Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F042301.81ON70170132630.0
NCAS0A005801.81ON68959215370.0
Smik_14.651.81ON79054014560.0
Skud_14.681.81ON75256214280.0
YNL272C (SEC2)1.81ON75953314080.0
Suva_14.701.81ON75153813970.0
KAFR0D039601.81ON66454913241e-174
SAKL0C02596g1.81ON73452913091e-171
TDEL0C062001.81ON70053813051e-171
CAGL0J08228g1.81ON75253312661e-164
Ecym_10851.81ON70553112311e-159
ZYRO0F16698g1.81ON77956312291e-158
Kpol_2000.671.81ON82453412301e-158
TPHA0B045001.81ON73354111941e-153
AFR670W1.81ON71752511771e-151
Kwal_33.133891.81ON69453311691e-150
KNAG0F004601.81ON65453311641e-150
KLTH0F02354g1.81ON73353211581e-148
TBLA0A054301.81ON79555011241e-142
KLLA0C02299g1.81ON65852210671e-135
Kwal_26.8128singletonOFF10168721.0
CAGL0H06765g5.717ON129473761.8
Smik_15.5067.68ON157686752.1
Skud_15.4937.68ON157485742.9
YOR326W (MYO2)7.68ON157485743.0
Kpol_1067.281.459ON1053118716.6
Suva_8.3777.68ON156885717.0
Smik_6.1603.134ON19932688.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F04230
         (701 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1...  1261   0.0  
NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON...   596   0.0  
Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {O...   565   0.0  
Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {O...   554   0.0  
YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON} ...   546   0.0  
Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {O...   542   0.0  
KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.8...   514   e-174
SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {...   508   e-171
TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1...   507   e-171
CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} simil...   492   e-164
Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}...   478   e-159
ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weak...   478   e-158
Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON} (1441...   478   e-158
TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1...   464   e-153
AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic ...   457   e-151
Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {...   454   e-150
KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}...   452   e-150
KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {...   450   e-148
TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa] ...   437   e-142
KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {...   415   e-135
Kwal_26.8128 s26 complement(657798..658103) [306 bp, 101 aa] {OF...    32   1.0  
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...    34   1.8  
Smik_15.506 Chr15 (875291..880021) [4731 bp, 1576 aa] {ON} YOR32...    33   2.1  
Skud_15.493 Chr15 (865472..870196) [4725 bp, 1574 aa] {ON} YOR32...    33   2.9  
YOR326W Chr15 (925721..930445) [4725 bp, 1574 aa] {ON}  MYO2One ...    33   3.0  
Kpol_1067.28 s1067 (63984..67145) [3162 bp, 1053 aa] {ON} (63984...    32   6.6  
Suva_8.377 Chr8 (666400..671106) [4707 bp, 1568 aa] {ON} YOR326W...    32   7.0  
Smik_6.160 Chr6 complement(265680..266279) [600 bp, 199 aa] {ON}...    31   8.7  

>NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1.81
           YNL272C
          Length = 701

 Score = 1261 bits (3263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/701 (89%), Positives = 625/701 (89%)

Query: 1   MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS 60
           MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS
Sbjct: 1   MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS 60

Query: 61  IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA 120
           IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA
Sbjct: 61  IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA 120

Query: 121 RKEAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETENNRYSMILPDSATIS 180
           RKEAHAKEILNSRLMGQLREKD                    ETENNRYSMILPDSATIS
Sbjct: 121 RKEAHAKEILNSRLMGQLREKDNLLETLTLQLKSLKKVLQNVETENNRYSMILPDSATIS 180

Query: 181 GASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSIKDTS 240
           GASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSIKDTS
Sbjct: 181 GASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSIKDTS 240

Query: 241 SDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQMGHT 300
           SDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQMGHT
Sbjct: 241 SDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQMGHT 300

Query: 301 TPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYLLKTQT 360
           TPPLGMNTQEEADAQRKVPKMFKF      VAVRDPCAFCGEERNDIIEHARMYLLKTQT
Sbjct: 301 TPPLGMNTQEEADAQRKVPKMFKFPSSSPPVAVRDPCAFCGEERNDIIEHARMYLLKTQT 360

Query: 361 TQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGSSKFS 420
           TQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGSSKFS
Sbjct: 361 TQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGSSKFS 420

Query: 421 EVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXXXXXXXX 480
           EVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARV             
Sbjct: 421 EVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVEPHGNHNNNNTNS 480

Query: 481 XXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQDEEFTTIDM 540
                 QPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQDEEFTTIDM
Sbjct: 481 PIENIGQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQDEEFTTIDM 540

Query: 541 TAEYIAQDMPLATRNLGDENTDAELAADVEATGNTTLQNKEEQNEDKEXXXXXXXXXXXX 600
           TAEYIAQDMPLATRNLGDENTDAELAADVEATGNTTLQNKEEQNEDKE            
Sbjct: 541 TAEYIAQDMPLATRNLGDENTDAELAADVEATGNTTLQNKEEQNEDKEATSTSGSVSDSS 600

Query: 601 XXXKFGTPKXXXXXXXXXXXXXXXXNDEGTNSVDIIESYDNHSKEGNVEDVTEKQSQNTN 660
              KFGTPK                NDEGTNSVDIIESYDNHSKEGNVEDVTEKQSQNTN
Sbjct: 601 ADSKFGTPKESLESETSEEELQDESNDEGTNSVDIIESYDNHSKEGNVEDVTEKQSQNTN 660

Query: 661 SELPSVSNKTQNAEVLAYAEAPSAETDISNVREDSIKIKET 701
           SELPSVSNKTQNAEVLAYAEAPSAETDISNVREDSIKIKET
Sbjct: 661 SELPSVSNKTQNAEVLAYAEAPSAETDISNVREDSIKIKET 701

>NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON}
           Anc_1.81 YNL272C
          Length = 689

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/592 (54%), Positives = 421/592 (71%), Gaps = 41/592 (6%)

Query: 1   MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS 60
           M E SEESKRIS QV++LSTQLIESI KQS LEEKLN AN+ I SQ+ SL++   L+ + 
Sbjct: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60

Query: 61  IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA 120
            +L+ S   + +E++  + ++ RE +LRE+AE EVEKLSKEVEDLTATLFDEANNMVADA
Sbjct: 61  EKLKISSEDQQKELDNFKVKIRRERELRENAEQEVEKLSKEVEDLTATLFDEANNMVADA 120

Query: 121 RKEAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETENN------RYSMILP 174
           RK+ +  E+LN++L+ QL EKD                    E ENN      RYS+I P
Sbjct: 121 RKDKYTVEVLNTKLVEQLHEKDNLLETLNLQLKNLKKVLQTVEDENNSLIGNNRYSIIQP 180

Query: 175 DSATISGAS--LDKVTTRTSSSFSQQ--PMNNGIIYSPNISSIRYDLSLYEEFLKFIAVI 230
           DSAT S ++  L+K+TT T SS+SQ    M NGIIYSP ISSIRYDL LYEEFLKFIAVI
Sbjct: 181 DSATTSSSTTSLEKITT-TVSSYSQNISNMANGIIYSPIISSIRYDLPLYEEFLKFIAVI 239

Query: 231 PHCKSIKDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSG 290
           PHC++IKDTSSDSKLIRRL+ DEI+PVLK+DNA+GLGW+V+KT+LSTMMEGLV+VEPLSG
Sbjct: 240 PHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVVVEPLSG 299

Query: 291 INEMYQMGHTTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEH 350
           +NE +QMG++T P       + ++Q  +PK+FKF      +A+ +PC+FCGE R+DIIEH
Sbjct: 300 VNETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESRDDIIEH 359

Query: 351 ARMYLLKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSA 410
           ARMY+LKTQ  Q+DGT+++ NT+PLCHWCLFK+RQTCEIFAFLRSLKT +WNLEKV + +
Sbjct: 360 ARMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLEKVTMKS 419

Query: 411 ISKYGSSKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXX 470
           IS   SS+FS VT+         I  T K+E+++SKRMSF+ GL + +SS I  A+V   
Sbjct: 420 ISSKDSSRFSVVTSA--------IRQT-KTEDRRSKRMSFIGGLTK-NSSAINTAQVEST 469

