ++ F+ S   +L+SG  DG   V+DL
Sbjct: 201 GTSTSVSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCIKVWDL 259

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 90/194 (46%), Gaps = 26/194 (13%)

Query: 17  NNWCFKFQPLDKANGLLLSLSN-GEIHCLDFGTCQSKQSIRVSNLSINDLKILNSDFHC- 74
           N +   F P   A G L+S S+   I   D    + KQ I+    S +D+ + +  +HC 
Sbjct: 153 NAYGLAFNP--NAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDI-VNDCQWHCF 209

Query: 75  -GSLFSTATAES-VKIFDINSNNGP----IATLHNDKNVPFLSLDSRHGLLAMGTELQGV 128
             ++F + + +S +++FD   N G     I++     ++ F    S +   A GT     
Sbjct: 210 NTNMFGSVSEDSTLQLFD-KRNGGKSDVKISSKGQYNSIAFSGF-SENLFAAAGTT---- 263

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL------ 182
              I +YDIR     L S+   H + VT+L+F      +L+SGS+D    ++DL      
Sbjct: 264 -NNIYLYDIRNTGKILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAE 321

Query: 183 TQQDE-DDALHQVM 195
            Q DE DD L +VM
Sbjct: 322 QQPDEADDGLPEVM 335

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 11/84 (13%)

Query: 129 DAQINIYDI-RKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
           +  I IYD  R   + L S +  H D+   L F+P+    L+SGS D    ++D T    
Sbjct: 127 EGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDAT---- 182

Query: 188 DDALHQ-VMNYASIHS-----CGW 205
           +D L Q +  + + HS     C W
Sbjct: 183 NDKLKQPIQEWTTSHSDIVNDCQW 206

>Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124C
           (DSE1) - Daughter Specific Expression 1 [contig 210]
           FULL
          Length = 553

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 3/73 (4%)

Query: 128 VDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
           +D Q+ ++DIR   T  +  ++ H   +  LK+H +D   L S   +GYT  +DL   D 
Sbjct: 316 IDNQVKVWDIRS--TGAKCTVNGHKGSIKGLKYH-NDTRRLYSSDDEGYTIAWDLQGIDN 372

Query: 188 DDALHQVMNYASI 200
               H    + SI
Sbjct: 373 VSECHLATGFLSI 385

>KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 459

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 76/152 (50%), Gaps = 20/152 (13%)

Query: 66  KILNSDFHC-GSLFSTATAESVK-IFDINSNNGPIATLHNDKNVPFLSLD-SRHGL-LAM 121
           ++ +  FH  GSL STA  +++  I+DI S    ++   + K  P  S+D S++G  LA 
Sbjct: 307 EVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSK--PIYSVDWSQNGYQLAS 364

Query: 122 GTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
           G+     D  I ++DIRK        I +H+  V+ +KF+  +   L+S   D   N+++
Sbjct: 365 GSG----DGTIKVWDIRKKGNV--ETILAHNSIVSQVKFNKQNGGYLVSSGYDKKVNIFN 418

Query: 182 ----LTQQDEDDALHQVMNY----ASIHSCGW 205
               + ++  +  L +VM+       I+S GW
Sbjct: 419 DGNWIKERSLEGHLDKVMSIDIVGPDIYSAGW 450

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 93/200 (46%), Gaps = 30/200 (15%)

Query: 21  FKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLKILNSDFHCGS--LF 78
           F + P+D    LL+S S+ +  C+ +   QS   ++ + L  +D ++ +  F   S  LF
Sbjct: 238 FHWNPID--TNLLIS-SSIDTTCIVWD-LQSSNYVK-TQLIAHDSEVYDVRFLTQSTQLF 292

Query: 79  STATAE-SVKIFDINS-------NNGPIATLHNDKN-VPFLSLD-SRHGLLAMGTELQGV 128
           ++   + SV++FD+ S          P++ L+ D +    L L+ S H    M T     
Sbjct: 293 ASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMAT-FAAD 351

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL------ 182
             +I I D+R  ++PL  +++ H   V  +K+HP    VLLSG  D     +DL      
Sbjct: 352 SNKILILDMRNPESPLM-ILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTAS 410

Query: 183 -----TQQDEDDALHQVMNY 197
                T +D+D A+ +   Y
Sbjct: 411 SDPVATTKDDDIAMDEEQGY 430

>YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 465

 Score = 37.0 bits (84), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 57/121 (47%), Gaps = 7/121 (5%)

Query: 63  NDLKILNSDFHC-GSLFSTATAESVK-IFDINSNNGPIATLHNDKNVPFLSLDSRHGLLA 120
           +D  + +  F C GSL  +   +S+  ++DI S +  +    + K +  ++       +A
Sbjct: 306 HDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVA 365

Query: 121 MGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSD-PTVLLSGSTDGYTNV 179
            G    G D  IN++DIRK D    + I +H + VT ++F   D    L+S   D   NV
Sbjct: 366 TG----GGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINV 421

Query: 180 Y 180
           Y
Sbjct: 422 Y 422

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 66/137 (48%), Gaps = 10/137 (7%)

Query: 66  KILNSDFH-CGSLFSTATAESV-KIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGT 123
           +I +  +H  G    +A+ +   +++D +++   +    +DK V  LS      L+  G 
Sbjct: 267 RISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSG- 325

Query: 124 ELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
              G+D+   ++DIR     +   +  H   +  + + P+   V  +G  DG  NV+D+ 
Sbjct: 326 ---GMDSLSMLWDIRSGSKVM--TLAGHSKPIYTVAWSPNGYQVA-TGGGDGIINVWDIR 379

Query: 184 QQDEDDALHQVMNYASI 200
           ++DE   L+Q++ + +I
Sbjct: 380 KRDEGQ-LNQILAHRNI 395

>KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa]
           {ON} similar to uniprot|P38123 Saccharomyces cerevisiae
           YBR175W SWD3 Subunit of the COMPASS complex which
           methylates histone H3 on lysine 4 and is required in
           transcriptional silencing near telomeres
          Length = 316

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 128 VDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
           +D  I ++DI    T LR+L  +H + V ++   P DP++L SGS DG   ++D
Sbjct: 119 MDESIKVWDILT-GTLLRTL-SAHSEPVVSIDIPPFDPSILSSGSYDGLIRIFD 170

>Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 7/112 (6%)

Query: 72  FHC-GSLFSTATAESVK-IFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVD 129
           F C GSL  +   +S+  I+DI S N  ++   + K V  +        +A G    G D
Sbjct: 315 FQCDGSLVCSGGMDSLAMIWDIRSGNKVMSLTGHSKPVYTVDWSPNGYQVATG----GGD 370

Query: 130 AQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSD-PTVLLSGSTDGYTNVY 180
             IN++DIR+ D      I +H + VT ++F   D    L+S   D   NVY
Sbjct: 371 GLINVWDIRQRDGGQVHQILAHRNIVTKVQFSKDDNGKKLISCGYDNLINVY 422

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 4/74 (5%)

Query: 127 GVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQD 186
           G+D+   I+DIR  +  +   +  H   V  + + P+   V  +G  DG  NV+D+ Q+D
Sbjct: 326 GMDSLAMIWDIRSGNKVMS--LTGHSKPVYTVDWSPNGYQVA-TGGGDGLINVWDIRQRD 382

Query: 187 EDDALHQVMNYASI 200
               +HQ++ + +I
Sbjct: 383 -GGQVHQILAHRNI 395

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 37.0 bits (84), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 2/32 (6%)

Query: 293 AHGDEVIRDVFIPPSHSELVYSCGEDGFVNLW 324
           AH D +++  F+P SH+   +SCG+DG V  W
Sbjct: 607 AHSDSIMKVAFLPESHN--FFSCGKDGLVKYW 636

>NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.338
           YLR208W
          Length = 300

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 6/80 (7%)

Query: 250 DYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPPSHS 309
           D V+D Y   +A   S +    +K+    GEN  + D+++    H   V R  +  P   
Sbjct: 14  DAVLDYYGKRLATCSSDK---TIKIFEVEGENYKLIDTLI---GHEGPVWRVDWAHPKFG 67

Query: 310 ELVYSCGEDGFVNLWKNNNG 329
            ++ SC  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 17/125 (13%)

Query: 64  DLKILNSDFHCGS------LFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHG 117
           D KI + D   G       L  T T   +K+   + NNG  A L   +     +L   + 
Sbjct: 443 DKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNG--ACLLGTEAPMIGALQCYNS 500

Query: 118 LLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYT 177
            LA GT+    D  + ++D+R    P+R L++ H D +T+LKF   D   L++GS D   
Sbjct: 501 ALATGTK----DGIVRLWDLRV-GKPVR-LLEGHTDGITSLKF---DSEKLVTGSMDNSV 551

Query: 178 NVYDL 182
            ++DL
Sbjct: 552 RIWDL 556

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 55/125 (44%), Gaps = 10/125 (8%)

Query: 86  VKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLR 145
           V+IFD+N        L +   V  LS +S   +L  G+     D  I   D+R  D P  
Sbjct: 327 VEIFDVNKKKCIRTMLGHSDRVACLSWNSY--ILTSGSR----DHNILHRDVRSPD-PFF 379

Query: 146 SLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGW 205
             I+SH  +V  LK++  D   L+SG  D   NVYD T       +    + A++ +  W
Sbjct: 380 EKIESHSQEVCGLKWN-VDENKLVSGGNDNIVNVYDRTSTKP--FMTMTEHKAAVKALDW 436

Query: 206 LSPNR 210
            S  R
Sbjct: 437 SSHKR 441

>Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}
           YGL128C (REAL)
          Length = 283

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 21/77 (27%)

Query: 122 GTELQGV-DAQINIYDIRKWDTPLRSLIDSHHDDV---------TALKF----HPSDPTV 167
           G ELQ V + ++N+YDI +  TPL +  D+ HDD+          ALK+    HP+DP++
Sbjct: 3   GHELQEVINQRLNLYDILELPTPLEA--DTIHDDLPQIKRKYRSLALKYHPDKHPNDPSI 60

Query: 168 -----LLSGSTDGYTNV 179
                LLS +T+  TN 
Sbjct: 61  IHKFHLLSTATNILTNT 77

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 39/190 (20%), Positives = 90/190 (47%), Gaps = 23/190 (12%)

Query: 19  WCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRV-SNLSINDLKILNSDFHC 74
           +   + PL+K+  LL    +G ++     T +    K +    +N SI D++   ++   
Sbjct: 289 YALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTE--- 345

Query: 75  GSLFSTATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDA 130
            ++F+T   +  ++I+D  S      I+   +  +V  +S + + G LLA G +    + 
Sbjct: 346 ATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDD----NG 401

Query: 131 QINIYDIRKWD-------TPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
              ++D+R++        +P+ +    H   +T++ F+P D +++   S D    ++DL+
Sbjct: 402 TWGVWDLRQFSPNNAASVSPV-AQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLS 460

Query: 184 QQDEDDALHQ 193
            + +D+ + Q
Sbjct: 461 VEADDEEIKQ 470

>TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {ON}
           Anc_6.239 YGL137W
          Length = 866

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 68/165 (41%), Gaps = 28/165 (16%)

Query: 32  LLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLK--------ILNSDFHCGSLFSTATA 83
           +L +L +G +   ++ T Q  +SI+V+   +   +        I+ SD     +F+  T 
Sbjct: 28  VLTTLYSGRVEIWNYETKQEVRSIQVTETPVRTGRFIARKNWIIVGSDDFKIRVFNYNTG 87

Query: 84  ESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVD-AQINIYDIRK-WD 141
           E V  F+ + +      +H  K  P++              L G D   + +++  K W+
Sbjct: 88  EKVVDFEAHPDYIRSIAVHPTK--PYV--------------LSGSDDLTVKLWNWEKSWE 131

Query: 142 TPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQD 186
             L    D H   V  + F+P DP+   S   D    V+ L QQD
Sbjct: 132 --LEQQFDGHTHFVMCVTFNPKDPSTFASACLDRTVKVWSLGQQD 174

>KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 705

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 63/133 (47%), Gaps = 24/133 (18%)

Query: 64  DLKILNSDFHCGSLFSTATAE-SVKIFDINSNNGPIATLHND-KNVPFLSLDSRHGLLAM 121
           D+  L+ D   G++ S  + + SVK++D+ S    IATLH    ++  + +D    L+  
Sbjct: 399 DITCLDFDMPFGTMCSAGSLDHSVKVWDL-SKKKQIATLHGHLASISCMQIDQYSTLITG 457

Query: 122 GTELQGVDAQINIYDIRKW------------DTPLRSLIDSHHDDVTALKFHPSDPTVLL 169
           G      DA + ++DI K             D  L +  DSH D++TA+ F   D   L+
Sbjct: 458 GR-----DAVLKLWDIDKAMADEASNSSEDNDACLYTF-DSHVDEITAISF---DGDNLV 508

Query: 170 SGSTDGYTNVYDL 182
           SGS D     +DL
Sbjct: 509 SGSQDRTVRQWDL 521

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 127 GVDAQINIYDIRKW---DTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           G    ++IYDI +    D+PL + +  H   + ++ F+     +L+SG  DG   V+DL
Sbjct: 203 GTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKVWDL 261

>CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 aa]
           {ON} highly similar to uniprot|P41811 Saccharomyces
           cerevisiae YGL137w SEC27
          Length = 902

