Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F042201.82ON2022202289450.0
NCAS0A005901.82ON1946116031470.0
YNL271C (BNI1)1.82ON1953118927500.0
Smik_14.661.82ON1952128727420.0
Suva_14.711.82ON1948109627390.0
CAGL0J08206g1.82ON1898109725750.0
KAFR0D039501.82ON195796625460.0
TDEL0C061901.82ON1879120623890.0
Skud_14.691.82ON194683623870.0
ZYRO0F16676g1.82ON199491621020.0
KNAG0F004701.82ON202884020970.0
Kpol_2000.661.82ON193083620260.0
TPHA0B044901.82ON194061219220.0
TBLA0A054401.82ON217085519180.0
Kwal_33.133921.82ON196858318370.0
SAKL0C02618g1.82ON198862517880.0
AFR669W1.82ON191859117520.0
KLTH0F02376g1.82ON197662117370.0
Ecym_10861.82ON209161017020.0
KLLA0C02321g1.82ON184263316680.0
NCAS0G001205.717ON13144858183e-88
SAKL0E15224g5.717ON13354607659e-82
Kpol_416.105.717ON14914807546e-80
CAGL0H06765g5.717ON12945057381e-78
TDEL0F055605.717ON12924817265e-77
Smik_9.95.717ON13744917275e-77
Skud_9.85.717ON13745227241e-76
AGL364Cna 1ON12604827202e-76
Ecym_40045.717ON14544687162e-75
Kwal_55.196205.717ON13894757142e-75
KNAG0L022505.717ON13674807124e-75
AFR301C5.717ON16554807146e-75
NDAI0F001605.717ON13495057081e-74
YIL159W (BNR1)5.717ON13754907081e-74
KLLA0F10912g5.717ON12834817023e-74
Ecym_5679na 1ON13064616999e-74
TPHA0E001205.717ON16424806878e-72
ZYRO0B16654g5.717ON14244206841e-71
KLTH0E00704g5.717ON13894386633e-69
TBLA0E018105.717ON14515096618e-69
KAFR0D021205.717ON13244906562e-68
Suva_9.265.717ON13754226535e-68
Skud_8.1375.363ON109366801.8
KAFR0K023306.223ON540112782.8
Kwal_55.202475.363ON923109773.8
KLTH0F13222g7.150ON520139773.9
Smik_8.1275.322ON88385765.3
NDAI0C063908.63ON37773755.6
Smik_8.1545.363ON109064749.4
SAKL0H21384g4.90ON80960749.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F04220
         (2022 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}          3450   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...  1216   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...  1063   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...  1060   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...  1059   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...   996   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....   985   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...   924   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...   924   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...   814   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     812   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...   785   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   744   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   743   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...   712   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...   693   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...   679   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...   673   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...   660   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   647   0.0  
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      319   3e-88
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   299   9e-82
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   295   6e-80
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   288   1e-78
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   284   5e-77
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   284   5e-77
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   283   1e-76
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   281   2e-76
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   280   2e-75
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   279   2e-75
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   278   4e-75
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   279   6e-75
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     277   1e-74
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   277   1e-74
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   275   3e-74
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   273   9e-74
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   269   8e-72
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   268   1e-71
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   259   3e-69
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   259   8e-69
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   257   2e-68
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   256   5e-68
Skud_8.137 Chr8 complement(226303..228618,228619..229584) [3282 ...    35   1.8  
KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {...    35   2.8  
Kwal_55.20247 s55 (318090..320861) [2772 bp, 923 aa] {ON} YHR077...    34   3.8  
KLTH0F13222g Chr6 (1086482..1088044) [1563 bp, 520 aa] {ON} simi...    34   3.9  
Smik_8.127 Chr8 complement(190428..193079) [2652 bp, 883 aa] {ON...    34   5.3  
NDAI0C06390 Chr3 complement(1479232..1480365) [1134 bp, 377 aa] ...    33   5.6  
Smik_8.154 Chr8 complement(229050..232316,232428..232433) [3273 ...    33   9.4  
SAKL0H21384g Chr8 complement(1869636..1872065) [2430 bp, 809 aa]...    33   9.8  