Query: 471 XXXXXXXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFT 530
                            PTTNIQRAW+QLCKLRSILHWAH+GIWS+DDS+++K+GPE+  
Sbjct: 470 TSMEITGL---------PTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKD 520

Query: 531 QDEEF------TTIDMTAEYIAQDMPLATRNLGDENTDAELAADVEATGNTT 576
            D++         I +T + I +D+     ++  EN   E + D E++ +T+
Sbjct: 521 PDDKLEPASIEANIKITKKQIEKDV----ESIISENNQGE-SFDFESSASTS 567

>Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {ON}
           YNL272C (REAL)
          Length = 790

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/540 (54%), Positives = 375/540 (69%), Gaps = 32/540 (5%)

Query: 3   ETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIE 62
           + SEE+KRIS+QV+SLSTQLIES+ KQS LEE+LN++ +TI+SQK+++   + L+     
Sbjct: 2   DASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEA 61

Query: 63  LEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARK 122
           L++++  + +EVNKLRE + +E +LR  AE E +KL+KEVEDLTA+LFDEANNMV+DARK
Sbjct: 62  LKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARK 121

Query: 123 EAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETEN------NRYSMILPDS 176
           E +A EILN RL  QLREKD                    + E+      NRYS IL DS
Sbjct: 122 EKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDS 181

Query: 177 ATISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSI 236
           AT S  SL+KV T  SS+   Q M +GI+YSP+ISSIRYD+SLY EFLKF+A +P+C +I
Sbjct: 182 ATSSSTSLNKVPTLNSSA--SQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNI 239

Query: 237 KDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQ 296
           K TSS+SKLIRRL+ DEI P+LKIDNA+G+GWLVKKTLLS +++GLV++EPLSG+N  YQ
Sbjct: 240 KATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQ 299

Query: 297 MGH-TTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYL 355
           +G+ ++ P+         A   +P+MFKF      VAV   C+FCGE R+DIIEHARMY+
Sbjct: 300 IGYNSSSPVKQ-------ATPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYI 352

Query: 356 LKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYG 415
           LKT    DDGT  + NTYPLCHWCL K+RQTCEIFAFLRSLK   W+LEK+   +I+K  
Sbjct: 353 LKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGD 412

Query: 416 SSKFSEVTT-TNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXX 474
             KFSEVT  T T+G          S++KK+KR+SFMAGLG   SSK             
Sbjct: 413 LGKFSEVTKRTKTDG-------RVSSQDKKAKRLSFMAGLGINSSSK--------SKQKM 457

Query: 475 XXXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQDEE 534
                       QPTTNIQRAWLQLCKLR ILHW+HIGIW+VDDS+S+K+GP V  +D +
Sbjct: 458 EVFSSEANAKPGQPTTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGDEDSD 517

>Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {ON}
           YNL272C (REAL)
          Length = 752

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/562 (53%), Positives = 377/562 (67%), Gaps = 31/562 (5%)

Query: 3   ETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIE 62
           + SEE+KRISIQV+SLSTQLIES+ KQS LEE+LN++ +TI SQK ++E  + LE     
Sbjct: 2   DASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNT 61

Query: 63  LEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARK 122
           L+++L+ R +EV KL E + +E +LR  AE E +KL++EVEDLTA+LFDEAN MVADAR+
Sbjct: 62  LKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARR 121

Query: 123 EAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETEN------NRYSMILPDS 176
           E +A EILN RL  QLREKD                    + E+      NRYS IL DS
Sbjct: 122 EKYAIEILNKRLTEQLREKDVLLETLTLQLKNLKKVMHSLDNESTVTNNSNRYSTILSDS 181

Query: 177 ATISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSI 236
           AT S  SL+KV T   +SF+ Q M +GI+YSP ISSIRYD+SLY EFLKF+A +P C++I
Sbjct: 182 ATSSSTSLNKVPTL--NSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENI 239

Query: 237 KDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQ 296
           K TSS+SKLIRRL+ DEI P+LKIDNA+G+GWLVKKTLLS +++GLVIVEPLSG+N  Y 
Sbjct: 240 KATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYH 299

Query: 297 MGH-TTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYL 355
           +G+ ++ P+  +T         +PKMFKF      VAV   C+FCGE R+DIIEHARMY+
Sbjct: 300 IGYNSSSPVKQSTA-------NMPKMFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYV 352

Query: 356 LKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYG 415
           LKT    DDGT  + NTYPLCHWCL K+RQTCEIFAFLRSLK   W+LEK+ +  I+K  
Sbjct: 353 LKTLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGD 412

Query: 416 SSKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXXX 475
             KFSEVT       + +      S +KKSKR+SFMAGLG   ++K              
Sbjct: 413 LVKFSEVTQRTKTEDRVS------SHDKKSKRLSFMAGLGINSTAK--------SKPKME 458

Query: 476 XXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQDEEF 535
                      QPTTNIQRAWLQLCKLR ILHW HIGIW+VDDS+S+K+GP V  +D + 
Sbjct: 459 VFSSEINAKPGQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVDDEDSDD 518

Query: 536 TTIDMTAEYIAQDMPLATRNLG 557
              D  +  + QD  L  +N G
Sbjct: 519 NQNDAISVRL-QDKTLWKKNKG 539

>YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON}
           SEC2Guanyl-nucleotide exchange factor for the small
           G-protein Sec4p; essential for post-Golgi vesicle
           transport and for autophagy; associates with the
           exocyst, via exocyst subunit Sec15p, on secretory
           vesicles
          Length = 759

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/533 (54%), Positives = 365/533 (68%), Gaps = 30/533 (5%)

Query: 3   ETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIE 62
           + SEE+KR+SIQV+SLSTQLIES+ KQS LEE+LN++ +TI SQK ++E  + L++    
Sbjct: 2   DASEEAKRVSIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLKEDYNT 61

Query: 63  LEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARK 122
           L++ L+ R +EV +LRE + +E +LR  AE E +KL+KEVEDLTA+LFDEANNMVADARK
Sbjct: 62  LKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARK 121

Query: 123 EAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETE------NNRYSMILPDS 176
           E +A EILN RL  QLREKD                    + E      +NRYS IL DS
Sbjct: 122 EKYAIEILNKRLTEQLREKDTLLDTLTLQLKNLKKVMHSLDNESTVTNNSNRYSTILSDS 181

Query: 177 ATISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSI 236
           AT S  SL+KV   TS S + Q + +GI+YSP+ISSIRYD+SLY EFLKF+A +P C++I
Sbjct: 182 ATSSSTSLNKVP--TSYSLASQDIYSGIVYSPSISSIRYDISLYNEFLKFVAALPRCENI 239

Query: 237 KDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQ 296
           K TS++SKLIRRL+ DEI P+LKIDNA+G+GWLVKKTLLS +++GLV+VEPLSG+N  YQ
Sbjct: 240 KATSTESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVVEPLSGVNATYQ 299

Query: 297 MGHTTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYLL 356
           +G+ +      +     A   +PKMFKF      VAV   C+FCGE R+DIIEHARMY+L
Sbjct: 300 IGYNS------SSPAKQATSNMPKMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYIL 353

Query: 357 KTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGS 416
           KT    DDG   + NTYPLCHWCL K+RQTCEIFAFLRSLK   W+LEK+    I+K   
Sbjct: 354 KTLHKTDDGKEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLTTQNITKEDL 413

Query: 417 SKFSEVTT-TNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXXX 475
            KFSEVT  T  +G          S++KK+KR+SFMAGLG   S+K              
Sbjct: 414 EKFSEVTKHTKRDGR-------VSSQDKKTKRLSFMAGLGINSSTK--------NKPKME 458

Query: 476 XXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEV 528
                      QPTTNIQRAWLQLCKLR ILHW HIGIW+VDDS+S+K+GP V
Sbjct: 459 IFSSETNAKPGQPTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLV 511

>Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {ON}
           YNL272C (REAL)
          Length = 751

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/538 (54%), Positives = 368/538 (68%), Gaps = 32/538 (5%)

Query: 3   ETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIE 62
           E SEE+KRISIQV+SLSTQLIES+ KQS LEE+LN++ +TI  QK +++  + L+     
Sbjct: 2   EASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIAGQKAAIDNYNKLKTDYDT 61