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/161 (19%), Positives = 66/161 (40%), Gaps = 8/161 (4%)

Query: 32  LLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLKILNSDFHCGSLFSTATAESVKIFDI 91
           +L +L +G +   ++ T Q  +SI+V++  +   K +        +   +    V++F+ 
Sbjct: 28  VLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFIT---RKNWIVVGSDDNKVRVFNY 84

Query: 92  NSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSH 151
           N+       + +   +  +++      +  G++    D  + +++    D  L      H
Sbjct: 85  NTGEKVADFVAHPDYIRSIAVHPSKPYILTGSD----DLTVKLWNWEN-DWSLEQTFKGH 139

Query: 152 HDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALH 192
              V  + F+P DP V  SG  D    V+ L Q   +  LH
Sbjct: 140 EHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLH 180

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 44/222 (19%), Positives = 99/222 (44%), Gaps = 24/222 (10%)

Query: 5   PYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRV-SNL 60
           P   + SH      +   + PL+K+  LL    +G ++     T +    K +    +N 
Sbjct: 275 PIHTVRSHG-NVEGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQ 333

Query: 61  SINDLKILNSDFHCGSLFSTATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHG 117
           SI D++   ++    ++F++   +  ++I+D  S      I+   +  +V  +S + + G
Sbjct: 334 SIEDIQFSRTE---ATVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISWNEKIG 390

Query: 118 -LLAMGTELQGVDAQINIYDIRKWD------TPLRSLIDSHHDDVTALKFHPSDPTVLLS 170
            LLA G +    +    ++D+R++       T   +  + H   +T++ F+P D +++  
Sbjct: 391 YLLASGDD----NGSWGVWDLRQFSPNTAASTSPVAQYNFHKGAITSISFNPLDDSIIAV 446

Query: 171 GSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGWLSPNRIF 212
            S D   +++DL+ + +D+ + Q    A       + P  +F
Sbjct: 447 ASEDNTVSLWDLSVEADDEEIKQ--QAAETRELQEIPPQLLF 486

>KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.119
           YGL004C
          Length = 409

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 31/46 (67%), Gaps = 3/46 (6%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTD 174
           +  I +Y+  K++T +R + D+H  D+T+LKF PS   VLLS STD
Sbjct: 120 NGNIAVYNA-KYET-VREIEDAHASDITSLKFFPSGE-VLLSASTD 162

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 7/107 (6%)

Query: 75  GSLFSTATAESV-KIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQIN 133
           GSL  +A  +    I+DI S N  +    + K  P  S+D       + T     D  +N
Sbjct: 319 GSLLCSAGLDCTGMIWDIRSGNCAMVLSGHTK--PIYSVDWSPRGFEVAT--ASGDGTVN 374

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVY 180
           I+DIRK + P   ++ +H+  V+ ++F   +   L+S   D   NVY
Sbjct: 375 IWDIRKTNQP--QVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVY 419

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 9/72 (12%)

Query: 111 SLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLS 170
           +L   +  LA GT+    D  + ++D+R    P+RSL + H D +T+LKF   D   L++
Sbjct: 497 ALQCYNSALATGTK----DGVVRLWDLR-IGKPVRSL-EGHTDGITSLKF---DSEKLVT 547

Query: 171 GSTDGYTNVYDL 182
           GS D    ++DL
Sbjct: 548 GSMDNSVRIWDL 559

>YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {ON}
            AMA1Activator of meiotic anaphase promoting complex
           (APC/C); Cdc20p family member; required for initiation
           of spore wall assembly; required for Clb1p degradation
           during meiosis
          Length = 593

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 110 LSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLL 169
           +SL+    LLA+G    G D   +++DI   D P++  +  H   V A+ F P   ++L 
Sbjct: 396 ISLNEHANLLAVG----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 170 SG 171
           +G
Sbjct: 452 TG 453

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 37/188 (19%), Positives = 87/188 (46%), Gaps = 19/188 (10%)

Query: 19  WCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQ---SKQSIRV-SNLSINDLKILNSDFHC 74
           +   + P+ K   LL    +G+I+     T +    KQ     +N S+ D++   ++   
Sbjct: 283 YALDWSPMIKNGALLTGDCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTE--- 339

Query: 75  GSLFSTATAES-VKIFDINSNN--GPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQ 131
            ++F++A  +  ++I+D  S      ++   ++ +V  +S   + G L    +  G+   
Sbjct: 340 STVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGL--- 396

Query: 132 INIYDIRKW------DTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185
             ++D+R++      D    +  D H   +T++ F+P D +++   S D    ++DL+ +
Sbjct: 397 WGVWDLRQFSPDNINDVQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVE 456

Query: 186 DEDDALHQ 193
            +D+ + Q
Sbjct: 457 ADDEEIKQ 464

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 66/162 (40%), Gaps = 13/162 (8%)

Query: 55  IRVSNLSINDLKIL------NSDFHCGSLFSTATAESVKIFDI-NSNNGPIATLHNDKNV 107
           ++VS  +  D ++L      N + +   L   + A S   + I  +   PI T+ N  NV
Sbjct: 221 LKVSPFASTDKEVLTATMSENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNV 280

Query: 108 PFLSLDSRHGLLAMGTELQGVDAQINIYDIR----KWDTPLRSLIDSHHDDVTALKFHPS 163
              +LD    ++  G  L G D    IY  +    KW T  +     ++  V  +++  +
Sbjct: 281 EGYALD-WSPMIKNGALLTG-DCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRT 338

Query: 164 DPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGW 205
           + TV  S   DGY  ++D   +    AL    +   ++   W
Sbjct: 339 ESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISW 380

>TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.247
           YKR036C
          Length = 719

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 9/64 (14%)

Query: 119 LAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTN 178
           LA GT+    D  + ++D+R    P+R+L + H D VTALKF   D + +++ S+D    
Sbjct: 574 LATGTK----DGIVRLWDLRSG-VPVRTL-EGHTDAVTALKF---DSSSIVTASSDKQVR 624

Query: 179 VYDL 182
           ++DL
Sbjct: 625 IWDL 628

>Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 110 LSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLL 169
           +SL+    LLA+G    G D   +++DI   D P++  +  H   V A+ F P   ++L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 170 SG 171
           +G
Sbjct: 452 TG 453

>Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178W
           (REAL)
          Length = 470

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 7/117 (5%)

Query: 67  ILNSDFHC-GSLFSTATAESVK-IFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTE 124
           + +  F C GSL  +   +S+  ++DI S +  +    + K V  ++       +A G  
Sbjct: 315 VFSLSFQCDGSLVCSGGMDSLTMLWDIRSGSKVMTLAGHSKPVYTVAWSPNGYQVATG-- 372

Query: 125 LQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSD-PTVLLSGSTDGYTNVY 180
             G D  IN++DIR+ D    + I +H + VT +KF   D    L+S   D   N+Y
Sbjct: 373 --GGDGLINVWDIRQRDEGQLNQILAHRNIVTQVKFSNDDGGKKLVSCGYDNLINIY 427

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 87  KIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRS 146
           +++D +++   +    + K V  LS      L+  G    G+D+   ++DIR     +  
Sbjct: 295 RLWDASTHQELLLQEGHSKGVFSLSFQCDGSLVCSG----GMDSLTMLWDIRSGSKVM-- 348

Query: 147 LIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASI 200
            +  H   V  + + P+   V  +G  DG  NV+D+ Q+DE   L+Q++ + +I
Sbjct: 349 TLAGHSKPVYTVAWSPNGYQVA-TGGGDGLINVWDIRQRDEGQ-LNQILAHRNI 400

>Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W
           (REAL)
          Length = 205

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query: 102 HNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFH 161
            ND  +  +SL+    LLA+G    G D   +++DI   D P++  +  H   V A+ F 
Sbjct: 1   QNDTTIG-ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFC 55

Query: 162 PSDPTVLLSG 171
           P   ++L +G
Sbjct: 56  PWSKSLLATG 65

>Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON}
           (27192..29201) [2010 nt, 670 aa]
          Length = 669

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 21/98 (21%)

Query: 111 SLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLS 170
           SL      LA GT+    D  I ++D+R     +  +++ H D +T+LKF   D T L++
Sbjct: 525 SLQCFESALASGTK----DGLIRLWDLRS--GKVIRILEGHTDAITSLKF---DMTNLIT 575

Query: 171 GSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGWLSP 208
           GS D    ++D+             N++ ++S G+ SP
Sbjct: 576 GSLDKNIRIWDM------------RNWSLVNSYGYQSP 601

>Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782
           bp, 593 aa] {ON} YGR225W (REAL)
          Length = 593

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 110 LSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLL 169
           +SL+    LLA+G    G D   +++DI   D P++  +  H   V A+ F P   ++L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 170 SG 171
           +G
Sbjct: 452 TG 453

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
           similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 127 GVDAQINIYDIRKWD---TPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           G    ++IYDI +     +PL +    H   + ++ F+     +++SG  DGY  V+DL
Sbjct: 213 GTSTSLSIYDINRTSDIGSPLVATYSEHSRSINSVDFNMGQTNLIISGGQDGYIKVWDL 271

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 132 INIYDIRK---WDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           I+IYDI K    D PL +    H   V +  F+ +  ++L+SG  DG   ++DL
Sbjct: 208 ISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQIKIWDL 261

>Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W
           (WTM2) - Transcriptional modulator [contig 67] FULL
          Length = 381

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           D +I  YD R    PL  + D H   +T     P+  T+ ++GS  G   ++DL
Sbjct: 186 DNKIRFYDTRGDGKPLWEVCDPHDGRLTCFDVSPALETLFVTGSDTGVLKLWDL 239

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDED 188
           + ++D+RK  +PL S+++ H   V ++ F+P + T ++S   DG    +D  + +++
Sbjct: 182 VYVWDVRKGTSPL-SVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

>ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {ON}
           highly similar to uniprot|Q04491 Saccharomyces
           cerevisiae YLR208W SEC13 Component of both the Nup84
           nuclear pore sub-complex and of the COPII complex (Sar1p
           Sec13p Sec16p Sec23p Sec24p Sec31p Sfb2p and Sfb3p)
           which is important for the formation of ER to Golgi
           transport vesicles
          Length = 294

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 250 DYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPPSHS 309
           D V+D Y   +A   S +    +K+    GE   + +++   S H   V R  +  P   
Sbjct: 14  DAVLDYYGRRLATCSSDK---TIKIFEVEGETHKLVETL---SGHEGPVWRVAWAHPKFG 67

Query: 310 ELVYSCGEDGFVNLWKNNNGALN 332
            ++ SC  DG V +WK  NG+ +
Sbjct: 68  TILASCSYDGKVLIWKEENGSWD 90

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (44%), Gaps = 5/110 (4%)

Query: 78  FSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDI 137
           F+  ++  V++F   +    I T    K+V + +   + G L    +  G+   +++YD 
Sbjct: 55  FAVTSSTRVQVFSSRTRQA-IKTFSRFKDVVYSASYRKDGKLLCAGDATGL---VSVYDS 110

Query: 138 RKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
               T L S+  S H      KFH  D   L+S S D  T V+D++   E
Sbjct: 111 YNPRTLLVSVAASQHP-THVTKFHDHDLKTLVSASDDRVTRVWDISHAYE 159

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 293 AHGDEVIRDVFIPPSHSELVYSCGEDGFVNLW 324
           AH D +++ VF+P SH+   +SC +D  V  W
Sbjct: 607 AHNDSIMKVVFVPESHN--FFSCSKDALVKYW 636

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 70/163 (42%), Gaps = 13/163 (7%)

Query: 40  EIHCLDFGTCQSKQSIRVSNLSINDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIA 99
           EI+ +D      K   ++SN    ++  L        L   + A+ +KIF + +    + 
Sbjct: 39  EINIIDLTADSRKILHKISNEDEQEITALQLTPDGQYLTYVSQAQLLKIFQLKTGK-VVR 97

Query: 100 TLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALK 159
           ++        L  DS   LLA+G    G D  I + DI   +  +   +  H   +++LK
Sbjct: 98  SMKISSPSYILDTDSTSTLLAVG----GTDGSIIVVDIE--NGYITHSLKGHGGTISSLK 151

Query: 160 FH---PSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYAS 199
           F+    S   +L SG T+G   V+DL ++     LH +  + S
Sbjct: 152 FYGQLDSKVWLLASGDTNGMVKVWDLVKR---KCLHTLQEHTS 191

>ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1147

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ 184
           + I+D+RK  TPL  L+  H   V ++ F+    T L++GS DG    +D ++
Sbjct: 182 VCIWDLRKGSTPLGKLV-GHGSSVNSVDFNRFKRTELMTGSNDGSVKFWDYSK 233

>Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,
           581 aa] {ON} complement(43262..43506,43751..45251) [1746
           nt, 582 aa]
          Length = 581

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 60/140 (42%), Gaps = 6/140 (4%)

Query: 78  FSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDI 137
           F+  ++  V+IF  +     + T    K+V + +     G L    +  G+   +++YD 
Sbjct: 55  FAVTSSTRVQIFS-SRTRQVVKTFSRFKDVVYSASFRNDGKLLCAGDATGL---VSVYDS 110

Query: 138 RKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDD-ALHQVMN 196
                 L S+  S H      KFH  DP  L++ S D  T ++D++   E    L    +
Sbjct: 111 YNPRVLLLSIKASTHP-THVTKFHTQDPKTLITASDDRVTRLWDISHAYEPQIELTGASD 169