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score = 3450 bits (8945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1730/2022 (85%), Positives = 1730/2022 (85%)

Query: 1    MLRNSSNKHNANQEQGTKNNATTSGSNLFQNLKRFAXXXXXXXXXXXXXXXXXXXXXQVK 60
            MLRNSSNKHNANQEQGTKNNATTSGSNLFQNLKRFA                     QVK
Sbjct: 1    MLRNSSNKHNANQEQGTKNNATTSGSNLFQNLKRFATNSTGSSNNTSPRTSNSSEPSQVK 60

Query: 61   RESIPQGSTSSLHSSNEIKPLIKNTTLNTQNLSQYINSKNIPDHXXXXXXXXXXXXXXXX 120
            RESIPQGSTSSLHSSNEIKPLIKNTTLNTQNLSQYINSKNIPDH                
Sbjct: 61   RESIPQGSTSSLHSSNEIKPLIKNTTLNTQNLSQYINSKNIPDHSRSQSIQSSSKYSYSS 120

Query: 121  XXXXXXTNPSVTGYKLDRQYTNQSSAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIE 180
                  TNPSVTGYKLDRQYTNQSSAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIE
Sbjct: 121  RRASSQTNPSVTGYKLDRQYTNQSSAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIE 180

Query: 181  YLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSKGAKASHSIGP 240
            YLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSKGAKASHSIGP
Sbjct: 181  YLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSKGAKASHSIGP 240

Query: 241  DXXXXXXXXXXXHLILGSPSKSNNMISPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP 300
            D           HLILGSPSKSNNMISPK                              P
Sbjct: 241  DNNNNNNNNYNNHLILGSPSKSNNMISPKSNLNNFESPSSSLSASTQTTTNNYKQYNNKP 300

Query: 301  SKRSASNISQPKSTTEVYXXXXXXXXXTTLTDKTNRLPIEYVKKIISDTLTSEEMKDLWV 360
            SKRSASNISQPKSTTEVY         TTLTDKTNRLPIEYVKKIISDTLTSEEMKDLWV
Sbjct: 301  SKRSASNISQPKSTTEVYSNSHSNSSNTTLTDKTNRLPIEYVKKIISDTLTSEEMKDLWV 360

Query: 361  TLRTEQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSML 420
            TLRTEQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSML
Sbjct: 361  TLRTEQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSML 420

Query: 421  SQGLREFTKHELMAQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFK 480
            SQGLREFTKHELMAQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFK
Sbjct: 421  SQGLREFTKHELMAQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFK 480

Query: 481  IGQNLHMAHNLKKFGEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNS 540
            IGQNLHMAHNLKKFGEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNS
Sbjct: 481  IGQNLHMAHNLKKFGEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNS 540

Query: 541  GGENATLEYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQ 600
            GGENATLEYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQ
Sbjct: 541  GGENATLEYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQ 600

Query: 601  IDVYENSKLDDINKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLS 660
            IDVYENSKLDDINKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLS
Sbjct: 601  IDVYENSKLDDINKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLS 660

Query: 661  SSQLIEDKQDATQLSKQLKLMDSLVTNVSVASTDQESTMNMAIQRLYDAMQTDEVARRSI 720
            SSQLIEDKQDATQLSKQLKLMDSLVTNVSVASTDQESTMNMAIQRLYDAMQTDEVARRSI
Sbjct: 661  SSQLIEDKQDATQLSKQLKLMDSLVTNVSVASTDQESTMNMAIQRLYDAMQTDEVARRSI 720

Query: 721  LESRTLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAXX 780
            LESRTLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQA  
Sbjct: 721  LESRTLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAEL 780