Query: 63  LEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARK 122
           L+++L  R  EV KL   + +E +LR  AE E +KL++EVEDLTA+LFDEAN+MVADARK
Sbjct: 62  LKKTLLERDNEVMKLNGNIAKETQLRTKAEDESDKLNREVEDLTASLFDEANHMVADARK 121

Query: 123 EAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETE----NN--RYSMILPDS 176
           E +A EILN RL  QLREKD                    + E    NN  RYS IL DS
Sbjct: 122 EKYAIEILNKRLTEQLREKDALLETLTLQLKNLKKVMHSLDNESTVTNNSGRYSTILSDS 181

Query: 177 ATISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSI 236
           AT S  SL+KV T  S+SF+ Q + +GI+YSP ISSIRYD +LY EFLKF+A +PHC++I
Sbjct: 182 ATSSSTSLNKVPT--SNSFTSQDLYSGIVYSPTISSIRYDSNLYNEFLKFVAALPHCENI 239

Query: 237 KDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQ 296
           K TSS+SKLIRRL+ DEI P+LKIDNA+G+GWLVKKTLLS +++G+V+VEPLSG+N  YQ
Sbjct: 240 KATSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGMVVVEPLSGVNATYQ 299

Query: 297 MGH-TTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYL 355
           +G+ ++ P+         A   +PKMFKF      VAV   C+FCGE R+DIIEHARMY+
Sbjct: 300 IGYNSSSPVKQ-------AAPNMPKMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYV 352

Query: 356 LKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYG 415
           LKT    DDGT  + NTYPLCHWCL K+RQTCEIFAFLRSLK   W+LEKV +  I K  
Sbjct: 353 LKTLHKADDGTEHVTNTYPLCHWCLLKVRQTCEIFAFLRSLKVGAWHLEKVTMQNIVKGD 412

Query: 416 SSKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXXX 475
             +FSEVT      +K +   +P   +K +KR+SFMAGLG   S+K +  RV        
Sbjct: 413 LERFSEVTKR----TKADGRVSP--HDKMAKRLSFMAGLGINSSTK-SKPRV-------E 458

Query: 476 XXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQDE 533
                       PTTNIQRAW+QLCKLR ILHW+HIGIW+VDDS+S+K+GP  F  DE
Sbjct: 459 VPSSEMTVKPGHPTTNIQRAWIQLCKLRCILHWSHIGIWAVDDSISSKIGP--FVDDE 514

>KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.81
           YNL272C
          Length = 664

 Score =  514 bits (1324), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 271/549 (49%), Positives = 367/549 (66%), Gaps = 32/549 (5%)

Query: 1   MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS 60
           M + +EE+ RIS QV+SLSTQL+ESI ++S+LEEKL    +   SQ+ S+ +  +L+   
Sbjct: 1   MDDLAEENNRISAQVTSLSTQLMESIQRESELEEKLKHLKKVALSQEGSIAKYDILKADY 60

Query: 61  IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA 120
            +L+ +++ R  E+  L+  L  E KLR SAE EV  LS+EVEDLTA+LF EAN+MVADA
Sbjct: 61  DKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADA 120

Query: 121 RKEAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETEN--NRYSMILPDSAT 178
           R+E H  EILN++L+ QLREKD                    E EN  N+ S I PD   
Sbjct: 121 RREKHITEILNTKLVEQLREKDTLLQTLDLQLKNLKKVLQNFEDENVTNKASSIAPDFL- 179

Query: 179 ISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSIKD 238
               S  K  + + S+    P N G+ YSP IS+IRYDL+LY EFLKFIAV+P+CK++KD
Sbjct: 180 ---GSEQKSASASLSNEVGDPSNKGV-YSPYISTIRYDLALYNEFLKFIAVLPYCKNLKD 235

Query: 239 TSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQMG 298
           TSS+SKL+RRLI DEI P+L+ID+ANG+GWL KK++L+ M++GLV++EPLSG+NE YQ+G
Sbjct: 236 TSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNENYQLG 295

Query: 299 HTTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYLLKT 358
           H +     N +   +++R+   +F +      VAV +PC+FCGE R+DI+EHARM++LKT
Sbjct: 296 HVSSSDQSN-RPSMESKRE-SHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARMHVLKT 353

Query: 359 QTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGSSK 418
           Q+  +DG++ + N+YPLC WCL K+RQTCEIFAFLRSLK   WNLEKV L++I+K  S+K
Sbjct: 354 QSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAKGESNK 413

Query: 419 FSEVT---TTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXXX 475
           F+EVT    +N +G         KS+ KK KR SFM GLG   SS +T            
Sbjct: 414 FTEVTRAIKSNKHG---------KSDEKKLKRKSFMVGLGINASSNLTP---------QV 455

Query: 476 XXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQDEEF 535
                      QPTTNIQRAW+QLCKLRS+LHW ++GIWSVD+S+S K+GP+V   + E 
Sbjct: 456 EVGASTIGNAGQPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNEI 515

Query: 536 --TTIDMTA 542
             TT+D+ +
Sbjct: 516 TGTTVDVAS 524

>SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 734

 Score =  508 bits (1309), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 258/529 (48%), Positives = 350/529 (66%), Gaps = 28/529 (5%)

Query: 6   EESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIELEQ 65
           EESKR+S+Q+SSLSTQLIES+ KQS LEE+L +A +TI SQ +S      L ++  + +Q
Sbjct: 5   EESKRVSMQLSSLSTQLIESVDKQSRLEEQLRKAKKTIASQSESAASYESLREQLEKAQQ 64

Query: 66  SLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARKEAH 125
            L +R+ E  +L  +L  E   R+ A+ ++++L+KEVEDLTA+LFDEANNMVADAR+E H
Sbjct: 65  ELASRSRESAELERKLAAETTARKMAQDKIDQLNKEVEDLTASLFDEANNMVADARREKH 124

Query: 126 AKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETENN------RYSMILP-DSAT 178
             E+ NS+L  QL EKD                    E EN+      R S  L  D+AT
Sbjct: 125 DVEVRNSKLHEQLHEKDALLETLEMQLKNLKKVLYSLEDENSSLAKTKRNSAFLSSDTAT 184

Query: 179 ISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSIKD 238
            S  SL+K  T   +S  +     G+++SP + S+RYDL LY EFLKF+A++P C+SIK 
Sbjct: 185 SSNVSLEKTAT-GGTSLGELSGAGGVLFSPVLQSLRYDLGLYNEFLKFVAMLPICRSIKG 243

Query: 239 TSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQMG 298
           T+++SKL+RRL+ DEI PVL++DNA+GLGWLV+++L+S M++GLV+VEPLSG+NE Y+MG
Sbjct: 244 TTTESKLLRRLMHDEIQPVLRLDNASGLGWLVRRSLMSLMIDGLVVVEPLSGVNETYRMG 303

Query: 299 HTTPPLGMNTQEEAD-AQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYLLK 357
           +++P L  + Q+ A   Q +   ++ +      VA+ + CAFC E RNDI+EH R+Y+LK
Sbjct: 304 YSSPQL--HAQQNAHFGQERAAHLYNYPTDSPPVAIHEACAFCSESRNDILEHGRLYVLK 361

Query: 358 TQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGSS 417
           T    +DGT    N YPLCH+CL K+RQTCEIFAFLRSLK  +W+LEKV L++I+  GSS
Sbjct: 362 TLQRNEDGTTETTNQYPLCHYCLLKVRQTCEIFAFLRSLKEGVWHLEKVTLTSIATGGSS 421

Query: 418 KFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXXXXX 477
           KFSEVT T    + K        E+ KSKRMSFMAGL R  ++K+               
Sbjct: 422 KFSEVTKTPHTSAAK--------EDAKSKRMSFMAGLSRPSTTKLMPT---------VEG 464

Query: 478 XXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGP 526
                    QP TNIQRAW QLCKLR+ LHWAHIG+WS++DSV+ ++GP
Sbjct: 465 APNFAGQSGQPVTNIQRAWAQLCKLRASLHWAHIGVWSIEDSVALRIGP 513

>TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1.81
           YNL272C
          Length = 700

 Score =  507 bits (1305), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 273/538 (50%), Positives = 363/538 (67%), Gaps = 34/538 (6%)