Query: 197 YASIHSCGWLSPNRIFTLSH 216
           Y    SC   +P+ I T S+
Sbjct: 170 YVRTVSCIPSAPHLISTGSY 189

>KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 aa]
           {ON} weakly similar to uniprot|Q12206 YOR229W
           Saccharomyces cerevisiae WTM2 WD repeat containing
           transcriptional modulator 2
          Length = 449

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           D  I  YDIR    PL ++ + H   +T     P+  T+ ++GS  G   ++DL
Sbjct: 254 DNGIRFYDIRGDGKPLWTVFEPHDGKLTCYDVSPTLETLFITGSDTGVLKLWDL 307

>NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {ON}
           Anc_3.95 YDR488C
          Length = 626

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%)

Query: 148 IDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDAL 191
           ++ H  DVT+L+FHP +  +L SGS D   +++D    D  D++
Sbjct: 487 VNFHSSDVTSLRFHPQNDDLLCSGSMDWNCHLWDTFNNDLIDSI 530

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 60/113 (53%), Gaps = 15/113 (13%)

Query: 77  LFSTATAESVKIFDINSNNGP--IATLHNDKNVPFLSLDSRHG---LLAMGTELQGVDAQ 131
           L ST+   +VK++D+NS N    +A++HN+KNV   S    HG   +L  G    G D++
Sbjct: 305 LASTSADHTVKLWDLNSGNAARSMASIHNNKNVS--SSQWHHGNGSILLTG----GYDSR 358

Query: 132 INIYDIRKWDTPLRSLI--DSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           I + D+R  +    S     S+ ++V  + F  +D  ++L+G+  G    +D+
Sbjct: 359 IALTDVRISNENEMSKYWSVSNGEEVETVIF--ADENIILAGTDSGNIYSFDI 409

>NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa]
           {ON} Anc_8.585 YBR175W
          Length = 335

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 128 VDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
           +D  I ++D+   +  L   I +H + V ++   P D TVL SGS DG   ++D
Sbjct: 125 MDESIKVWDVL--NGILMKTISAHSESVVSVDICPEDSTVLSSGSFDGLIRLFD 176

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 65/149 (43%), Gaps = 10/149 (6%)

Query: 40  EIHCLDFGTCQSKQSIRVSNLSINDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIA 99
           EI+ +D      K   ++SN    ++  L        L   + A+ +KIF + +    + 
Sbjct: 39  EINIIDLTLGCRKILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKTGR-IVR 97

Query: 100 TLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALK 159
           +L        L  D    LLA+G    G D  I I DI   +  +   +  H   +++LK
Sbjct: 98  SLKISSPSYILDTDPTSTLLAVG----GTDGSIVIVDIE--NGYITHSLKGHGGTISSLK 151

Query: 160 FH---PSDPTVLLSGSTDGYTNVYDLTQQ 185
           F+    S+  +L SG T+G   V+DL ++
Sbjct: 152 FYGQLDSETWLLASGDTNGMVKVWDLVKR 180

>Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON}
           YJL112W (REAL)
          Length = 714

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 111 SLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLS 170
           +L S    LA GT+    D  + ++D+R     +R+L + H D +T+LKF   D   L++
Sbjct: 571 ALQSFDAALATGTK----DGVVRLWDLRSGKV-IRTL-EGHTDAITSLKF---DSACLVT 621

Query: 171 GSTDGYTNVYDL 182
           GS D    V+DL
Sbjct: 622 GSYDRTVRVWDL 633

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 293 AHGDEVIRDVFIPPSHSELVYSCGEDGFVNLW 324
           AH D ++   F+P SH+   +SCG+DG +  W
Sbjct: 608 AHQDAIMNVKFVPQSHN--FFSCGKDGVIKYW 637

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 127 GVDAQINIYDIRKW---DTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           G    + IYDI K    D P+ + +  H   + ++ F+    ++L+SG  DG   ++DL
Sbjct: 197 GTSTSVAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQDGCIKIWDL 255

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 132 INIYDIRKWDTPLRSLIDS---HHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           I+IYDI K +   ++LI S   H   V +  F+  D  +L+SG  DG   ++DL
Sbjct: 205 ISIYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCIKIWDL 258

>NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {ON}
           Anc_8.67
          Length = 885

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 83/205 (40%), Gaps = 21/205 (10%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDED 188
           D Q+ IYD +K    L+ L   H   V ALK+   +  +++SGSTD    V+D+ +    
Sbjct: 493 DRQLRIYDSKK-KIFLKEL-SGHEGGVWALKY--DEDGIIVSGSTDRTVRVWDIKR---G 545

Query: 189 DALHQVMNYASIHSC----GWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVR 244
              H    + S   C     + +   I T S   T  + +L  +     +  PL F    
Sbjct: 546 CCTHVFKGHTSTVRCLEIVTYKNIKYIVTGSRDNTLHVWKLVREDNRSIDELPLIFNTPE 605

Query: 245 EKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKD-----SVVIPSAHGDEVI 299
           E     Y + V  G++A+ ++  G+G + +  +   N+ V D      + +   H D + 
Sbjct: 606 EN---PYFVGVLRGHMASVRTISGHGNIIISGSYDNNLMVWDIAQMKCIYLLIGHTDRIY 662

Query: 300 RDVFIPPSHSELVYSCGEDGFVNLW 324
             ++      +   S   D  + +W
Sbjct: 663 STIY--DHQRKRCISASMDSTIKIW 685

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 21/113 (18%)

Query: 85  SVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYD-------- 136
           S+KI+D++          +  ++  + +D+R+ +L  G    G DA + +++        
Sbjct: 421 SIKIWDLSQKKQTGQMAGHLASISCMQIDNRYNMLITG----GRDAVLKMWNLNLGAQLY 476

Query: 137 ------IRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
                 I   +T      DSH D++TAL F   D   L+SGS D     +DLT
Sbjct: 477 QEESDAIPSSETACVYTFDSHVDEITALSF---DSGHLVSGSQDRTVRQWDLT 526

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 33.9 bits (76), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 111 SLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLS 170
           +L S    LA GT+    D  + ++D+R     +R+L + H D +T+LKF   D   L++
Sbjct: 565 ALQSFDAALATGTK----DGIVRLWDLRSGKV-IRTL-EGHTDAITSLKF---DSACLVT 615

Query: 171 GSTDGYTNVYDL 182
           GS D    V+DL
Sbjct: 616 GSYDRTVRVWDL 627

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 53/121 (43%), Gaps = 36/121 (29%)

Query: 85  SVKIFDINSNN------GPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIR 138
           +VKI+D++         G +AT++       + +D  +G L  G    G DA + ++++ 
Sbjct: 416 TVKIWDLSKRKKIGELAGHLATIN------CMQIDRDYGTLVTG----GRDAALKLWNLN 465

Query: 139 -----------------KWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
                            + D+P     ++H D+VTAL     DP  L+SGS D     +D
Sbjct: 466 LAEQLYQETQNLTCPASQIDSPCVFTFEAHIDEVTALSL---DPNFLVSGSQDRTIRQWD 522

Query: 182 L 182
           L
Sbjct: 523 L 523

>KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {ON}
           Anc_2.469 YMR093W
          Length = 508

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 53/120 (44%), Gaps = 5/120 (4%)

Query: 78  FSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDI 137
           F+  ++  V+IF  +     + T    K+V + +     G L +  +  G+   +++YD 
Sbjct: 55  FAVTSSTRVQIFS-SKTRQVVKTFSRFKDVVYSASFRNDGKLLVAGDATGL---VSVYDA 110

Query: 138 RKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNY 197
               + L S+  S H      KFHP D   L++ S D  T ++D++   E   L    +Y
Sbjct: 111 YNPRSILLSINASTHP-THVTKFHPQDNKTLVTTSDDRVTRIWDISHAYEAQELTGASDY 169

>CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {ON}
           highly similar to uniprot|P40066 Saccharomyces
           cerevisiae YER107c GLE2
          Length = 369

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 49/112 (43%), Gaps = 10/112 (8%)

Query: 77  LFSTATAE-SVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIY 135
           LFS ++ +  V+I+D   N  P      + N P L   +R  L        G D  + +Y
Sbjct: 50  LFSVSSWDGKVRIWDAQ-NGVPQGKAQYEHNGPVLC--TRWSLDGARIASGGCDNTVKLY 106

Query: 136 DIRKWDTPLRSLIDSHHDDVTALKFHPSDPT---VLLSGSTDGYTNVYDLTQ 184
           D+    +     I SH+D V +L+F    PT    L++GS D     +D  Q
Sbjct: 107 DVASGQS---QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDTRQ 155

>KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {ON}
           Anc_1.247 YKR036C
          Length = 700

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 9/64 (14%)

Query: 119 LAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTN 178
           LA GT     D  + ++D+R  +  +RSL D H D +T+LKF   D   +++GS D    
Sbjct: 565 LATGTR----DGIVRLWDLRSGEV-IRSL-DGHTDAITSLKF---DKYNIITGSIDKTVR 615

Query: 179 VYDL 182
           ++DL
Sbjct: 616 IWDL 619

>NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa]
           {ON} Anc_1.247 YJL112W
          Length = 668

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 67/145 (46%), Gaps = 21/145 (14%)

Query: 41  IHCLDFGTCQSKQSIRVSNLSINDLKI--LNSDFHCGSLFSTATAESVKIFDINSNNGPI 98
           I CLDF   +S  ++  +    N +KI  L++    GS FS   A ++    +++NN  +
Sbjct: 354 ITCLDFA--KSWNTLCTAANYDNTVKIWDLSTTEQLGS-FSGHKA-TINCLQMSNNNSLL 409

Query: 99  ATLHNDKNVPFLSLDSRHGLLAMGTEL-QGVDAQINIYDIRKWDTPLRSLIDSHHDDVTA 157
            T   D  V   ++D       +G EL +  + Q+   D    ++P     DSH D++TA
Sbjct: 410 MTGSKDATVKVWNID-------LGIELAKKENNQLEEKD----ESPCVLTFDSHSDEITA 458

Query: 158 LKFHPSDPTVLLSGSTDGYTNVYDL 182
           L F   D   L+S S D     YD+
Sbjct: 459 LSF---DGEYLISASRDKTVRQYDI 480

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 16/70 (22%)

Query: 138 RKWDTPLRSLIDS---HHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQV 194
           R WD  +  ++ S   H+  +T+L+F   DP  L + STDG   V+DL          + 
Sbjct: 532 RLWDLRIGKVVRSMEGHNGAITSLQF---DPIKLTTSSTDGDIRVWDL----------RT 578

Query: 195 MNYASIHSCG 204
             +  +H CG
Sbjct: 579 AGWLELHPCG 588

>ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004C RPN14 Putative non-ATPase subunit of the 19S
           regulatory particle of the 26S proteasome localized to
           the cytoplasm
          Length = 391

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 149 DSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185
           ++H D++T LKF PS   VLLSGSTD    ++ L  +
Sbjct: 121 EAHLDEITCLKFFPSG-QVLLSGSTDMRLKIWSLADE 156

>TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.338
           YLR208W
          Length = 294

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 6/80 (7%)

Query: 250 DYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPPSHS 309
           D ++D Y   +A   S +    +K+    GEN  + +++   + H   V R  +  P   
Sbjct: 14  DAILDYYGKRLATCSSDK---TIKIFEVEGENHKLVETL---TGHEGPVWRVDWAHPKFG 67

Query: 310 ELVYSCGEDGFVNLWKNNNG 329
            ++ SC  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 57/126 (45%), Gaps = 13/126 (10%)

Query: 77  LFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYD 136
           L   + A+ +KIF ++S      ++        +  DS   L+A+G    G D  I++ D
Sbjct: 75  LCYVSQAQQLKIFSLDSMK-ITRSMKISSPSYVMDSDSTSTLIAIG----GTDGSISVVD 129

Query: 137 IRKWDTPLRSLIDSHHDDVTALKFHPS---DPTVLLSGSTDGYTNVYDLTQQDEDDALHQ 193
           +   +  +      H   +++LKFH     D  +L SG T+G   V+DL ++     LH 
Sbjct: 130 VE--NGYITHSFKGHGGTISSLKFHGELNGDKWLLASGDTNGVAKVWDLVKR---RCLHT 184

Query: 194 VMNYAS 199
           +  + S
Sbjct: 185 MQEHTS 190

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 79/179 (44%), Gaps = 28/179 (15%)

Query: 47  GTCQSKQSIRVSNLSINDLKILNSDFHCGSLF-STATAESVKIFDIN--SNNGPIATLHN 103
           G  Q  +++  S+  IN+   +  +    +L  S+ +   V+++DI   S+  PI  L  
Sbjct: 185 GVIQDVETMDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDL-- 242

Query: 104 DKNVPFLSLDS-------------RHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDS 150
               P +S++S                L A  TE   V    ++ D+R     L+S   S
Sbjct: 243 ----PLVSINSDGSGVNDVTWMPTHDSLFAACTEGNTV----SLLDLRTKKEKLKSNCRS 294

Query: 151 HHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGWLSPN 209
           H+  V + KF+  +  +L S  ++G  N++D+   + D  L  + +  S+ +  W SPN
Sbjct: 295 HNGGVNSCKFNYRNSLILASADSNGKLNLWDIRNMN-DCPLTTMEHGGSVSTLEW-SPN 351

>Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W
           (REAL)
          Length = 297

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 250 DYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPPSHS 309
           D V+D Y   +A   S +    +K+    GE   + D++   + H   V R  +  P   
Sbjct: 14  DAVLDYYGKRLATCSSDK---TIKIFEVEGETHKLVDTL---TGHEGPVWRVDWAHPKFG 67

Query: 310 ELVYSCGEDGFVNLWKNNNG 329
            ++ SC  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178w PRP4
           U4/U6 snRNP
          Length = 500

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 48/107 (44%), Gaps = 7/107 (6%)

Query: 75  GSLFSTA-TAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQIN 133
           G+L STA T ++  I+D+ S         + K +  +        LA G    G D  I 
Sbjct: 352 GALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATG----GGDGVIT 407

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVY 180
           I+D+RK D   +  I  H   VT+LKF  ++   L+S   D    VY
Sbjct: 408 IWDLRKSDKLTK--ITEHKSIVTSLKFDKANDHNLISSGYDRSIFVY 452

>TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.123
           YAR003W
          Length = 437

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/196 (20%), Positives = 82/196 (41%), Gaps = 10/196 (5%)

Query: 5   PYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSIND 64
           P  L N+     N  C +F P  + + L +   NG +   D  T +    +  S L  + 
Sbjct: 16  PEKLTNTLETPLNTECVQFSP--RGDYLAVGCVNGAVVIYDMDTFRPV-FVLGSRLDAHR 72

Query: 65  LKILNSDFH-CGSLFSTATAE-SVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122
             + +  +   G    TA+ +  +K++D+ S   P+  L     V  +   +      + 
Sbjct: 73  RSVQSIAWSPSGRYILTASRDWFIKLWDLQSPQQPLRQLRFTGPVWNVHWINAANFACVA 132

Query: 123 TELQG-----VDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYT 177
           T L+      +D  +N  +  + DT L S+++     V     HP    +L++G++ G+ 
Sbjct: 133 TVLEEKMAYLIDFSLNEPNFAQLDTGLDSIMEQDQRFVITSVVHPKYDNILVTGTSKGWI 192

Query: 178 NVYDLTQQDEDDALHQ 193
           N Y L   + ++ +++
Sbjct: 193 NFYLLADSNSNENVNE 208

>Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W
           (REAL)
          Length = 297

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 250 DYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPPSHS 309
           D V+D Y   +A   S +    +K+    GE   + D++   + H   V R  +  P   
Sbjct: 14  DAVLDYYGKRLATCSSDK---TIKIFEVEGETHKLIDTL---TGHEGPVWRVDWAHPKFG 67

Query: 310 ELVYSCGEDGFVNLWKNNNG 329
            ++ SC  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 2/71 (2%)

Query: 130 AQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDD 189
           AQI ++DI +   PL +L     D++TA+KF+ ++  +LLS  +D    +YDL       
Sbjct: 195 AQIELWDINR-RKPLSNL-SWGIDNITAVKFNQNEADLLLSSGSDNSVVLYDLRTNSPTQ 252

Query: 190 ALHQVMNYASI 200
            + Q M   S+
Sbjct: 253 KIVQTMKTNSM 263

>NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa]
           {ON} Anc_1.247
          Length = 589

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 58/115 (50%), Gaps = 19/115 (16%)

Query: 77  LFSTATAESVKIFDINSNNGPIATLH---------NDKNVPFLSLDSRHGLLAMGTELQG 127
           L S +  +S++ +D+ + N  + TL          N K+    +L S    LA G++   
Sbjct: 404 LLSASRDKSIRQWDLTTGNC-VQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSK--- 459

Query: 128 VDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
            D  I ++D+R     +R+L+  H   +T+L+F   D T +++GSTD   +V DL
Sbjct: 460 -DGIIRLWDLRSGKV-VRTLL-KHQGPITSLQF---DSTKIITGSTDANISVSDL 508

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 81/175 (46%), Gaps = 20/175 (11%)

Query: 47  GTCQSKQSIRVSNLSINDLKILNSDFHCGSLF-STATAESVKIFDINSN-------NGPI 98
           G  Q  +++  S+  +N+   L  +    +L  S+ +   V+I+DI          + P+
Sbjct: 185 GVIQDVEAMDTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPL 244

Query: 99  ATLHNDK----NVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDD 154
            ++ +D     +V ++   +   L A  TE   V    ++ D+R     LRS   +H   
Sbjct: 245 VSIESDASGVNDVTWMP--THDSLFAACTEGNVV----SLLDLRTKKEKLRSNRQNHTGG 298

Query: 155 VTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGWLSPN 209
           V + KF+  +  VL S  ++G  N++D+ + +E   +  + + ASI +  W +PN
Sbjct: 299 VNSCKFNYRNSLVLASADSNGRLNLWDIRKMNE-SPITTMEHGASISTLEW-NPN 351

>TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON}
           Anc_8.585 YBR175W
          Length = 336

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 3/54 (5%)

Query: 128 VDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
           VD  I I+DI    T LR+ I++H+D V  + F+ +D ++  SGS DG   +YD
Sbjct: 131 VDESIKIWDILH-GTNLRT-INTHNDPVVTIDFN-NDSSIFSSGSHDGLVRLYD 181

>YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}
           SEC13Structural component of three distinct complexes;
           subunit of the Nup84 nuclear pore sub-complex (NPC), the
           COPII vesicle coat, and the Seh1-associated (SEA)
           complex; the COPII vesicle coat is required for vesicle
           formation in ER to Golgi transport; the Nup84 subcomplex
           contributes to nucleocytoplasmic transport, NPC
           biogenesis and processes that may require localization
           of genes or chromosomes at the nuclear periphery
           including transcription; homologous to human SEC13
          Length = 297

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 250 DYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPPSHS 309
           D V+D Y   +A   S +    +K+    GE   + D++   + H   V R  +  P   
Sbjct: 14  DAVLDYYGKRLATCSSDK---TIKIFEVEGETHKLIDTL---TGHEGPVWRVDWAHPKFG 67

Query: 310 ELVYSCGEDGFVNLWKNNNG 329
            ++ SC  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 75/184 (40%), Gaps = 23/184 (12%)

Query: 134 IYDIRK-WDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALH 192
           +YD  K  D  L S +  H D+   L F+P D   LLSGS D    ++D+T     ++  
Sbjct: 134 LYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITT----NSTK 189

Query: 193 QVMNYASIHS-----CGW--LSPNRIFTLSHMETFAIHE------LNDKSEELKEPQPLD 239
            V  + S H      C W  L+ N   ++S   T  +H+      + DK + +     + 
Sbjct: 190 PVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIA 249

Query: 240 FG----DVREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHG 295
           F     ++    G D +I +Y            +G    + TN E  + KD +V+ S   
Sbjct: 250 FSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNV-TNLEFYAAKDGIVMSSGED 308

Query: 296 DEVI 299
             VI
Sbjct: 309 RRVI 312

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 6/92 (6%)

Query: 127 GVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL---- 182
           G D+ I +YD R+    L ++   H  +VT L+F+ +   +++S   D    ++DL    
Sbjct: 262 GTDSLIYLYDSRRTGNVLHTM-SGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIG 320

Query: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTL 214
            +Q  DDA         IH+ G  SP   F++
Sbjct: 321 AEQVPDDADDGSPEVVMIHA-GHRSPVNDFSM 351

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 2/72 (2%)

Query: 127 GVDAQ-INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185
           G+D + I I D+R    P+  ++  H   V  +K+HPS P VLLS   D     +DL  +
Sbjct: 433 GLDKKAILILDMRNPGVPVL-VLSGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDLNSE 491

Query: 186 DEDDALHQVMNY 197
                 H   N+
Sbjct: 492 LNPKVTHLARNH 503

>Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {ON}
           complement(87507..89612) [2106 nt, 702 aa]
          Length = 701

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 19/98 (19%)

Query: 89  FDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTP----L 144
            DI+ N+G          V  +S++  +GLLA+G E    D+ +  +D R         L
Sbjct: 178 LDIDENSG----------VNHVSINQVNGLLAVGLE----DSVVEFWDPRARSRVSKLYL 223

Query: 145 RSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
            + IDS    VTA  F  +D      G+++GYT +YDL
Sbjct: 224 ENQIDSSSFQVTATSFR-NDGLNFACGTSNGYTYLYDL 260

>Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON}
           (67445..69169) [1725 nt, 575 aa]
          Length = 574

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 5/64 (7%)

Query: 77  LFSTATAESVKIFDINSNNGP--IATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINI 134
           L ST+   +VK++D+NS      IA++H++KNV        HG + +     G D+++ +
Sbjct: 302 LASTSADHTVKLWDLNSGTAARSIASIHSNKNVSASEWHMSHGSILL---TGGYDSRLAL 358

Query: 135 YDIR 138
            D+R
Sbjct: 359 TDVR 362

>KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]
           {ON} similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 572

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 44/77 (57%), Gaps = 6/77 (7%)

Query: 119 LAMGTELQGVDAQINI-YDIRKWD----TPLRSLIDSHHD-DVTALKFHPSDPTVLLSGS 172
           LA   + + V A  +  + ++ WD    T  RSLI+ H + +V+A ++HPS+ +VLL+  
Sbjct: 294 LAHNKQFRAVLASTSADHTVKLWDLNTATAARSLINIHSNTNVSASQWHPSNGSVLLTAG 353

Query: 173 TDGYTNVYDLTQQDEDD 189
            D    + D+  ++++D
Sbjct: 354 YDSRAALSDVRIENDND 370

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 127 GVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVY 180
           G D  INI+DIRK     R L  +H++ VT ++F  S    L+S   D    +Y
Sbjct: 378 GGDGVINIWDIRKTTETTRLL--AHNNIVTGVRFQKSTGHCLVSCGYDKQIRIY 429

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 22/36 (61%)

Query: 147 LIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           ++  H   +T + FHP++P +L + S D Y + +D+
Sbjct: 109 VLHGHSRAITDINFHPTNPEILATCSIDAYVHAWDM 144

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDED 188
           I+D+R   TPL  L  SH   V ++ F+    T ++S S DG    +D ++  ED
Sbjct: 184 IWDLRNGSTPLFKL-SSHESSVNSIDFNRFRSTEIMSSSNDGTVKFWDYSRNVED 237

>Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON}
           (90456..91340) [885 nt, 295 aa]
          Length = 294

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 6/80 (7%)

Query: 250 DYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPPSHS 309
           D V+D Y   +A   S +    +K+    GE+  + +++V    H   V R  +  P   
Sbjct: 14  DTVLDYYGKRLATCSSDK---TIKIFEIEGESHKLVETLV---GHEGPVWRVDWAHPKFG 67

Query: 310 ELVYSCGEDGFVNLWKNNNG 329
            ++ SC  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 131 QINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           +I I D+R  ++P+ +L + H   V  +K+HP+   VLLS S D     +DL
Sbjct: 376 KIIILDMRNPESPILTL-EGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDL 426

>KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.469
           YMR093W
          Length = 509

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 72/167 (43%), Gaps = 10/167 (5%)

Query: 78  FSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDI 137
           F+  ++  V+IF   +    + T    K+V + +     G L +  +  G+   +++YD 
Sbjct: 55  FAVTSSTRVQIFSSRTRQ-VVKTFSRFKDVVYCANFRADGKLLVAGDATGL---VSVYDS 110

Query: 138 RKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDD-ALHQVMN 196
                 L S+  S H      KFHP D   L++ S D  T ++D++   E    L    +
Sbjct: 111 YNPRNVLVSIQASTHP-THVTKFHPMDSKTLITSSDDRVTRLWDISHAYEPTLELGGATD 169

Query: 197 YASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEE----LKEPQPLD 239
           Y    +C   +P+ + T S+     +++   +S +    L   QP++
Sbjct: 170 YVRSLTCVPSAPHLVATGSYDGLVRMYDTRTQSSDPIYSLNHDQPVE 216

>Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W
           (REAL)
          Length = 297

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 250 DYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPPSHS 309
           D V+D Y   +A   S +    +K+    GE   + D++   + H   V R  +  P   
Sbjct: 14  DAVLDYYGKRLATCSSDK---TIKVFEVEGETHKLIDTL---TGHEGPVWRVDWAHPKFG 67

Query: 310 ELVYSCGEDGFVNLWKNNNG 329
            ++ SC  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 7/111 (6%)

Query: 78  FSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDI 137
           F+  ++  V++F  +S    I T    K+V + +     G L    +  G+   +++YD 
Sbjct: 55  FAVTSSTRVQLFS-SSTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGL---VSVYDS 110

Query: 138 RKWDTPLRSL-IDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
               T L S+   SH   VT  KFH  D   L++ S D  T V+D++   E
Sbjct: 111 YNPRTLLLSINASSHPTHVT--KFHTQDSKTLVTASDDRITRVWDISHAYE 159

>Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON}
           (77284..78369) [1086 nt, 362 aa]
          Length = 361

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 10/112 (8%)

Query: 77  LFSTATAES-VKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIY 135
           LFS ++ ++ V+I+DI   N P      + + P L   +R           G D  + +Y
Sbjct: 48  LFSASSWDNKVRIWDIQGGN-PQGKAQYEHSAPVLC--TRWSFDGTKVASGGCDNVVKVY 104