Query: 781  XXXXXXXXXXXXXXXXXXRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKV 840
                              RKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKV
Sbjct: 781  EDLKKKHLLEKHEQEVELRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKV 840

Query: 841  LQEGLNRTKKDFTMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFXXXXXX 900
            LQEGLNRTKKDFTMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEF      
Sbjct: 841  LQEGLNRTKKDFTMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFEKKKLE 900

Query: 901  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQTLANIQNESNDISKFNVEERVNELFNE 960
                                           RQTLANIQNESNDISKFNVEERVNELFNE
Sbjct: 901  PAPKIKKLKQKKQNKNEKKEEDDKIKKLNELRQTLANIQNESNDISKFNVEERVNELFNE 960

Query: 961  KRSTALQRLKELETKYKDFGINFNIDDISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDEL 1020
            KRSTALQRLKELETKYKDFGINFNIDDISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDEL
Sbjct: 961  KRSTALQRLKELETKYKDFGINFNIDDISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDEL 1020

Query: 1021 NRITEQLLDAQAKLNEKNLKDXXXXXXXXXXXXXXXXXXXXXXXXXXXDEEEIDDIKSRD 1080
            NRITEQLLDAQAKLNEKNLKD                           DEEEIDDIKSRD
Sbjct: 1021 NRITEQLLDAQAKLNEKNLKDSSNKSTFSESSSSSSSSSSSSSSSSSSDEEEIDDIKSRD 1080

Query: 1081 RQSEISAQSTSSAAGSFLEALSQKYAMGQNNPSSPQRDRPVKASQYDFINRVRKNNITPQ 1140
            RQSEISAQSTSSAAGSFLEALSQKYAMGQNNPSSPQRDRPVKASQYDFINRVRKNNITPQ
Sbjct: 1081 RQSEISAQSTSSAAGSFLEALSQKYAMGQNNPSSPQRDRPVKASQYDFINRVRKNNITPQ 1140

Query: 1141 FLEELSGKVVPPSSGLSTTTKVVDVTSGGKSETATENVLENTTEPVTEHSFRNAVLSNDK 1200
            FLEELSGKVVPPSSGLSTTTKVVDVTSGGKSETATENVLENTTEPVTEHSFRNAVLSNDK
Sbjct: 1141 FLEELSGKVVPPSSGLSTTTKVVDVTSGGKSETATENVLENTTEPVTEHSFRNAVLSNDK 1200

Query: 1201 IDREENDTVISTTEPTEKIGFNAEEKSXXXXXXXXXXXXXILEGRSEEEDRSTANTNISK 1260
            IDREENDTVISTTEPTEKIGFNAEEKS             ILEGRSEEEDRSTANTNISK
Sbjct: 1201 IDREENDTVISTTEPTEKIGFNAEEKSAVAAPPPAPPLPAILEGRSEEEDRSTANTNISK 1260

Query: 1261 TSVSXXXXXXXXXXXXXXLGLFGFNSNIPKLADTEPLKQXXXXXXXXXXXXXXXXXXXXX 1320
            TSVS              LGLFGFNSNIPKLADTEPLKQ                     
Sbjct: 1261 TSVSPVPPPPPPPPPPPPLGLFGFNSNIPKLADTEPLKQSASSPALSSPAPPPPPPPPPP 1320

Query: 1321 XXXMLPTNGPKKVXXXXXXXXXXXXFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQF 1380
               MLPTNGPKKV            FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQF
Sbjct: 1321 APPMLPTNGPKKVLSSPLLPQSPSLFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQF 1380

Query: 1381 ADDLYEKGVLSELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVP 1440
            ADDLYEKGVLSELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVP
Sbjct: 1381 ADDLYEKGVLSELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVP 1440

Query: 1441 DLITKILKCDRDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEK 1500
            DLITKILKCDRDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEK
Sbjct: 1441 DLITKILKCDRDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEK 1500

Query: 1501 NPNELQRADQIYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQES 1560
            NPNELQRADQIYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQES
Sbjct: 1501 NPNELQRADQIYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQES 1560