Query: 1   MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS 60
           M E+ EES+R+S+Q+SSLSTQLIESI KQ  LEE+LNQA RTI SQ+ SL+  + L+ K 
Sbjct: 1   MGESVEESRRVSVQISSLSTQLIESIDKQFQLEEQLNQAKRTIQSQRNSLDSYNDLKSKF 60

Query: 61  IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA 120
             +E SL  + + + +L+E L +E  LR +AE  V+ L+KE+EDLTA+LFDEAN MVA A
Sbjct: 61  DGVESSLQTKNQIIEELKEELVKEKTLRTTAERNVDDLNKEIEDLTASLFDEANKMVATA 120

Query: 121 RKEAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETEN-----NRYSMILPD 175
           RKE++  EI N++L  QL EKD                    E E+     +R S +  D
Sbjct: 121 RKESYTIEIKNNKLKEQLDEKDMILETLNLQLKNLKKVIQNLEKESTTHSGSRSSFVGND 180

Query: 176 SATISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKS 235
           ++T S  SL+K +T  S   S  P     IYSPNI+S+RYDL+LY EFLKFIAV+P+C++
Sbjct: 181 NST-SSISLNKTSTSNSDELSLGP-----IYSPNITSVRYDLNLYTEFLKFIAVLPYCET 234

Query: 236 IKDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMY 295
           +KDTSSDSKL+RRL+ DEI P L++DNA+GLGW+V++TL+S MMEGLV+VEPLSG+NE +
Sbjct: 235 LKDTSSDSKLLRRLVNDEIQPALRLDNASGLGWIVRRTLMSLMMEGLVVVEPLSGLNENF 294

Query: 296 QMGHTTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYL 355
           Q G+T+P L  ++   +    K   +F +      +AV D C+FC E R+D+IEHARMY+
Sbjct: 295 QYGYTSPVLPSSSFNPS-MGGKDSHLFSYPSDSPPIAVHDKCSFCSEARDDVIEHARMYV 353

Query: 356 LKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYG 415
           LKTQT  +DG+L++ N++PLC +CL K+RQTCEIFAFLRSLK   WNLEKV L+ I+K  
Sbjct: 354 LKTQTRIEDGSLVVTNSFPLCRYCLLKVRQTCEIFAFLRSLKLGAWNLEKVTLTKIAKGE 413

Query: 416 SSKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXXX 475
           SS+FS+V+  N  G        P+ E K+ +RMS +   G+  SSK+ A +V        
Sbjct: 414 SSEFSQVSNGNHKG--------PQKEEKRLQRMSLIT--GKNQSSKL-APQVDIPVDQIG 462

Query: 476 XXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVFTQDE 533
                       PTTNIQRAWLQLCKLR  LHWAHIGIWSV+D+V+ K+GP V  +DE
Sbjct: 463 A-----------PTTNIQRAWLQLCKLRITLHWAHIGIWSVEDAVTQKIGPFVKEEDE 509

>CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} similar
           to uniprot|P17065 Saccharomyces cerevisiae YNL272c SEC2
           protein transport protein
          Length = 752

 Score =  492 bits (1266), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 265/533 (49%), Positives = 349/533 (65%), Gaps = 34/533 (6%)

Query: 1   MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS 60
           M +  EES RIS+QVS+LSTQLIESI +QS+LE++L  A   I  QK  + +   L++K+
Sbjct: 1   MSDPIEESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIINKQKHVMHEFETLKQKN 60

Query: 61  IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA 120
            EL     +  E++  L  +L  E   R +AE EV+KL +EVEDLTA+LFDEANNMV+DA
Sbjct: 61  KELSDGQQSFEEKIRALSAQLEEEKSKRLAAEKEVDKLGQEVEDLTASLFDEANNMVSDA 120

Query: 121 RKEAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETEN----NRYSMILPDS 176
           R+E H  EI NSRL   L+EKD                    ++E+    N  S I  ++
Sbjct: 121 RREKHDIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQTVDSESSINANIRSPISTEN 180

Query: 177 ATISGASLDKVTTRTSS-SFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKS 235
           +T + AS +K+T R S  S S    N   ++SP ++++RYD SLY EFLKF+AV+P   S
Sbjct: 181 STTTSASGNKLTRRQSQLSISH---NESPLFSPYVTTLRYDQSLYNEFLKFLAVLPSSSS 237

Query: 236 IKDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMY 295
           +K TS++SKL++RL++DEI PVLKIDNA+G+GWLV+K+LL++MMEG V+VEPLSGINE Y
Sbjct: 238 LKATSTESKLLKRLVSDEIQPVLKIDNASGIGWLVRKSLLTSMMEGQVVVEPLSGINEAY 297

Query: 296 QMGHTTPP-LGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMY 354
           Q+G+ T   +  N  EE      +P MF F      +AVRDPCAFC E+R+DIIEHARMY
Sbjct: 298 QLGYETKEHVSQNEGEE------MPHMFNFPLNSPPIAVRDPCAFCAEQRDDIIEHARMY 351

Query: 355 LLKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKY 414
           ++KT   ++DG+  I N++PLCHWCL K+RQTCEIFAFLRSLK   W+LEKV L+ ISK 
Sbjct: 352 VMKTFNKENDGSTTITNSFPLCHWCLMKVRQTCEIFAFLRSLKLGTWHLEKVTLNTISKG 411

Query: 415 GS-SKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXX 473
            S SKFSEVT + TNGS  N       E KKS R SF+  L +    K +          
Sbjct: 412 ESLSKFSEVTKS-TNGSTSN-------EEKKSNRKSFIPSLPKGSPKKSSPV-------- 455

Query: 474 XXXXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGP 526
                        QPT+NIQRAW+ LCKLRS+LHWAH+GIW+++DS+S K+GP
Sbjct: 456 --VETHIDTTKAGQPTSNIQRAWVHLCKLRSMLHWAHVGIWNMEDSISLKMGP 506

>Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}
           similar to Ashbya gossypii AFR670W
          Length = 705

 Score =  478 bits (1231), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 250/531 (47%), Positives = 334/531 (62%), Gaps = 23/531 (4%)

Query: 1   MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS 60
           M E  EESKRISIQVSSLSTQLIESI KQS LEE LNQA + +++QK S+ Q   L+++ 
Sbjct: 10  MTEQQEESKRISIQVSSLSTQLIESIDKQSRLEEHLNQAKKALSAQKDSISQFDSLKQQL 69

Query: 61  IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA 120
            + ++ L    EE+   R  L    ++R +AE   EKL+KE+EDLT +LFDEAN+MVA+A
Sbjct: 70  SDTKKQLAYTEEELAVKRRELVEAQEVRVAAERAAEKLNKEIEDLTTSLFDEANSMVANA 129

Query: 121 RKEAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETENN-----RYSMILPD 175
           RKE H  E+LNS+L  QLREKD                    E E+N     R S+I+ +
Sbjct: 130 RKEKHDVEVLNSKLQEQLREKDMLLDTLSIQLRNLKEVLYKVEDEHNTLNSYRQSIIM-E 188

Query: 176 SATISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKS 235
            +  S ASLDK              +  +++SP   S+RYD+ LY E+L+F+AV+P CK 
Sbjct: 189 GSNGSNASLDKEALGNPGLIYDHHHHMNLLFSPLAQSLRYDIPLYTEYLRFLAVLPMCKG 248

Query: 236 IKDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMY 295
           IKDT  DSK +RRL+ DEI PVL++D A+GLGWLV++ L++ M++GLV+VEPLSGINE Y
Sbjct: 249 IKDTRHDSKFLRRLVLDEIQPVLRLDAASGLGWLVRRNLMNLMIDGLVVVEPLSGINETY 308

Query: 296 QMGHTTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYL 355
           ++G+ +P    +   E D      KMF +      VA++DPCAFC E RNDI+EH R+Y+
Sbjct: 309 RIGYASPQSNSHKVTEVDN----AKMFNYPSNSPPVAIQDPCAFCSESRNDILEHGRLYV 364

Query: 356 LKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYG 415
           LKT    +DG+      YPLCH+CL K+RQTCEIFAFLRSLK+  WNLE V LS  ++ G
Sbjct: 365 LKTLQKNEDGSTTSETQYPLCHYCLLKVRQTCEIFAFLRSLKSGAWNLENVTLSC-ARPG 423