Query: 136 DIRKWDTPLRSLIDSHHDDVTALKF---HPSDPTVLLSGSTDGYTNVYDLTQ 184
           D+   ++     + SH   V +L+F    P++   L++GS D     +DL Q
Sbjct: 105 DL---NSGQNQQVGSHDSAVQSLRFVQCGPTNAECLVTGSWDKTLKYWDLRQ 153

>KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.239
           YGL137W
          Length = 911

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 65/161 (40%), Gaps = 24/161 (14%)

Query: 32  LLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLK--------ILNSDFHCGSLFSTATA 83
           +L +L +G+I   ++ T Q  +SI V+   +   +        ++ SD     +F+  T 
Sbjct: 28  VLTTLYSGKIEIWNYETQQEVRSIHVTETPVRAGRFIARKNWIVVGSDDFRLRIFNYNTG 87

Query: 84  ESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTP 143
           E +  F+ + +      +H  K  P++   S              D  + +++  K +  
Sbjct: 88  EKISDFEAHPDYIRSIAVHPTK--PYVITGSD-------------DLTVKLWNWEK-NWA 131

Query: 144 LRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ 184
           L    + H   V ++ F+P DP    SG  D    V+ L Q
Sbjct: 132 LEQTFEGHDHFVMSVAFNPKDPNTFASGCLDRTVKVWSLGQ 172

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDED 188
           I+D+R   TPL  L+  H   V ++ F     T ++S S DG    +D +  +ED
Sbjct: 183 IWDLRNGSTPLCQLV-GHESSVNSIDFSRFKSTEIMSSSNDGTVKFWDYSVNNED 236

>NCAS0B08880 Chr2 complement(1703601..1705580) [1980 bp, 659 aa]
           {ON} Anc_1.37
          Length = 659

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 79  STATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIR 138
           S +T E+     I+ N  PI  + N     + +LD + G   MGT   G++   N   ++
Sbjct: 34  SISTVETSLSNKISLNKLPIIKVRNHPKNGYHALDEQIGASKMGT---GMNQYRNA--MK 88

Query: 139 KWDTPLRSLIDSHHDDVTALK 159
           K  +PL ++ DS+ DD+   K
Sbjct: 89  KLKSPLATVTDSYQDDIPYFK 109

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 69/163 (42%), Gaps = 13/163 (7%)

Query: 40  EIHCLDFGTCQSKQSIRVSNLSINDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIA 99
           EI+ +D          R+SN    ++  L        L   + A+ +KIF + +    + 
Sbjct: 39  EINIIDLTPGSRNIIHRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGK-VVR 97

Query: 100 TLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALK 159
           ++        L  DS   LLA+G    G D  I + DI   +  +      H   +++LK
Sbjct: 98  SMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDIE--NGYITHSFKGHGGTISSLK 151

Query: 160 FH---PSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYAS 199
           F+    S   +L SG T+G   V+DL ++     LH +  ++S
Sbjct: 152 FYGQLDSKIWLLASGDTNGMVKVWDLVKR---KCLHTLQEHSS 191

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 69/163 (42%), Gaps = 13/163 (7%)

Query: 40  EIHCLDFGTCQSKQSIRVSNLSINDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIA 99
           EI+ +D      K   ++SN    ++  L        L   + A+ +KIF + +    + 
Sbjct: 39  EINIIDLTPGSRKILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGK-VVR 97

Query: 100 TLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALK 159
           ++        L  DS   LLA+G    G D  I + DI   +  +      H   +++LK
Sbjct: 98  SMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDIE--NGYITHSFKGHGGTISSLK 151

Query: 160 FHP---SDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYAS 199
           F+    S   +L SG T+G   V+DL ++     LH +  + S
Sbjct: 152 FYGQLNSKIWLLASGDTNGMVKVWDLVKR---KCLHTLQEHTS 191

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 86/208 (41%), Gaps = 28/208 (13%)

Query: 45  DFGTCQSKQSIRVSNLSINDLKILNSDFHCGSLFSTATAESVKIFDI------NSNNGPI 98
           D  T ++ +S+++S+ +     +L+ D     L    T  SV +FDI      +S  G  
Sbjct: 88  DLETKRTTRSMKISSPAY----VLDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHG 143

Query: 99  ATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTA- 157
           AT+ + K   +  +DS   LLA G +  G+        ++ WD   R  I +  +   A 
Sbjct: 144 ATISSVKF--YGEVDSGMWLLASG-DTNGM--------VKIWDLVKRRCIHTVQEHTAAV 192

Query: 158 ----LKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQVMNYASIHSCGWLSPNR--I 211
               ++      ++LLSG  D   +V+    + +   L  +     I SCG++  N   I
Sbjct: 193 RGLDIRVQEGAESLLLSGGRDDVVHVHHFDMKKKCKLLQTIPVKRQIESCGFIGDNTSLI 252

Query: 212 FTLSHMETFAIHELNDKSEELKEPQPLD 239
           +T      + I  L       +  QP++
Sbjct: 253 YTAGGDAVYQIISLESGKSIKQTAQPVE 280

>ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 726

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 9/64 (14%)

Query: 119 LAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTN 178
           LA GT+    D  + ++D+R   T +RSL + H D +T LKF   D   L++GS D    
Sbjct: 590 LATGTK----DGIVRLWDMRSGKT-IRSL-EGHTDAITTLKF---DSRNLVTGSLDRSIR 640

Query: 179 VYDL 182
           ++DL
Sbjct: 641 IWDL 644

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 54/113 (47%), Gaps = 21/113 (18%)

Query: 85  SVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIR------ 138
           S+K+++++  N       +  ++  + LD+++ +L  G    G DA + ++D+       
Sbjct: 438 SIKLWNLSKKNQVGQMTGHHASINCMQLDNQYNMLISG----GRDAVLKLWDLSLAYQLY 493

Query: 139 KWDTPLRS--------LIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
           + DT   S          DSH D++TAL F   D   L+SGS D     +DL+
Sbjct: 494 QEDTEFASNSEEACVYTFDSHLDEITALSF---DSGHLVSGSQDRTLRQWDLS 543

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 22/39 (56%)

Query: 144 LRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           +  ++  H   +T + FHP+ P +L + S D Y + +D+
Sbjct: 106 IEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDM 144

>Kwal_27.9955 s27 (136001..136399) [399 bp, 132 aa] {OFF} [contig
           43] FULL
          Length = 132

 Score = 31.2 bits (69), Expect = 2.1,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 1/63 (1%)

Query: 43  CLDFGTCQSKQSIRVSNLSINDLKILNSDFHCGSL-FSTATAESVKIFDINSNNGPIATL 101
           C   G  + + S R ++ + +D  IL        L FS  +  SVK+   NS N P   L
Sbjct: 39  CTIVGIMRCENSSRFASNTTSDFSILTDTIFLLDLSFSRTSKNSVKVLGRNSLNSPFNAL 98

Query: 102 HND 104
            ND
Sbjct: 99  END 101

>TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.67
           YFL009W
          Length = 732

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 68/151 (45%), Gaps = 19/151 (12%)

Query: 129 DAQINIYD--IRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQD 186
           D  I IYD   +K+   LR     H+  V ALK+  +   +L+SGSTD    ++D+   D
Sbjct: 352 DKMIRIYDAVTKKFVNELRG----HNGGVWALKYDENG--ILVSGSTDRSVRIWDI---D 402

Query: 187 EDDALHQVMNYAS----IHSCGWLSPNRIFTLSHMETFAIHELNDK-SEELKEPQPLDFG 241
                H    + S    +H   + +   + T S   T  + +L +K + E K+  P+ + 
Sbjct: 403 LGVCTHVFKGHTSTVRCLHIVKYKNIKYVVTGSRDNTLHVWKLPNKCNTEDKDKYPIVYD 462

Query: 242 DVREKWGCDYVIDVYPGYIAAGKSQEGNGQL 272
              E     Y + +  G++A+ ++  G G +
Sbjct: 463 STEEN---PYFVGILRGHLASVRTVSGYGNI 490

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 9/72 (12%)

Query: 111 SLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLS 170
           +L S    LA GT+    D  + ++D+R     +R+L   H D +T+LKF   D   L++
Sbjct: 571 ALQSFDAALATGTK----DGVVRLWDLRSGKV-IRTL-KGHTDAITSLKF---DSACLVT 621

Query: 171 GSTDGYTNVYDL 182
           GS D    ++DL
Sbjct: 622 GSYDRTVRIWDL 633

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 36/121 (29%)

Query: 85  SVKIFDINSNN------GPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIR 138
           +VKI+D++  N      G +AT++       + ++  +G L  G    G DA + ++++ 
Sbjct: 422 TVKIWDLSKQNKIGELAGHLATIN------CMQINRDYGTLVTG----GRDAALKLWNLN 471

Query: 139 -----------------KWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
                              D+P     ++H D+VTAL     DP+ L+SGS D     +D
Sbjct: 472 LAQQLYQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSL---DPSFLVSGSQDRTIRQWD 528

Query: 182 L 182
           L
Sbjct: 529 L 529

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 47/101 (46%), Gaps = 14/101 (13%)

Query: 137 IRKWDT----PLRSLIDSHHDDVTALKFHP------SDPTVLLSGSTDGYTNVYDLTQQD 186
           IR WD+    PL   +  H   +T+L + P       +   L S S DG   ++D+T++ 
Sbjct: 210 IRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRR- 268

Query: 187 EDDALHQVMNYASIHSC-GWLSPNRIFTLSHMETFAIHELN 226
               L+ +  + +  SC  W     I++ SH +T  + ++N
Sbjct: 269 --VCLYTMSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWDMN 307

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 1/64 (1%)

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQ 193
           ++D+RK  TPL SL   H   V ++ F+    T L+S S DG    +D ++   +     
Sbjct: 183 VWDLRKGSTPLCSL-KGHVSSVNSIDFNRFKSTELMSSSNDGTVKFWDYSKSTTESKRTV 241

Query: 194 VMNY 197
             N+
Sbjct: 242 TTNF 245

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 78/177 (44%), Gaps = 26/177 (14%)

Query: 26  LDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLKILNSDFHCGSLFSTATAES 85
           +D+ N + LS +   IH ++    Q   +++++          N ++ C      + A+ 
Sbjct: 37  VDEVNIMELSPTKRLIHTIENDDEQEITALKLTP---------NGEYLC----FVSQAQL 83

Query: 86  VKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLR 145
           ++I+ ++S    I ++     V  +  DS   L+A+G    G D  + + DI   +  + 
Sbjct: 84  LRIYKLSSKK-IIRSMKVSSPVYVMDCDSSSTLVALG----GTDGSVTVVDIE--NGYVT 136

Query: 146 SLIDSHHDDVTALKFHPSDPTV---LLSGSTDGYTNVYDLTQQDEDDALHQVMNYAS 199
                H   ++++KFH         L SG T G   V+DL ++   + +H +  +A+
Sbjct: 137 HSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRR---NCIHTIQEHAA 190

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 293 AHGDEVIRDVFIPPSHSELVYSCGEDGFVNLW 324
           AH D ++   F+P SH+   +SC +DG V  W
Sbjct: 607 AHQDSIMSVKFVPESHN--FFSCSKDGLVKYW 636

>TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON}
           Anc_7.338 YLR208W
          Length = 298

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/149 (18%), Positives = 62/149 (41%), Gaps = 27/149 (18%)

Query: 71  DFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRH-------------G 117
           D++   L + ++ +++KI++I+ ++  + T       P   +D  H             G
Sbjct: 18  DYYGRKLATCSSDKTIKIYEIDGDSHKLLTTLTGHEGPVWRIDWAHPKFGTILASCSYDG 77

Query: 118 LLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSD-PTVLLSGSTDGY 176
            + +  E  G  +QI ++ +             H   V ++K+ P +   VLL+ S+DG 
Sbjct: 78  KVIIWKEENGTWSQIAVHSV-------------HSASVNSVKWAPHEYGAVLLAASSDGK 124

Query: 177 TNVYDLTQQDEDDALHQVMNYASIHSCGW 205
            +V +  +    + +    +   ++S  W
Sbjct: 125 ISVVEFKENGTQNPMVLDAHAVGVNSAAW 153

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 130 AQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           +++ I D+R   +PL +L ++H   +  +K+HP+   VLLS S D     +DL
Sbjct: 335 SKVLILDMRSPGSPLLTL-EAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDL 386

>TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON}
           Anc_7.338 YLR208W
          Length = 294

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 53/118 (44%), Gaps = 5/118 (4%)

Query: 71  DFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDA 130
           D++   L S ++ +++KIF +N     +         P   +   H            D 
Sbjct: 18  DYYATRLASCSSDKTIKIFAVNGEQYALLDTLVGHEGPVWRVSWAHPKFGNLLASASYDG 77

Query: 131 QINIYDI--RKWDTPLRSLIDSHHDDVTALKFHPSD-PTVLLSGSTDGYTNVYDLTQQ 185
           +I I+    +KW + L SL   H   V  +++ PS+   +LL+GS+DG  +V +L  +
Sbjct: 78  KIIIWKEANKKW-SKLASL-SVHSASVNVVEWAPSEFGAILLAGSSDGNISVVELKDE 133

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 293 AHGDEVIRDVFIPPSHSELVYSCGEDGFVNLWKNNN 328
           AH D ++   F+P SH+   +SC +DG V  W  N+
Sbjct: 607 AHQDSIMNVKFLPESHN--FFSCSKDGTVKYWDGNS 640