Query: 1561 ENLKNVFGVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYP 1620
            ENLKNVFGVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYP
Sbjct: 1561 ENLKNVFGVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYP 1620

Query: 1621 AFNKFLVELEPVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLA 1680
            AFNKFLVELEPVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLA
Sbjct: 1621 AFNKFLVELEPVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLA 1680

Query: 1681 KVLPSLPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKK 1740
            KVLPSLPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSG               ITEYKK
Sbjct: 1681 KVLPSLPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKK 1740

Query: 1741 AQTQNLRLEEEEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDT 1800
            AQTQNLRLEEEEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDT
Sbjct: 1741 AQTQNLRLEEEEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDT 1800

Query: 1801 LLEQLKNVTPTNKTDPSSARKRALVRKKLMGESTSNILKDIDTEDDSIIYSPDAKKPMAT 1860
            LLEQLKNVTPTNKTDPSSARKRALVRKKLMGESTSNILKDIDTEDDSIIYSPDAKKPMAT
Sbjct: 1801 LLEQLKNVTPTNKTDPSSARKRALVRKKLMGESTSNILKDIDTEDDSIIYSPDAKKPMAT 1860

Query: 1861 TVDMANTTLESELDVSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTK 1920
            TVDMANTTLESELDVSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTK
Sbjct: 1861 TVDMANTTLESELDVSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTK 1920

Query: 1921 RHSLLNEHKEXXXXXXXXTTNEFVSGKLQFVGEDXXXXXXXXXXXXXXXXXXXXXXXXXX 1980
            RHSLLNEHKE        TTNEFVSGKLQFVGED                          
Sbjct: 1921 RHSLLNEHKERLRARRRRTTNEFVSGKLQFVGEDETIVNTNENMNNNETDSENTPTETTI 1980

Query: 1981 XXXGSADTETTSLEQPATTTDVSLNKDDVKGVDDHNSNDNDE 2022
               GSADTETTSLEQPATTTDVSLNKDDVKGVDDHNSNDNDE
Sbjct: 1981 IPPGSADTETTSLEQPATTTDVSLNKDDVKGVDDHNSNDNDE 2022

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score = 1216 bits (3147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1160 (56%), Positives = 793/1160 (68%), Gaps = 45/1160 (3%)

Query: 75   SNEIKPLIKNTTLNTQNLSQYINSKNIPDHXXXXXXXXXXXXXXXXXXXXXXTNPSVTGY 134
            +N +KPL K T+LNTQNLSQYIN K+ P H                         ++   
Sbjct: 67   TNSLKPLNKKTSLNTQNLSQYINDKHSPQHTRSASVQSSSKYSYSRRSSSQTLGSTLN-- 124

Query: 135  KLDRQYTNQSSAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQ 194
            ++ RQ+TNQSSA S+LSQGS++NLSKF+  DGK+NLEMP DP+E+E L+++IM+KRNILQ
Sbjct: 125  QIARQHTNQSSA-SILSQGSFTNLSKFIAPDGKINLEMPRDPNEVEVLFEDIMLKRNILQ 183

Query: 195  SLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSKGAKASHSIGPDXXXXXXXXXXXHL 254
            SLP  KQ+ELMSYD+ KKWLIVKQDLQNE KK + K    + +   +             
Sbjct: 184  SLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRLKTNSTNTNNNNNNNRSSMSPENSST 243

Query: 255  I-LGSPSKSNNMISPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSKRSASNISQPKS 313
            I L SP+     +SP                                SKR    IS P  
Sbjct: 244  INLNSPATM--QMSPHHHIGSNSNSSINSHHTPITI-----------SKRPTGPISNPIP 290

Query: 314  TTEVYXXXXXXXXXTTLTDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAF 373
              ++Y         ++++DKTNR PI YVK+II+DT+TSEEMKDLWVTLRTEQ+DWVDAF
Sbjct: 291  NADMYKLSMRNTSSSSMSDKTNRPPIHYVKRIIADTITSEEMKDLWVTLRTEQIDWVDAF 350