Query: 416 SSKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXXX 475
           S +F++V   +T  S  N  A   S    SKR+SFM+GL RT SS     R+        
Sbjct: 424 SDEFTKVDRNSTTNSASNKEANSTS----SKRLSFMSGLSRTSSSTRMTPRIETVTDFSE 479

Query: 476 XXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGP 526
                       P+TN+QR+W+ LCKLR+ LHW HIG+W+++DS+  KV P
Sbjct: 480 RKGL--------PSTNVQRSWVHLCKLRASLHWCHIGVWTLEDSIQLKVAP 522

>ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weakly
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 779

 Score =  478 bits (1229), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 249/563 (44%), Positives = 354/563 (62%), Gaps = 55/563 (9%)

Query: 2   PETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSI 61
           P   EES+R+S Q+ SLSTQLIESI +QS LE++LNQAN+ I     ++++   L+K   
Sbjct: 4   PSEVEESRRVSTQIMSLSTQLIESIERQSTLEKELNQANKIIEGHGGAMQEYEKLKKNFA 63

Query: 62  ELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADAR 121
           ELE+  + +  ++NKLRE L ++ + R  A+   +KL+ EVE+LTA+LFDEANNMVADAR
Sbjct: 64  ELEKRESNKDAQLNKLREELRKQKEARTEADSNADKLNHEVEELTASLFDEANNMVADAR 123

Query: 122 KEAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETENNRYSMILPDSATISG 181
           K +HA E+ N++L+ QL E+D                    + +    SM      T++ 
Sbjct: 124 KASHATELRNAKLVEQLHERDALLETLNLQLRHLKKVIQTLDDD----SMASEQVKTLAN 179

Query: 182 ASLD-----KVTTRTSSSFSQQ---PMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHC 233
           AS +      ++   SSS  +Q   P+  G I+SPNI+++RYDL LY EFLKF+AV+P  
Sbjct: 180 ASDNANLAASLSKNLSSSHGRQIEAPL--GPIFSPNITAVRYDLGLYHEFLKFLAVLPDY 237

Query: 234 KSIKDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINE 293
           + IKDT+SDSKL+RRL+ DEI PVLK++NA+GLGW++K+TL++ M+EGLV VEP+SG+NE
Sbjct: 238 QDIKDTASDSKLLRRLVNDEIQPVLKLENASGLGWILKRTLVNLMIEGLVAVEPISGLNE 297

Query: 294 MYQMGHTTPPLGMNTQ---------------------------EEADAQRKVPKMFKFXX 326
           M+Q G+ +P L  +++                             + +  K   +F +  
Sbjct: 298 MHQYGYASPMLNQHSKMGGNNSNSLENSPATTSNTSTTTKRNHSRSSSMTKSLNLFNYPS 357

Query: 327 XXXXVAVRDPCAFCGEERNDIIEHARMYLLKTQTTQDDGTLIIANTYPLCHWCLFKIRQT 386
               VA+R+ CA CGE R+D++EHAR+++LKTQ+  DDGT+ + NT+PLC +C+ KIRQT
Sbjct: 358 DSPPVALREKCAICGECRDDLVEHARLHILKTQSRADDGTVTVNNTFPLCKYCVLKIRQT 417

Query: 387 CEIFAFLRSLKTDIWNLEKVPLSAISKYGSSKFSEVTTTNTNGSKKNIAATPKSENKKSK 446
           CEIFAFLRSLK   W LEKV L+++SK  S +FS+V+  N+N  K N  +  K EN+K+ 
Sbjct: 418 CEIFAFLRSLKLGAWKLEKVSLTSVSKGDSKEFSQVSMVNSNEDKPNRDS--KKENRKTA 475

Query: 447 RMSFMAGLGRTHSSKITAARVXXXXXXXXXXXXXXXXXXXQPTTNIQRAWLQLCKLRSIL 506
           R SFMAG+   +S   T                        PTTNIQ AW+QLC+LRS+L
Sbjct: 476 RKSFMAGMNALNSKNTTVT------------PEVPVSQAGAPTTNIQWAWIQLCRLRSML 523

Query: 507 HWAHIGIWSVDDSVSTKVGPEVF 529
           HW HIGIW+VDD +++K+GP V 
Sbjct: 524 HWTHIGIWNVDDCITSKIGPLVI 546

>Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON}
           (144161..146635) [2475 nt, 825 aa]
          Length = 824

 Score =  478 bits (1230), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 258/534 (48%), Positives = 349/534 (65%), Gaps = 18/534 (3%)

Query: 1   MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS 60
           M ++S+ESKR SIQ+++LSTQL+ESI KQ+ LE+KL ++ RTI  Q+ ++EQ + L+ K 
Sbjct: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY 60

Query: 61  IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA 120
            +L+++      ++ KL      E KLR SAE +V++L+KEVE+LTA+LFDEANNMVADA
Sbjct: 61  DQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADA 120

Query: 121 RKEAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETE------NNRYSMILP 174
           R+ A   +I N +L+  L EKD                    + +      +NR S+I  
Sbjct: 121 RRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNSLIST 180

Query: 175 DSATISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCK 234
            SA+ S  SL K  T TS+S +   + +  IY+P + ++RYDL LY EFLKFIAV+P C+
Sbjct: 181 TSASSSSVSLKK--TITSNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCE 238

Query: 235 SIKDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEM 294
           SIK T+S+SKL+RRLI DEI PVL++DNA+GLGW+VK+TL++ M+EGLV++EPLSG+NE 
Sbjct: 239 SIKHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNEN 298

Query: 295 YQMGHTTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMY 354
           Y+   + P   +N+  +     K   +FK+      +AV +PCAFCGE RND++EHARMY
Sbjct: 299 YRFSSSAPVSNVNSNNDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMY 358

Query: 355 LLKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKY 414
           +LKTQT  +D TL I N +PLC  CL K+RQTCEIFAFLRSLK   WNLEKV LS I+K 
Sbjct: 359 MLKTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKG 418

Query: 415 GSSKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXX 474
            S KFS VT   ++ SK  I    K ++K  KR S MAG G +  S  T  +        
Sbjct: 419 DSKKFSSVTAATSSISKSKIEE--KFDSKLMKRRSIMAGFGISSISNTTTTK-------- 468

Query: 475 XXXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEV 528
                        PTTNIQRAW+ L KLRS+LHWAHIGIW+ D++V+TK+ PE+
Sbjct: 469 SETSVGVVDQSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPEL 522

>TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1.81
           YNL272C
          Length = 733

 Score =  464 bits (1194), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 255/541 (47%), Positives = 343/541 (63%), Gaps = 37/541 (6%)

Query: 1   MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS 60
           M   S+E KR+S+Q++SLSTQL+ESI KQS LE+KL Q+ + I  QK ++ Q + L  K 
Sbjct: 1   MSGNSDEDKRVSVQLTSLSTQLLESIEKQSSLEDKLRQSRKIIEEQKTTITQYNELRIKY 60

Query: 61  IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA 120
            +L+++ + +  ++ +L ++L  E   +  AE +V++L+KEVE+LTA+LFDEANNMVADA
Sbjct: 61  DQLDKNFSKKKVDLQRLEQQLQAEKLGKAEAERKVDELNKEVEELTASLFDEANNMVADA 120

Query: 121 RKEAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETENNRYSMILPDSATIS 180
           RKE  + E  N +L  QL EKD                    +TE+   SM + ++  IS
Sbjct: 121 RKETDSIETKNKKLTEQLLEKDTILETLNLQLKNLKTVLQDLQTES---SMSIINNGNIS 177

Query: 181 ---------------GASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLK 225
                            SL K++T TS   SQQ + N  I++P I++IRYD  LY EFLK
Sbjct: 178 LKGDVPLSNENGGSSSHSLKKMSTTTSFQ-SQQEVVNYAIFTPKITNIRYDTFLYNEFLK 236

Query: 226 FIAVIPHCKSIKDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIV 285
           F+AV+PHC SIK+TS++SKL+RRLI+DEI PVL++D +NGLGWL K+TL++ ++EGLV++
Sbjct: 237 FVAVLPHCNSIKNTSAESKLLRRLISDEIHPVLRLDTSNGLGWLTKRTLMNQIVEGLVVI 296

Query: 286 EPLSGINEMYQMGHTTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERN 345
           EPLSGINE Y+           +  ++D   K  KMF F      +AVRDPCAFC E R+
Sbjct: 297 EPLSGINETYRQSALYEVSISKSSIKSDQITKA-KMFNFPADSPPIAVRDPCAFCDESRS 355

Query: 346 DIIEHARMYLLKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEK 405
           D I HARMY+LKTQT  DD TL I N YPLC  CL K+RQTC+IFAFLRSLK+ +W LEK
Sbjct: 356 DCIGHARMYMLKTQTRNDDDTLSITNQYPLCQACLIKVRQTCDIFAFLRSLKSGVWQLEK 415

Query: 406 VPLSAISKYGSSKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAA 465
           V LS ISK  +S F +V     N  K+N  AT  ++ KK KR S ++ LG++HSS + A 
Sbjct: 416 VTLSTISKGDTSSFLKVA---ENQFKQNEKAT--AQEKKQKRKSIISSLGKSHSSYVNA- 469

Query: 466 RVXXXXXXXXXXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVG 525
                                 P+TNIQRAWLQLCKLRSILHW+HIGI + +D V++   
Sbjct: 470 -----------KLDCTVEPVGLPSTNIQRAWLQLCKLRSILHWSHIGISNTEDCVTSTFA 518

Query: 526 P 526
           P
Sbjct: 519 P 519

>AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL272C (SEC2)
          Length = 717

 Score =  457 bits (1177), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 239/525 (45%), Positives = 328/525 (62%), Gaps = 23/525 (4%)

Query: 6   EESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIELEQ 65
           EE++RIS+QVSSLSTQLIESI KQS LEE+L  A + + +QK  ++Q      ++ +L  
Sbjct: 14  EENRRISVQVSSLSTQLIESIDKQSRLEEQLQHAKKALAAQKDVVKQCESARGEAQQLRS 73

Query: 66  SLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARKEAH 125
            L  R  E+ +  E L    K R +AE+ VE+L+KE+EDLT +LFDEAN MV+ ARKE H
Sbjct: 74  QLADRDTELERQGEELEEARKARLAAELAVERLNKEIEDLTTSLFDEANRMVSKARKEKH 133

Query: 126 AKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETENN----RYSMILPDSATISG 181
             E  N+RL  QLREKD                    E E N    R S++  DS   S 
Sbjct: 134 VVEQHNARLQEQLREKDMLLDTLTIQLKNLKDVLYKVEDEQNTRSRRQSVM--DSVNPSH 191

Query: 182 ASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSIKDTSS 241
            SLD      +S+F    +++G++++P + S+RYD+ +Y E+L+F+AV+P CKSI+DT  
Sbjct: 192 TSLD--VDGYASAFDNM-LSSGLLFTPAVQSLRYDIPMYTEYLRFLAVLPMCKSIRDTRH 248

Query: 242 DSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQMGHTT 301
           DSK +RRL++DEI PVL++D+A GLGWLV++ L++ M+EGLV+VEPLSGINE Y+MG+ +
Sbjct: 249 DSKFLRRLVSDEIQPVLRLDSATGLGWLVRRNLMNLMIEGLVVVEPLSGINETYRMGYAS 308

Query: 302 PPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYLLKTQTT 361
           P    +++    A     KMF +      VA+  PCAFC E RNDI+EH R+Y+LKT   
Sbjct: 309 PQTHSHSKSSEPA---AVKMFTYPVNSPPVAIEAPCAFCSEARNDILEHGRLYVLKTLQK 365

Query: 362 QDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGSSKFSE 421
            + G L+  N YPLCH+CL K+RQTCEIFAFLRSLKT  WNLE V LS  +K  S  F++
Sbjct: 366 TETGELLTENQYPLCHFCLLKVRQTCEIFAFLRSLKTGSWNLENVTLSC-AKQESDAFTQ 424

Query: 422 VTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXXXXXXXXX 481
           +   N+  +   I     S    SKR+SFM+ L R  ++  T  R+              
Sbjct: 425 I--PNSVQASPVIHRDENSITSSSKRLSFMSSLSRVSTTSKTTPRIEAVTDFNEKKGL-- 480

Query: 482 XXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGP 526
                 P TN+QR+W+ LCKLR+ LHW+HIG+W++DD+V TKV P
Sbjct: 481 ------PPTNVQRSWVHLCKLRASLHWSHIGVWTLDDAVQTKVVP 519

>Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {ON}
           YNL272C (SEC2) - GDP/GTP exchange factor for Sec4p
           [contig 118] FULL
          Length = 694

 Score =  454 bits (1169), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 241/533 (45%), Positives = 335/533 (62%), Gaps = 25/533 (4%)

Query: 6   EESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIELEQ 65
           EESKR+S+QVSSLSTQLIESI KQS LEE+L QA + I+SQ+ +L+    + K+  E E 
Sbjct: 5   EESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLEETEA 64

Query: 66  SLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARKEAH 125
            L +   +  K +E L       E+A+ EV +L+KEVE+LTA+LFDEANNMVADARKE H
Sbjct: 65  ELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADARKETH 124

Query: 126 AKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETENNRY-------SMILPDSAT 178
           + ++ N +L  QL+EK                     E E+N          M   D++T
Sbjct: 125 SIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSDNST 184

Query: 179 ISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSIKD 238
           +S A   + T    +  ++ P  N +++SP + S+RYDL+LY EFLKFIA +P   SIKD
Sbjct: 185 VSSAIALENTMHALNGTARSP--NNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASIKD 242

Query: 239 TSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQMG 298
           T+S+SKL+RRL+ DEI P+L++DNA+GLGW  K++L++ MM+GLV+VEP+SGINE Y++ 
Sbjct: 243 TASESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYRVS 302

Query: 299 HTTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYLLKT 358
           H +       Q     QR    ++ +      VA++DPC+FC E RNDI+EH R+Y+L+T
Sbjct: 303 HASGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVLRT 362

Query: 359 QTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGSSK 418
               ++GT  + + +PLCH+CL K+RQTCEIFAFLRSLK+  W+LE V + A S+  S++
Sbjct: 363 LQKTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSSTE 422

Query: 419 FSEVTTTNT--NGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXXXX 476
           F   +  +T   GS++ + +     ++KSKR+S MAGL ++  SK + A           
Sbjct: 423 FKSQSKLSTPERGSERKVKS-----DRKSKRLSIMAGLTKSFPSKTSYA---------IE 468

Query: 477 XXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEVF 529
                      PTTNIQ AW QLCKLRS LHW HIGIWS+ DSV TK+GP  F
Sbjct: 469 ETPGSNSQVTTPTTNIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTF 521

>KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}
           Anc_1.81 YNL272C
          Length = 654

 Score =  452 bits (1164), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 243/533 (45%), Positives = 329/533 (61%), Gaps = 32/533 (6%)

Query: 3   ETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIE 62
           +T++ESKRIS+Q++S+STQL+ESI  QS LEEKLN+AN+   + K+       L+ +  +
Sbjct: 14  DTADESKRISLQITSMSTQLMESIQNQSLLEEKLNRANKAAAALKEQTVHYDELKGRVAK 73

Query: 63  LEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARK 122
           LE SLT R EE+  L+  L  E   R +++  VE+L  EVEDLTA+LF EANNMVADARK
Sbjct: 74  LEASLTNRDEEMAALKSALAEEKSKRAASDKSVEELQSEVEDLTASLFSEANNMVADARK 133

Query: 123 EAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXE----TENNRYSMILPDSAT 178
           E H  EILN +L+  + EKD                    +    +   R SM   D+ T
Sbjct: 134 EKHTTEILNRKLLEAVNEKDNALETMKIQLKHLRKMLEKVDVGSPSATGRSSMTSADTDT 193

Query: 179 ISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSIKD 238
               SL  + TR SS+ SQ      ++YSP++ S+RYDLSLY EFLKF+  +P C  I+D
Sbjct: 194 ---NSLKGIVTR-SSNQSQSDTAPLVVYSPSVGSVRYDLSLYSEFLKFLVSLPRCTQIRD 249