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 44/102 (43%), Gaps = 8/102 (7%)

Query: 106 NVPFLSLD-SRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSD 164
           + PF +L  S+H          G D+ + ++D R    PL S+   H   VT ++F P  
Sbjct: 261 DAPFNTLAFSKHSQYLFAA--AGTDSHVYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQ 317

Query: 165 PTVLLSGSTDGYTNVYDL----TQQDEDDALHQVMNYASIHS 202
             +L++   D    ++D+     +Q  DDA         IH+
Sbjct: 318 DGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHA 359

>KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672)
           [2658 bp, 885 aa] {ON} Anc_6.239 YGL137W
          Length = 885

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 65/163 (39%), Gaps = 28/163 (17%)

Query: 32  LLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLK--------ILNSDFHCGSLFSTATA 83
           +L +L +G I   ++ T    +SI+V+   +   K        I+ SD     +F+  T 
Sbjct: 28  VLTTLYSGRIEIWNYETQHEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTG 87

Query: 84  ESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVD-AQINIYDIRK-WD 141
           E V  F+ + +      +H  K  P++              L G D   I +++  K W+
Sbjct: 88  EKVVDFEAHPDYIRSIAVHPTK--PYV--------------LSGSDDLTIKLWNWEKNWN 131

Query: 142 TPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ 184
             L    + H   V  + F+P DP    SG  D    V+ L Q
Sbjct: 132 --LEQTFEGHEHFVMCVAFNPKDPNTFASGCLDRTVKVWSLGQ 172

>TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {ON}
           Anc_7.356 YLR196W
          Length = 582

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 9/114 (7%)

Query: 77  LFSTATAESVKIFDINSNNGP--IATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINI 134
           L ST+   +VKI+D+NS +    +A++HN+ NV        +G + + +   G D+++ +
Sbjct: 306 LASTSADHTVKIWDLNSGDAARSLASIHNNTNVSSSEWHWTNGSILLTS---GYDSRVAL 362

Query: 135 YDIRKWDTPLRSLIDS--HHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQD 186
            D+R  D    S   S    +D+    F  +D  ++L G+  G    +D+   D
Sbjct: 363 SDVRISDESQMSKYWSVMGGEDIETATF--ADENIILCGTDAGNVYSFDVRNGD 414

>SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 568

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 56/110 (50%), Gaps = 9/110 (8%)

Query: 77  LFSTATAESVKIFDINSNNGP--IATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINI 134
           L ST+   +VK++D+N+      IA++HN+KNV      S  G + +     G D+++ +
Sbjct: 295 LASTSADHTVKLWDLNNGIAARSIASIHNNKNVSSSQWHSTDGSILL---TGGYDSRVAV 351

Query: 135 YDIRKWDTPLRSLIDS--HHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
            D+R  D    S   S    +++ +++F  +   V++ G+  G    +D+
Sbjct: 352 SDVRIADDSAMSKYWSVMAGEEIESVRF--ASENVIMCGTDSGNVYSFDI 399

>ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38123 Saccharomyces
           cerevisiae YBR175W SWD3 Subunit of the COMPASS complex
           which methylates histone H3 on lysine 4 and is required
           in transcriptional silencing near telomeres
          Length = 319

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 128 VDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
           +D  I I+D+   +  L   I +H + V ++     D T+L SGS DG   V+D+ 
Sbjct: 119 MDESIKIWDVL--NGSLMRTIAAHSESVVSVDIPQLDSTILSSGSYDGLIRVFDMA 172

>Kwal_56.24577 s56 complement(1061240..1062766) [1527 bp, 508 aa]
           {ON} YDL156W - Hypothetical ORF [contig 161] FULL
          Length = 508

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 54/121 (44%), Gaps = 4/121 (3%)

Query: 77  LFSTATAESVKI---FDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQIN 133
           L +TA    VK+    DI   N  +    +  N  F S D    + A     + +     
Sbjct: 106 LKNTAIVGDVKLSDLIDIEDENALLDRFRSYSNKSFSSGDFFKEIQAHQKVSEDIGELRK 165

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPS-DPTVLLSGSTDGYTNVYDLTQQDEDDALH 192
            +D+  +D    + I    D ++A+ FHPS D  +++ G T G+  ++++  +D +D L 
Sbjct: 166 QFDLEMYDIFQPNEIKIVQDRISAMFFHPSIDRKLVVGGDTTGHVGLWNVHNEDPNDQLA 225

Query: 193 Q 193
           +
Sbjct: 226 E 226

>ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [2694
           bp, 897 aa] {ON} highly similar to uniprot|P41811
           Saccharomyces cerevisiae YGL137W SEC27 Involved in
           beta'-subunit of yeast coatomer
          Length = 897

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 65/162 (40%), Gaps = 26/162 (16%)

Query: 32  LLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLK--------ILNSDFHCGSLFSTATA 83
           +L +L +G +   ++ T    +SI+ ++  I   K        I+  D +   +F+  T 
Sbjct: 28  VLTTLYSGRVEIWNYETQTEVRSIQATDSPIRSGKFIARKNWIIVGCDDYRIRVFNYNTG 87

Query: 84  ESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVD-AQINIYDIRKWDT 142
           E  K+ D  ++   I ++      P+L              L G D   + +++  K + 
Sbjct: 88  E--KVVDFEAHPDYIRSIAVHPTKPYL--------------LSGSDDLTVKLWNWEK-NW 130

Query: 143 PLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ 184
            L    + H   V  + F+P DP+   SG  D    V+ L Q
Sbjct: 131 ALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDSTVKVWSLGQ 172

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 293 AHGDEVIRDVFIPPSHSELVYSCGEDGFVNLW 324
           AH D ++   F+P SH+   +SC +DG +  W
Sbjct: 625 AHQDSIMNVKFVPESHN--FFSCSKDGLIKYW 654

>TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 888
           aa] {ON} 
          Length = 888

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 42/213 (19%), Positives = 87/213 (40%), Gaps = 36/213 (16%)

Query: 23  FQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLK--------ILNSDFHC 74
           F P++    +L +L +G I   ++ T    +SI+V+   +   +        ++ SD   
Sbjct: 21  FHPVEP--WVLTTLYSGRIEIWNYETETEVRSIQVTETPVRSGRFIARKNWIVVGSDDFR 78

Query: 75  GSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVD-AQIN 133
             +F+  T E V  F+ + +      +H  K  P++              L G D   + 
Sbjct: 79  IRIFNYNTGEKVSDFEAHPDYIRSIAVHPTK--PYV--------------LSGSDDLTVK 122

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDAL-- 191
           +++  K +  L    + H   V ++ F+P DP+   SG  D    V+ L Q   +  L  
Sbjct: 123 LWNWEK-NWALEQTFEGHEHFVMSVAFNPKDPSTFASGCLDRTVKVWSLGQSSPNFTLTT 181

Query: 192 --HQVMNYASIHSCGWLSPNRIFTLSHMETFAI 222
              + +NY   +      P++ + ++  + F++
Sbjct: 182 GQEKGVNYVDYYPL----PDKPYLITSSDDFSV 210

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 62/139 (44%), Gaps = 24/139 (17%)

Query: 77  LFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAM---GTELQGVD---- 129
           + S +  ++VK++ +NS +     L +D+      L++  GLL         QG+D    
Sbjct: 132 MLSCSDDKTVKLWSVNSED--YVNLKDDE-----QLNTTSGLLKTFYSDIAFQGIDHHRS 184

Query: 130 --------AQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
                   AQI ++D  +  TPL +L     D++T +KF+ ++  +  S  +D    +YD
Sbjct: 185 NSNFVTGGAQIQLWDSNR-STPLSNL-SWGADNITTVKFNQNETDIFASAGSDNSIVLYD 242

Query: 182 LTQQDEDDALHQVMNYASI 200
           L        + Q M   +I
Sbjct: 243 LRTNSPTQKIVQTMRTNAI 261

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 55/118 (46%), Gaps = 21/118 (17%)

Query: 83  AESVKIFDINSNNG------------PIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDA 130
           ++++KI+++ +  G            PI TL        +  DS   L+A+G    G D 
Sbjct: 85  SQALKIYNLTAIEGETTMNTKQQSLQPIKTLKLSSPSYIMDCDSTSTLVAVG----GTDG 140

Query: 131 QINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPT---VLLSGSTDGYTNVYDLTQQ 185
            I + DI   +  +      H   ++++KF+ ++ T   +L SG T+G   ++DL ++
Sbjct: 141 SIIVVDIE--NGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSGDTNGMVKIWDLVKR 196

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 293 AHGDEVIRDVFIPPSHSELVYSCGEDGFVNLW 324
           AH D ++   F+P SH+   +SC +DG V  W
Sbjct: 607 AHQDSIMSVKFLPESHN--FFSCSKDGLVKYW 636

>CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly
           similar to uniprot|Q04491 Saccharomyces cerevisiae
           YLR208w SEC13
          Length = 298

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 250 DYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPPSHS 309
           D V+D Y   +A   S +    +K+    GE+  + D++V    H   V R  +  P   
Sbjct: 14  DAVLDYYGKKLATCSSDK---TIKIFEVEGESHKLVDTLV---GHEGPVWRVDWAHPKFG 67

Query: 310 ELVYSCGEDGFVNLWKNNN 328
            ++ SC  DG V +WK  N
Sbjct: 68  TILASCSYDGKVIIWKEEN 86

>NDAI0B01710 Chr2 (407575..408939) [1365 bp, 454 aa] {ON} Anc_7.180
           YIR012W
          Length = 454

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 153 DDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDD-ALHQVMN-YASIHSC 203
           D+V  LK HP+ P +   G+ DG    Y +     DD +L Q+M+ +A    C
Sbjct: 174 DEVVWLKCHPTVPGIFAFGAADGSVWCYQINDNGSDDVSLEQLMSGFAHQQDC 226

>TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8.288
           YDR128W
          Length = 1134

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 131 QINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
           +++I+D+RK  TPL  L+  H   V ++ F+      +++GS DG    +D +
Sbjct: 181 EVSIWDLRKGSTPLGKLL-GHESGVNSIDFNRFKNDEIMTGSNDGTVKFWDYS 232

>Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 19/85 (22%)

Query: 107 VPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSL---------IDSHHDDVTA 157
           V ++S++  +GLLA GTE   V+          WD   RS          ID+    VT 
Sbjct: 183 VNYVSINDVNGLLAAGTETNAVEF---------WDPRSRSRVSKLYLENNIDNRPFQVTT 233

Query: 158 LKFHPSDPTVLLSGSTDGYTNVYDL 182
             F  +D      G+++GY+ +YDL
Sbjct: 234 CSFR-NDGLNFACGTSNGYSYLYDL 257

>Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDAL 191
           I ++D+RK  TPL SL   H   V ++ F+    T ++S S DG    +D ++   +   
Sbjct: 181 IFVWDLRKGSTPLCSL-KGHVSSVNSIDFNRFKSTEIMSSSNDGTVKFWDYSKSTTESKR 239

Query: 192 HQVMNY 197
               N+
Sbjct: 240 TVTTNF 245

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 293 AHGDEVIRDVFIPPSHSELVYSCGEDGFVNLW 324
           AH D ++   F+P SH+   +SC +DG +  W
Sbjct: 651 AHQDSIMNVKFVPESHN--FFSCSKDGIIKYW 680

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187
           I+D+R   TPL  L   H+  V ++ F   +   ++S S DG    +DL+++++
Sbjct: 185 IWDLRHGSTPLHKLT-GHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSKEEK 237

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 3/54 (5%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLS-GSTDGYTNVYD 181
           D  + ++DIRK   P++++  +    ++AL+++P  PTVL + G  DG   +++
Sbjct: 296 DGLVQLWDIRKLHNPIKTI--NCESPLSALEWNPQLPTVLATGGQEDGLVKLWN 347

>NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.338
           YLR208W
          Length = 297

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 32/80 (40%), Gaps = 6/80 (7%)

Query: 250 DYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPPSHS 309
           D V+D Y   +A   S +    +K+    GE       V     H   V R  +  P   
Sbjct: 14  DAVLDYYGKRLATCSSDK---TIKIFEVEGE---THKEVATLEGHDGPVWRVDWAHPKFG 67

Query: 310 ELVYSCGEDGFVNLWKNNNG 329
            ++ SC  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVLIWKEENG 87

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 9/80 (11%)

Query: 109 FLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHP---SDP 165
            +  DS   L+A+G    G D  I + DI   +  +   +  H   ++ALKF     S+ 
Sbjct: 111 IMDCDSTSTLVALG----GTDGSITVVDIE--NGFITHSLKGHGATISALKFFGQANSNV 164

Query: 166 TVLLSGSTDGYTNVYDLTQQ 185
            +L SG T+G   V+DL ++
Sbjct: 165 WLLCSGDTNGMVKVWDLVKR 184

>TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa]
           {ON} Anc_1.247 YKR036C
          Length = 589

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 56/115 (48%), Gaps = 18/115 (15%)

Query: 75  GSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINI 134
            SL +T+  ++++ +D+N+N        N + +P  S  S +    + T LQ  DA +  
Sbjct: 358 SSLITTSLDKTIRHWDLNTN-------KNIQTIPLPSPVSVYTSPIINT-LQCFDAALAT 409