Query: 239 TSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQMG 298
           T S+SKL+RRLI DEI+P+L+ID+A G+GW+ KK+L++ M+EG+VI+EP SG+NE YQ G
Sbjct: 250 TESESKLVRRLINDEIAPILRIDSAPGIGWMAKKSLMNVMLEGMVIIEPNSGVNENYQHG 309

Query: 299 HTTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYLLKT 358
           H++P +  ++       +  P +F +      +A  + CA CGE R+DI EH R++ +K 
Sbjct: 310 HSSPSISQHS-----LGKSQPHLFSYPADSPPIASFESCALCGESRSDIYEHERLHKMKI 364

Query: 359 QTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKV-----PLSAISK 413
           Q  +DDGTL + N YPLC WCL ++RQTCEIF+FLRSLKT +W LE +     P SA SK
Sbjct: 365 QQKRDDGTLEVVNLYPLCLWCLLRVRQTCEIFSFLRSLKTGVWGLETIKTRGSPTSAKSK 424

Query: 414 YGSSKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXX 473
               KF      + N +      T  S N ++KRMS+MAGLG    +  ++A        
Sbjct: 425 ----KF------DLNNAPIRRNKTKNSAN-RTKRMSWMAGLGLNTPTSSSSA---PNDVS 470

Query: 474 XXXXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGP 526
                         P TNI+RAWLQLCKLRSILHWAHIGIWSV D++  K+GP
Sbjct: 471 LMEPSTTFTDKNGLPNTNIKRAWLQLCKLRSILHWAHIGIWSVSDALDLKIGP 523

>KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 733

 Score =  450 bits (1158), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 241/532 (45%), Positives = 337/532 (63%), Gaps = 27/532 (5%)

Query: 6   EESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIELEQ 65
           EESKR+S+QVSSLSTQLIESI KQS LEE+L QA + I SQ++SL+    L ++  + E 
Sbjct: 5   EESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLEQAES 64

Query: 66  SLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARKEAH 125
           +L +   +  K++E L      + +AE E+++L+KEVEDLTA+LFDEANNMVADAR+E H
Sbjct: 65  NLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADARRETH 124

Query: 126 AKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETENNRYSMILPDSATISGASLD 185
           + ++ NS+L  QL+EK+                    E E+N    +  + A++  A+ D
Sbjct: 125 SVQVKNSKLAEQLQEKETLLETLEIQLKNLKKVLYNLEEESN--DRLKSNQASV--AAED 180

Query: 186 KVTTRTSSSFSQQPMN--NGI-------IYSPNISSIRYDLSLYEEFLKFIAVIPHCKSI 236
            V + + S+  ++ MN  NG        ++SP + S+RYDL LY EFLKFIA +P C SI
Sbjct: 181 SVASSSESAL-EKTMNALNGTASPPSPALFSPLLKSLRYDLVLYNEFLKFIAALPQCASI 239

Query: 237 KDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQ 296
           +D++S SKL+RRLI DEI PVL++DNA+G+GW +++ L+S M++G ++VEP+SGINE Y+
Sbjct: 240 RDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYR 299

Query: 297 MGHTTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYLL 356
           +GH +  +    Q +   Q+  P ++ +      VA+  PC+FC E RNDI+EH R+Y+L
Sbjct: 300 VGHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVL 359

Query: 357 KTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGS 416
           KT    ++G    ++ +PLCH+CL K+RQTCEIFAFLRSLK+  W+LE V    ISK  +
Sbjct: 360 KTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAV---TISKTNN 416

Query: 417 SKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXXXX 476
           + FS  T + +N             ++KSKRMSFMAGL +T   K +             
Sbjct: 417 A-FSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLPLKTS---------YTVE 466

Query: 477 XXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEV 528
                      PTTNIQRAW QLCKLRS LHWAHIGIW+++D V TKVGP V
Sbjct: 467 SASPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVV 518

>TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa]
           {ON} Anc_1.81 YNL272C
          Length = 795

 Score =  437 bits (1124), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 241/550 (43%), Positives = 332/550 (60%), Gaps = 42/550 (7%)

Query: 3   ETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIE 62
           E ++ES+R++ QV+ LSTQL+ESI KQS LE+KLNQAN+ + +QK ++E++  ++     
Sbjct: 5   EIADESQRVTDQVTLLSTQLMESISKQSQLEDKLNQANKKLAAQKLTIEKNSQIKATGSA 64

Query: 63  LEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARK 122
           L+++      ++      L +E +LRE AE E   L+KEVEDLTA+LFDEAN+MVADARK
Sbjct: 65  LQKNANDLESQLKIANAELVKERQLREKAEGECTALNKEVEDLTASLFDEANHMVADARK 124

Query: 123 EAHAKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETE--NNRYSMILPDSATIS 180
           E  A E+ N++LM QL+EKD                    + E  NN+ + +L +    S
Sbjct: 125 EKAAVELRNTKLMEQLKEKDTVLETLELQLKNLKKVLQEFQDEDSNNKRNSMLSEVTIHS 184

Query: 181 GASLDK-----VTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKS 235
           G+S        ++T  S SF+       IIYSPNIS IRYDL LY EFLKF+AV+P  K+
Sbjct: 185 GSSQRAGSPTIISTTNSESFA------NIIYSPNISDIRYDLPLYGEFLKFVAVLPFVKN 238

Query: 236 IKDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMY 295
           IK T++DSKL+RRL+ DEI PVL++DNA+GLGW+VK+TLL+ MMEGLV+VEPLSG+NE+Y
Sbjct: 239 IKQTTNDSKLLRRLVNDEIQPVLRLDNADGLGWVVKRTLLTQMMEGLVMVEPLSGVNELY 298

Query: 296 -------------QMGHTTPPLGMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGE 342
                          G T    G +T     + +K   +F F      VAV +PCAFC E
Sbjct: 299 THSRNRRSATSNNTTGSTRDISGKDTN--GSSNQKNSHLFNFPTNSPPVAVHEPCAFCNE 356

Query: 343 ERNDIIEHARMYLLKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWN 402
           +R+D ++HAR++LLKTQ+  + G + + N +PLC  C+ K+RQT EIFAFLRSL    W 
Sbjct: 357 KRDDSVQHARIHLLKTQSRSETGKITVTNQFPLCQSCVLKVRQTGEIFAFLRSLALGTWK 416

Query: 403 LEKVPLSAISKYGSSKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKI 462
           LEK+ ++ +SK   +K          GS  +     + E KK+KR SF+ GL    ++ +
Sbjct: 417 LEKIAIANLSKSDPTKIK--------GSPASPTKDKEKEKKKAKRKSFIKGLNMAQTASV 468

Query: 463 TAARVX------XXXXXXXXXXXXXXXXXXQPTTNIQRAWLQLCKLRSILHWAHIGIWSV 516
                                         QPTTNIQRAWLQLCKLR +LHW+H+GIWS+
Sbjct: 469 LNPATSNPFFQQTQTNPVGDTSLTDVDTFGQPTTNIQRAWLQLCKLRCMLHWSHMGIWSL 528

Query: 517 DDSVSTKVGP 526
           DDS+  K  P
Sbjct: 529 DDSIEAKFAP 538

>KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 658

 Score =  415 bits (1067), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 229/522 (43%), Positives = 329/522 (63%), Gaps = 36/522 (6%)

Query: 6   EESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIELEQ 65
           EESKRIS+QV+SLSTQLIESI KQS LEE+L  A +TI++Q+        +     EL+Q
Sbjct: 5   EESKRISLQVTSLSTQLIESIDKQSQLEEQLLVAKKTISTQQN-------IANSYNELKQ 57

Query: 66  SLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADARKEAH 125
            L +   +    + +  ++ ++   AE +V  L++E+EDLTA+LFDEANNMVADARKE +
Sbjct: 58  ELQSLKLQYETDKTKFKKQEEICADAEKKVATLNQEIEDLTASLFDEANNMVADARKEQN 117

Query: 126 AKEILNSRLMGQLREKDXXXXXXXXXXXXXXXXXXXXETE-NNRYSMILPDSATISGASL 184
           A EILNS+L  QL+EKD                    E + N+  ++ L DSAT S  S+
Sbjct: 118 AVEILNSKLKEQLKEKDLLLDTLSMQLKNLKNVLYKFENDFNSSKNVSLSDSATSSTTSI 177

Query: 185 DKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCKSIKDTSSDSK 244
           D+ TT  +S         G+++SP + S+RYD+ LY E+LKF+AV+P C++++ T+S+SK
Sbjct: 178 DRSTTNLTSVNDNSLSFQGVLFSPLLHSLRYDVPLYTEYLKFLAVLPQCENLQQTTSESK 237

Query: 245 LIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEMYQMGHTTPPL 304
           L+RRLI  EISPVL++DNA+G+GWLVK+ L++ MMEGLV +EP+SGINE Y+ G+++P +
Sbjct: 238 LLRRLINYEISPVLRLDNASGVGWLVKRNLMNLMMEGLVSIEPISGINETYRTGYSSPSI 297

Query: 305 GMNTQEEADAQRKVPKMFKFXXXXXXVAVRDPCAFCGEERNDIIEHARMYLLKTQTTQDD 364
                +  + + K   +F        VA+ +PCAFCGE RNDI+EH R+Y+ KT    ++
Sbjct: 298 P----DSPEVENKDSHLFSRPVNSPPVAMVEPCAFCGENRNDILEHGRLYIFKTYQKLEN 353

Query: 365 GTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKYGSSKFSEVTT 424
           G   + N +P+CH+CL K+RQ CEIFAFLRSL++  W+LEKV L++I +   + +SEVT 
Sbjct: 354 GKNELTNQFPVCHYCLLKLRQVCEIFAFLRSLRSGAWHLEKVALASIHQGKVNAYSEVTK 413

Query: 425 TNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVXXXXXXXXXXXXXXXXX 484
                     A+ PK    KSKR+S   GL ++ SS                        
Sbjct: 414 ----------ASRPK---MKSKRLSIFQGLKQSQSS-----------TPIIENGPQFADK 449

Query: 485 XXQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGP 526
              PTTNIQR+W +L +LR+ L W+HIG+WS+D+SV+T + P
Sbjct: 450 NGLPTTNIQRSWARLSQLRASLQWSHIGVWSLDESVATDIAP 491

>Kwal_26.8128 s26 complement(657798..658103) [306 bp, 101 aa] {OFF}
           [contig 55] FULL
          Length = 101

 Score = 32.3 bits (72), Expect = 1.0,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 167 NRYSMILPDSATISGASLDKVTTRTSSSF-SQQPMNNGIIYSPNISSIRYDLSLYEEFLK 225
           N +  I P++  ++  S+  V+        S+   N+ I+YSP+I+++R +   +++   
Sbjct: 15  NNFHFIFPETFRVTAPSVHLVSISPRREIISKTKKNSRIVYSPSITNVRTERLSFDQLFF 74

Query: 226 FIAVIPHC 233
            +  I HC
Sbjct: 75  HLKNICHC 82

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa]
           {ON} similar to uniprot|P40450 Saccharomyces cerevisiae
           YIL159w BNR1
          Length = 1294

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 8   SKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIELEQSL 67
           ++R  +++ +L   + E     ++LE + +   RTI  Q K  E  HMLE+K+IE E S+
Sbjct: 435 TRRAMVEIKTLEKNITELNSHIAELENEAHMDKRTIIQQLKQAE--HMLEEKTIENESSI 492

Query: 68  TARTEEVNKLRER 80
               +   +LRE+
Sbjct: 493 RLINQLKGQLREK 505

>Smik_15.506 Chr15 (875291..880021) [4731 bp, 1576 aa] {ON} YOR326W
           (REAL)
          Length = 1576

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 50/86 (58%), Gaps = 3/86 (3%)

Query: 19  STQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIELEQSLTARTEEVNKLR 78
           +T +++S+ ++   + KL Q      S     E S+ LE K IEL Q+L ++ +E  ++ 
Sbjct: 906 NTVVVQSLVRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVKENKEMT 965

Query: 79  ERLTR-EIKLRESAEIE--VEKLSKE 101
           ER+   ++++ ESA+++  +E + KE
Sbjct: 966 ERIKELQVQVEESAKLQETLENMKKE 991

>Skud_15.493 Chr15 (865472..870196) [4725 bp, 1574 aa] {ON} YOR326W
           (REAL)
          Length = 1574

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 49/85 (57%), Gaps = 3/85 (3%)

Query: 20  TQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIELEQSLTARTEEVNKLRE 79
           T +++S+ ++ D + KL Q      S     E S+ LE K IEL Q+L  + +E  ++ E
Sbjct: 907 TVVVQSLIRRRDAQRKLKQLKADAKSVYHLKEVSYKLENKVIELTQNLAFKVKENKEMTE 966

Query: 80  RLT-REIKLRESAEIE--VEKLSKE 101
           R+   ++++ E+A+++  +E + KE
Sbjct: 967 RIKGLQVQVGENAKLQETLENMKKE 991

>YOR326W Chr15 (925721..930445) [4725 bp, 1574 aa] {ON}  MYO2One of
           two type V myosin motors (along with MYO4) involved in
           actin-based transport of cargos; required for the
           polarized delivery of secretory vesicles, the vacuole,
           late Golgi elements, peroxisomes, and the mitotic
           spindle
          Length = 1574

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 49/85 (57%), Gaps = 3/85 (3%)

Query: 20  TQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIELEQSLTARTEEVNKLRE 79
           T +++S+ ++   + KL Q      S     E S+ LE K IEL Q+L ++ +E  ++ E
Sbjct: 907 TVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVKENKEMTE 966

Query: 80  RLTR-EIKLRESAEIE--VEKLSKE 101
           R+   ++++ ESA+++  +E + KE
Sbjct: 967 RIKELQVQVEESAKLQETLENMKKE 991

>Kpol_1067.28 s1067 (63984..67145) [3162 bp, 1053 aa] {ON}
           (63984..67145) [3162 nt, 1054 aa]
          Length = 1053

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 63/118 (53%), Gaps = 20/118 (16%)

Query: 1   MPETSEESKRISIQVSSLST--QLIES-----IGKQSDLEEKLNQANRTITSQKKSLEQS 53
           M ++  +  R+ + + S S+  Q IES     I KQ  LE++LN+ +R   S  KSL + 
Sbjct: 1   MSDSEADLSRLGVNILSQSSLEQRIESDASSLINKQL-LEQELNRLDRANNSLDKSLTKK 59

Query: 54  HMLEKK-----SIELEQSLTARTEEVNK-----LRERLTREIKLRES-AEIEVEKLSK 100
            +LE+K      I ++Q L  + +E+NK     +R R  ++IK R S AEI +   S+
Sbjct: 60  RLLERKLANTSRISVKQRLREQIDEINKNELNSIR-RDIKDIKGRISDAEINISGTSR 116

>Suva_8.377 Chr8 (666400..671106) [4707 bp, 1568 aa] {ON} YOR326W
           (REAL)
          Length = 1568

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 49/85 (57%), Gaps = 3/85 (3%)

Query: 20  TQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKSIELEQSLTARTEEVNKLRE 79
           T +++S+ ++   + +L Q      S     E S+ LE K IEL Q+L ++ +E  ++ E
Sbjct: 909 TVVVQSLIRRRAAQGRLRQLKSDAKSVHHLKEVSYKLENKVIELTQNLASKVKENKEMTE 968

Query: 80  RLTR-EIKLRESAEIE--VEKLSKE 101
           R+   ++++ ESA+++  +E + KE
Sbjct: 969 RIKELQVQVEESAKLQETLENMKKE 993

>Smik_6.160 Chr6 complement(265680..266279) [600 bp, 199 aa] {ON}
           YGR078C (REAL)
          Length = 199

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (68%)

Query: 51  EQSHMLEKKSIELEQSLTARTEEVNKLRERLT 82
           E   +L+KK ++ EQSLT  TE+V  LRE +T
Sbjct: 136 EAIELLQKKLVDSEQSLTVSTEDVEFLRENIT 167

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.125    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,263,352
Number of extensions: 2614548
Number of successful extensions: 15159
Number of sequences better than 10.0: 559
Number of HSP's gapped: 15608
Number of HSP's successfully gapped: 800
Length of query: 701
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 584
Effective length of database: 40,065,477
Effective search space: 23398238568
Effective search space used: 23398238568
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)