Query: 135 YD----IRKWDTPLRSLIDS---HHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
                 +R WD  +  ++ S   H+D++T LKF+      L+S S D    ++DL
Sbjct: 410 GSRDGIVRLWDLRIGKIVRSFEKHNDEITGLKFNNKQ---LVSTSLDNSIKIWDL 461

>TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.356
           YLR196W
          Length = 563

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 56/111 (50%), Gaps = 11/111 (9%)

Query: 77  LFSTATAESVKIFDINSNNGP--IATLHNDKNVPFLSLDSRHG-LLAMGTELQGVDAQIN 133
           L ST+   +VK++D+NS      +A++H+ KNV      + +G +L  G    G D++I 
Sbjct: 288 LASTSADHTVKLWDLNSATAARSMASIHSGKNVSSSEWHTTNGSVLLTG----GYDSRIA 343

Query: 134 IYDIRKWDTPLRSLIDS--HHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           + D+R  D    S   S    +DV  + F  +D  ++L G+  G    +D+
Sbjct: 344 LSDVRIPDETKMSKYWSVVPGEDVETVTF--ADENIMLCGTDSGNIYSFDI 392

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 8/98 (8%)

Query: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDAL 191
           + I D+R   +P+  L++ H   V  LK+HPS P VL +   D     +DL      + L
Sbjct: 324 VIILDMRYPGSPML-LLEGHAAPVNQLKWHPSKPNVLATCGDDCQILYWDLL-----ELL 377

Query: 192 HQVMNYASIHSCGWLSPNRIFTLS--HMETFAIHELND 227
                +  +    W + + + TL    M   A +E+N+
Sbjct: 378 SASQVWTGLTQQRWSTTSTVRTLETPQMSYTAQYEVNN 415

>Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W
           (REAL)
          Length = 707

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 19/85 (22%)

Query: 107 VPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSL---------IDSHHDDVTA 157
           V  +S++  +GLLA GTE   V+          WD   RS          ID+    VTA
Sbjct: 183 VNHVSINDVNGLLAAGTETNVVEF---------WDPRSRSRVSKLYLENNIDNRPFQVTA 233

Query: 158 LKFHPSDPTVLLSGSTDGYTNVYDL 182
             F  +D      G+++GY+ +YDL
Sbjct: 234 TSFR-NDGLTFACGTSNGYSYLYDL 257

>CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} similar
           to uniprot|Q05583 Saccharomyces cerevisiae YDR267c
          Length = 337

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 68/173 (39%), Gaps = 17/173 (9%)

Query: 75  GSLFSTATAE-SVKIFDINSNNGP---IATLH-NDKNVPFLSLDSRHGLLAMGTELQGVD 129
           G L +T + + SV I++ +        I+ L  + ++V  +   ++H LLA  +     D
Sbjct: 123 GCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSS----YD 178

Query: 130 AQINIYDIRKWDTPLRSLIDSHHDDVTALKF-HPSDPTVLLSGSTDGYTNVYDLTQQDED 188
             + I+     D    +++  H   +    F    DP  L SGS D    V+     DED
Sbjct: 179 DTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDED 238

Query: 189 DALHQV-------MNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKE 234
           D    V        + + I+   W    RI ++      A+++      E+ E
Sbjct: 239 DQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYKEKQNDSEVSE 291

>NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 5/106 (4%)

Query: 78  FSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDI 137
           F+  ++  V+IF   +    I T    K+V + +     G L +  +  G+   +++YD 
Sbjct: 55  FAVTSSTRVQIFSSRTRQ-VIKTFSRFKDVVYSASFRSDGKLLVAGDATGL---VSVYDS 110

Query: 138 RKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
               T L S+  S H      KFHP D   L++ S D    ++D++
Sbjct: 111 YNPRTILLSINASTHP-THVTKFHPQDNKTLITASDDRVIRLWDIS 155

>KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.119
           YGL004C
          Length = 412

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           D+  NI+   +   PL  + ++H  D+T++KF PS   ++LS STD    ++ L
Sbjct: 117 DSNGNIHLYYELFNPLYKIEEAHFGDITSVKFFPSG-KLILSASTDMRMKIWSL 169

>KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 723

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 13/97 (13%)

Query: 89  FDINSNNGPIATL---HNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLR 145
           F   S+N P +++   HND  V   +L      +A GT+    D  + ++D+R     +R
Sbjct: 553 FSTISSNNPRSSVLLTHNDPPV-IGALQCYDAAMATGTK----DGIVRLWDLRMGQV-VR 606

Query: 146 SLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           +L + H D VT L+F   D   L++GS D    ++DL
Sbjct: 607 TL-EGHTDAVTGLQF---DAVNLVTGSLDRSIRIWDL 639

>YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Protein
           with WD-40 repeats involved in rRNA processing;
           associates with trans-acting ribosome biogenesis
           factors; similar to beta-transducin superfamily
          Length = 576

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 42/76 (55%), Gaps = 5/76 (6%)

Query: 65  LKILNSDFHCGSLFSTATAESVKIFDINSNNGP--IATLHNDKNVPFLSLDSRHGLLAMG 122
           L + ++ +    L ST+   +VK++D+NS N    +A++H++KNV        +G + + 
Sbjct: 290 LSMAHNKYFRSVLASTSADHTVKLWDLNSGNAARSLASIHSNKNVSSSEWHMLNGSILL- 348

Query: 123 TELQGVDAQINIYDIR 138
               G D+++ + D+R
Sbjct: 349 --TGGYDSRVALTDVR 362

>KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.247
           YKR036C
          Length = 653

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 9/76 (11%)

Query: 111 SLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLS 170
           +L S    LA G+     D  I ++D+R     +R+ I +H+  VTALKF   D T L++
Sbjct: 511 TLQSYENALATGSR----DGLIRLWDLRIGKV-VRT-IPAHNSAVTALKF---DTTHLIT 561

Query: 171 GSTDGYTNVYDLTQQD 186
           GS D    ++DL   D
Sbjct: 562 GSFDRTAFIWDLRTGD 577

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDAL 191
           I ++D R     LRS    H+  + + KF+    ++L+SG ++G  N++DL + D  + +
Sbjct: 268 IGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSLLISGDSEGRINLWDLRKLD-GEPI 326

Query: 192 HQVMNYASIHSCGWLSPN 209
             + + +SI +  W +PN
Sbjct: 327 KTLHHGSSISTLEW-NPN 343

>AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR175W
           (SWD3)
          Length = 320

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 137 IRKWDT---PLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
           I++WD     L   + +H D V ++     D T+L SGS DG   ++D
Sbjct: 120 IKQWDVLSGTLLKTMSAHSDPVVSIDTPDCDATILSSGSYDGLIRIFD 167

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 141 DTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           D+P     ++H D+VTAL     DP+ L+SGS D     +DL
Sbjct: 489 DSPCVYTFEAHTDEVTALSL---DPSFLVSGSQDRTIRQWDL 527

>Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON}
           complement(17489..19777) [2289 nt, 763 aa]
          Length = 762

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 84/215 (39%), Gaps = 23/215 (10%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDED 188
           D  I + D +K    L   +  H   V ALK+   +  +L+SGSTD    V+D+ +    
Sbjct: 407 DKMIRVIDAKKKKFLLE--LSGHDGGVWALKY--DEDGILVSGSTDRTVRVWDIKR---G 459

Query: 189 DALHQVMNYASIHSC----GWLSPNRIFTLSHMETFAIHELNDKSEELKE--PQPLDFGD 242
              H    + S   C     + +   I T S   T  + +L  +S    E    PL F  
Sbjct: 460 CCTHVFKGHTSTVRCLDIVEYKNVKYIVTGSRDNTLHVWKLPRESSSTGEDPSYPLYFNS 519

Query: 243 VREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKD-----SVVIPSAHGDE 297
             E     Y + +  G++A+ ++  G+G + +  +   N+ V D      + I + H D 
Sbjct: 520 PEEN---PYFVGILRGHMASVRTVSGHGNIVISGSYDNNLMVWDIAQMKCLYILTGHTDR 576

Query: 298 VIRDVFIPPSHSELVYSCGEDGFVNLWKNNNGALN 332
           +   ++          S   D  + +W   N + N
Sbjct: 577 IYCTIY--DHKRRRCISASMDSSIRIWNLENISKN 609

>AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YJL112W (MDV1) and YKR036C
           (CAF4)
          Length = 715

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 16/106 (15%)

Query: 85  SVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKW---- 140
           ++K+++++ N    +   +   V  + +D  + L+  G      DA + ++DI+K     
Sbjct: 435 TIKVWNLSKNKHVASITGHLATVSCMQMDQYNTLITGGR-----DALLKMWDIQKAIDND 489

Query: 141 ----DTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
               D       DSH D++TAL F  ++   L+SGS D     +DL
Sbjct: 490 SIPSDEVCIYTFDSHIDEITALSFEANN---LVSGSQDRTIRQWDL 532

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 12/122 (9%)

Query: 131 QINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL-------- 182
           ++ I D+R   +P+  +++ H   V  +++HPS   VLLS + D     +DL        
Sbjct: 378 RVLILDMRNPGSPVL-VLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYWDLNNYIMGHP 436

Query: 183 TQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLD-FG 241
           T QD D A+        +    W S N + TL     F  +   + +  +  PQ  D FG
Sbjct: 437 TDQDPDHAVDSQQQNNPV--AKWNSKNVLRTLDTPSMFYSNGGQEVNNIVWRPQGDDWFG 494

Query: 242 DV 243
            V
Sbjct: 495 SV 496

>Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W
           (REAL)
          Length = 1152

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDAL 191
           I ++D+RK  TPL SL   H   V ++ F+    T ++S S DG    +D +    +   
Sbjct: 182 IFVWDLRKGSTPLCSL-KGHVSSVNSIDFNRFKSTEIMSSSNDGTVKFWDYSTSTTESKR 240

Query: 192 HQVMNY 197
               N+
Sbjct: 241 TVTTNF 246

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ 184
           I I+D+R   TPL  L+  H   V ++ F+    + ++S S DG    +D+++
Sbjct: 185 IYIWDLRMGSTPLHKLV-GHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDISK 236

>Smik_7.189 Chr7 complement(325444..328791) [3348 bp, 1115 aa] {ON}
           YGL094C (REAL)
          Length = 1115

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 77/193 (39%), Gaps = 37/193 (19%)

Query: 1   MSISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNL 60
           M  +P+SL N+   G +N  +    +D   G L SL N               S +V  L
Sbjct: 120 MCYTPHSLQNNIYCGGDNTNWGIASIDLNKGTLDSLLN--------------YSFKVKLL 165

Query: 61  SINDLKILNSDFHCGS--LFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGL 118
             N+ KIL+     GS  L   A+  ++K F+ +S +     L ++  V        + L
Sbjct: 166 CSNN-KILSIGRQTGSVDLLDPASNRTIKSFNAHSASISAMDLRDNTLVTVGKSKRFYNL 224

Query: 119 LAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTAL--------KFHPSDPTVLLS 170
            A        D  +N+YDIR     +R L        T +        + HP  PTV++ 
Sbjct: 225 YA--------DPFVNVYDIRT----MRQLPPVSFSKGTTMGSGGADFVQLHPLLPTVMIV 272

Query: 171 GSTDGYTNVYDLT 183
            S+ G  +  DL+
Sbjct: 273 ASSSGSFDFIDLS 285

>NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON}
           Anc_4.309 YLR429W
          Length = 661

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 55/134 (41%), Gaps = 35/134 (26%)

Query: 66  KILNSDFHCGSLFSTATAE---SVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMG 122
           +IL++DF   + +  A+A    S+ I+DI  N  P   L +++N+P              
Sbjct: 86  QILDTDFDPFNTYRIASASDDCSIGIWDIPKNYSPSTYLDDEENIP-------------- 131

Query: 123 TELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
              + +     +Y               H   V  + +HP+ P +L S S D    ++++
Sbjct: 132 ---KDISPSFFLY--------------GHARKVGHILYHPTIPNILASSSLDYSVKIWNI 174

Query: 183 -TQQDEDDALHQVM 195
            T++DE    H  M
Sbjct: 175 GTKKDEITLRHSDM 188

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 57/109 (52%), Gaps = 10/109 (9%)

Query: 77  LFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLD-SRHGL-LAMGTELQGVDAQINI 134
           +F+ ++ ++ +++DI +  G    L      P LS+  +  GL LA G+E    D  I+I
Sbjct: 652 IFTGSSDKTCRMWDITT--GESVRLFIGHTAPILSVAVAPDGLRLATGSE----DGVIHI 705

Query: 135 YDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
           +DI    + L+ LI      V +L ++  +  +L+SG +D    ++DLT
Sbjct: 706 WDIGTGKS-LKKLIGHGKSAVNSLSYN-KESNILVSGGSDNSVRIWDLT 752

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 72/167 (43%), Gaps = 26/167 (15%)

Query: 28  KANGLLLSL-SNGEIHCLDFGTC------QSKQSIRVSNLSINDLKILNSDFHCGSLFST 80
           K N +L S  S GEI+  D  TC       +  +  V++  I ++  L  +     +F++
Sbjct: 117 KQNNVLASGGSKGEIYIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFAS 176

Query: 81  ATAES-VKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLL------------AMGTELQG 127
           A + S   I+D+ +       +H     P   L S+  ++            A G++ + 
Sbjct: 177 AGSTSYASIWDLKAKK---EVIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEP 233

Query: 128 VDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTD 174
           +   I ++D+R  +TPL+ L   H   + +L +   D  +LLS   D
Sbjct: 234 L---ILVWDLRNANTPLQVLSKGHSKGILSLDWCSQDEELLLSSGRD 277

>KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {ON}
           Anc_7.338 YLR208W
          Length = 304

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 6/80 (7%)

Query: 250 DYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPPSHS 309
           D V+D Y   +A   S +    +K+    GE+   +  V   + H   V R  +  P   
Sbjct: 14  DAVLDYYGKRLATCSSDK---TIKIFEVEGES---QKLVSTLTGHEGPVWRVDWAHPKFG 67

Query: 310 ELVYSCGEDGFVNLWKNNNG 329
            ++ SC  DG V +WK  NG
Sbjct: 68  TILASCSYDGKVIIWKEENG 87

>Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W
           (REAL)
          Length = 315

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 137 IRKWDT---PLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
           I+ WDT    L   I +H + V ++    +D ++L SGS DG   ++D
Sbjct: 120 IKIWDTLNGSLMKTISAHSEAVVSVDVPTNDSSILSSGSYDGLIRIFD 167

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 45/114 (39%), Gaps = 11/114 (9%)

Query: 137 IRKWDTPLRSL---IDSHHDDVTALKFHP----SDPTVLLSGSTDGYTNVYDLTQQDEDD 189
           ++ WD   R     +  H   V  L F       D   L+SG  D   N+Y    + +  
Sbjct: 191 VKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQLISGGRDNIINLYQFDSRKKCK 250

Query: 190 ALHQVMNYASIHSCGWLSP----NRIFTLSHMETFAIHELNDKSEELKEPQPLD 239
            L  +  +  + SCG+++     N ++T      + I  L+  S   K  QP++
Sbjct: 251 LLKTLPIHQQVESCGFINTGGVQNCVYTAGSDAVYQIVSLDTGSVIRKTAQPIE 304

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 79/181 (43%), Gaps = 23/181 (12%)

Query: 21  FKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLKILNSDF--HCGSLF 78
           F + P+D    LL+S S+ +  C+ +   QS   +R + L  +D ++ +  F  H   LF
Sbjct: 228 FHWNPIDT--NLLIS-SSIDTTCIVWD-LQSSNYVR-TQLIAHDSEVFDVKFLAHSTQLF 282

Query: 79  STATAE-SVKIFDI------------NSNNGPIATLHNDKNVP--FLSLDSRHGLLAMGT 123
           ++   + SV++FD+            NS+     TL +++  P   L L        +  
Sbjct: 283 ASCGGDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMA 342

Query: 124 ELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
                   I I D+R   +P+ +L + H   V  +K+HP    VLLS   D     +DL 
Sbjct: 343 TFALDSKSILILDMRNPGSPVLTL-EGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLN 401

Query: 184 Q 184
           +
Sbjct: 402 E 402

>TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.119
           YGL004C
          Length = 429

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 116 HGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTD 174
           H L A+G         I +YD +K D   R +  +H  D+T+L+F PS   VLLS S D
Sbjct: 123 HELYALGN----AKGDIKVYD-KKLDLQ-REMKGAHLSDITSLRFFPSGE-VLLSSSND 174

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 151 HHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           H   +T + FHPS P +L + S D Y + +D+
Sbjct: 113 HFRAITDINFHPSHPELLATCSIDTYVHAWDM 144

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 131 QINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           +I I D+R  +TP+ +L   H   +  +K+HP++  +LLS + D     +DL
Sbjct: 372 KIIILDMRNPETPVLTL-QGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

>Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196W
           (REAL)
          Length = 576

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 5/64 (7%)

Query: 77  LFSTATAESVKIFDINSNNGP--IATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINI 134
           L ST+   +VK++D+NS N    +A++H++KNV   S    H L        G D+++ +
Sbjct: 302 LASTSADHTVKLWDLNSGNAARSLASIHSNKNV---SSSEWHMLNGSVLLTGGYDSRVAL 358

Query: 135 YDIR 138
            D+R
Sbjct: 359 TDVR 362

>TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa]
           {ON} Anc_4.119 YGL004C
          Length = 388

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%), Gaps = 9/124 (7%)

Query: 224 ELNDKSEELKEPQPLDFGDVREKWGCDYVIDVYPGY---IAAGKSQEGNGQ-LKLIPTNG 279
           ++ND + E +  Q   F  ++E    D  +    G    I  G S EGN + L    T+ 
Sbjct: 68  KINDFNYEFQTGQEFKFAQLKEDPNQDINVTSIDGTNDKIVVGDS-EGNIEILNNDNTSK 126

Query: 280 ENISVKDSVVIPSAHGDEVIRDVFIPPSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWD 339
           + IS  +S+VIP AH   + +    P     L  S   D  +N++   +G+   P  F  
Sbjct: 127 DKISFTESLVIPQAHFSGITKSKIFPSGVVLLTGSI--DMSINIFSMTDGS--NPRTFKG 182

Query: 340 YSKR 343
           +SKR
Sbjct: 183 HSKR 186

>Kwal_27.11124 s27 complement(647446..650835) [3390 bp, 1129 aa]
           {ON} YGL094C (PAN2) - 135-kDa protein that is subunit of
           poly(A) ribonuclease [contig 31] FULL
          Length = 1129

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTA--------LKFHPSDPTVLLSGSTDGYTNVY 180
           D  +N+YD+R     L  +  SH  ++++        ++ HP  PTVL+  ST G  N  
Sbjct: 226 DPFVNVYDLRMMRQ-LTPVAFSHGQEMSSSGSAGADFVRLHPILPTVLIVASTSGAFNFI 284

Query: 181 DLT 183
           DL 
Sbjct: 285 DLV 287

>Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 5/64 (7%)

Query: 77  LFSTATAESVKIFDINSNNGP--IATLHNDKNVPFLSLDSRHGLLAMGTELQGVDAQINI 134
           L ST+   +VK++D+NS N    +A++H++KNV   S    H L        G D+++ +
Sbjct: 306 LASTSADHTVKLWDLNSGNAARSLASIHSNKNV---SSSEWHMLNGSVLLTGGYDSRVAL 362

Query: 135 YDIR 138
            D+R
Sbjct: 363 TDVR 366

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 131 QINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           +I I D+R  ++P+ +L + H   V  +K+HP+   VLLS S D     +DL
Sbjct: 374 KIIILDMRNPESPILNL-EGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDL 424

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 131 QINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL 182
           +I I D+R  ++P+ +L + H   V  +K+HP+   VLLS   D     +DL
Sbjct: 374 KIIILDMRNPESPILNL-EGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

>YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essential
           nucleolar protein, required for biogenesis of the small
           ribosomal subunit; contains WD repeats, interacts with
           Mpp10p and Bfr2p, and has homology to Spb1p
          Length = 707

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 19/85 (22%)

Query: 107 VPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSL---------IDSHHDDVTA 157
           V  +S++  +GLLA GTE   V+          WD   RS          ID+    VT 
Sbjct: 183 VNHVSINEVNGLLAAGTETNVVEF---------WDPRSRSRVSKLYLENNIDNRPFQVTT 233

Query: 158 LKFHPSDPTVLLSGSTDGYTNVYDL 182
             F  +D      G+++GY+ +YDL
Sbjct: 234 TSFR-NDGLTFACGTSNGYSYIYDL 257

>Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON}
           similar to Ashbya gossypii AGR207C
          Length = 313

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 137 IRKWD----TPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
           I++WD    T L+++  +H D V ++     D T+L SGS DG   ++D
Sbjct: 120 IKEWDILTGTVLKTM-SAHSDPVVSIDVPVCDSTILSSGSYDGLIRIFD 167

>TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.450
           YMR102C
          Length = 945

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 56/130 (43%), Gaps = 24/130 (18%)

Query: 69  NSDFHCGSLFSTATAESVKI--FDINSNNG-------------PIATLHNDKNVPFLSLD 113
           NS  +  S F++    + ++   D NSN+G             P+       N   L LD
Sbjct: 357 NSTLYNNSTFTSNVKSNSRLESADQNSNSGSTMNLFAPVFKPRPVKVFQEHTN-DILDLD 415

Query: 114 -SRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGS 172
            SR+G +   +    +D  + ++   K +  LR+   SH D VT +KFHP D    +SG 
Sbjct: 416 WSRNGFILTSS----IDKTVKLWHTDK-NKSLRTF--SHPDFVTTVKFHPIDDRFFISGC 468

Query: 173 TDGYTNVYDL 182
            D    ++ +
Sbjct: 469 IDQKCRLWSI 478

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTD 174
           D  I ++D+R  + PL++L   H   V +L +   D T+LLS   D
Sbjct: 228 DPSILVWDLRNANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRD 273

>KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.585
           YBR175W
          Length = 315

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 128 VDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLT 183
           +D  I I+D+   +  L   I +H + V ++     D +VL SGS DG   ++D T
Sbjct: 118 MDESIKIWDVL--NGTLMKTISAHSEAVVSIDVPTLDSSVLGSGSYDGLIRIFDTT 171

>TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.626
           YPL126W
          Length = 891

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%)

Query: 103 NDKNVPFLSLDSRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHP 162
           N K +  ++LD+    LA+G    GV   +N++D+        +L+  H D V +L F+ 
Sbjct: 252 NSKYISTMALDNSCTKLALGFA-SGVINVVNLFDLT------STLLKWHIDTVLSLCFN- 303

Query: 163 SDPTVLLSGSTDGYTNVYDLTQQDE 187
           SD T L+SG  +   + + LT  ++
Sbjct: 304 SDATYLISGGWEKVISFWQLTTNNQ 328

>TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.67
           YFL009W
          Length = 640

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 75/184 (40%), Gaps = 19/184 (10%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDED 188
           D  I +YD  K    +   +  H   V ALK+   +  +L+SGSTD    V+D+ +    
Sbjct: 287 DKVIRVYDSEKKQFLME--LTGHDGGVWALKY--DEDGILVSGSTDRSVRVWDIKR---G 339

Query: 189 DALHQVMNYASIHSC----GWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVR 244
              H    +AS   C     +     I T S   T  + +L  +     +  P+ +    
Sbjct: 340 CCTHVFKGHASTVRCLDIVEYKKVKYIVTGSRDNTLHVWKLPLEPVAEGQEWPVVYNTPE 399

Query: 245 EKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKD-----SVVIPSAHGDEVI 299
           E     Y + V  G++A+ ++  G+G + +  +   N+ V D      + I + H D + 
Sbjct: 400 EN---PYFVGVLRGHMASVRTVSGHGNIVISGSYDNNLMVWDIAQMKCLYILTGHTDRIY 456

Query: 300 RDVF 303
             ++
Sbjct: 457 STIY 460

>YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essential
           subunit of the COMPASS (Set1C) complex, which methylates
           histone H3 on lysine 4 and is required in
           transcriptional silencing near telomeres; WD40 beta
           propeller superfamily member and ortholog of mammalian
           WDR5
          Length = 315

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 137 IRKWDT---PLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYD 181
           I+ WDT    L   I +H + V ++    +D ++L SGS DG   ++D
Sbjct: 120 IKIWDTLNGSLMKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFD 167

>TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.450
           YMR102C
          Length = 918

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 8/75 (10%)

Query: 109 FLSLD-SRHGLLAMGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTV 167
            L LD S++G L   +    +D  + +++I K  + LR+ +  H D VT++KF P+D   
Sbjct: 293 ILDLDWSKNGFLVSAS----MDKSVKLWNIEKKQS-LRTYL--HPDFVTSIKFLPTDDRF 345

Query: 168 LLSGSTDGYTNVYDL 182
           ++SG  D    V+ +
Sbjct: 346 IISGCLDHKCRVWSI 360

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDED 188
           D  I I+D+R  + P++ L   H   V +L +   D T+LLS   D   NV  L   +E 
Sbjct: 228 DPSILIWDLRNANVPMQVLSQPHTKGVLSLDWCKQDETLLLSSGRD---NVCVLWNPEEG 284

Query: 189 DALHQ 193
            +L Q
Sbjct: 285 QSLTQ 289

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 8/96 (8%)

Query: 134 IYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDEDDALHQ 193
           I D+R   +P+ +L + H+  +  L++HPS P VL +   D     +DL      D+L+ 
Sbjct: 323 ILDMRYPGSPILTL-NGHYCALNQLRWHPSKPNVLATCGDDCQILYWDLL-----DSLNG 376

Query: 194 VMNYASIHSCGWLSPNRIFTLS--HMETFAIHELND 227
               + I    W S N +  L    M   A +E+N+
Sbjct: 377 GTISSGIPQQRWTSTNTVHFLETPQMSYTAQNEVNN 412

>TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.429
           YDR364C
          Length = 452

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 140 WDTPLRSLIDSH--HDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185
           WDT    +   +  H     LKFHPS+P   + G ++   N YD+  Q
Sbjct: 230 WDTETGKVTSRYNFHSTPNDLKFHPSEPNSFIVGLSNSKINHYDVRVQ 277

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,892,601
Number of extensions: 2095842
Number of successful extensions: 7517
Number of sequences better than 10.0: 392
Number of HSP's gapped: 7673
Number of HSP's successfully gapped: 444
Length of query: 397
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 285
Effective length of database: 40,638,807
Effective search space: 11582059995
Effective search space used: 11582059995
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)