Query: 374  IEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELM 433
            IEHQGHIAMAN+LMKS+YKT+ +     QLLEKEN+FFKCFRVLSMLSQGLREFT+HE+M
Sbjct: 351  IEHQGHIAMANILMKSLYKTSSDGTPNPQLLEKENAFFKCFRVLSMLSQGLREFTRHEIM 410

Query: 434  AQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKK 493
            +QT+ARGLFS TLSTR+MATEIFVCML KKNPERFKVILN LDQKFKIG N HM  N+K 
Sbjct: 411  SQTVARGLFSITLSTRRMATEIFVCMLEKKNPERFKVILNALDQKFKIGYNAHMTQNIKM 470

Query: 494  FGEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWS 553
            F +YF  LTLDS LKVT+AWLFAVEH+LDGRGKMGS VGASDD+KNSGGENA LEYCQWS
Sbjct: 471  FPDYFTHLTLDSQLKVTQAWLFAVEHTLDGRGKMGSLVGASDDFKNSGGENAILEYCQWS 530

Query: 554  MIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDIN 613
            MIFINHLC CS NINQRMLLR KLE CGI+RIMN++K+L Y+KVIEQID+YEN+KLDD+N
Sbjct: 531  MIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDYDKVIEQIDLYENNKLDDLN 590

Query: 614  KLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQ 673
             LLE +NKNANINL DPTS+++NLWDACKGTENEKLLISL+QHLFLSSSQ IE+K+D  +
Sbjct: 591  TLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLMQHLFLSSSQFIEEKKDPVK 650

Query: 674  LSKQLKLMDSLVTNVSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEES 733
            LS+QLKL+DSLVTNVSV+STDQE++MNMAIQRLYDAMQTDEVARRSILESRTLTKKLEE 
Sbjct: 651  LSRQLKLLDSLVTNVSVSSTDQEASMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEEV 710

Query: 734  QAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXX 793
            QAE DLLSQKLKNAEHGLVGQLQDEL QRDR+ +KNQR+ EQLQ                
Sbjct: 711  QAERDLLSQKLKNAEHGLVGQLQDELAQRDRILSKNQRVMEQLQGELEELKKKHLLEKHE 770

Query: 794  XXXXXRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFT 853
                 RKMLTILNAR +  E    S K   + P + + SKKQ+IQ+ LQ+GL+RTKKD++
Sbjct: 771  QEVELRKMLTILNARPEIVEGNGTSKKTKAKNPSALDPSKKQSIQQALQDGLSRTKKDYS 830

Query: 854  MDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFXXXXXXXXXXXXXXXXXXX 913
            +D+++FGMT+QPNKRLK LRMQMEDIENEARELEMTNF E+                   
Sbjct: 831  VDARNFGMTIQPNKRLKLLRMQMEDIENEARELEMTNFTEY----EKRKLEAPSKIKKPK 886

Query: 914  XXXXXXXXXXXXXXXXXXRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELE 973
                              RQTLA IQ ESNDISKFNV+ERVNELFN+KR TAL+RL++LE
Sbjct: 887  KVATKKEIDPSINKLNDLRQTLAEIQMESNDISKFNVDERVNELFNQKRITALKRLQDLE 946

Query: 974  TKYKDFGINFNIDDISEKTTGIDNSGD-KSTEYSSLDPNAYQIKLDELNRITEQLLDAQA 1032
            TKYKDFGI+FNID++ +  +  +N  + +S +YSSLDP AYQ KLDELNR+T++LL  + 
Sbjct: 947  TKYKDFGIDFNIDELVDSASKDENGNNQQSGDYSSLDPKAYQRKLDELNRLTDELLRVKN 1006

Query: 1033 KLN--EKNLKDXXXXXXXXXXXXXXXXXXXXXXXXXXXDEEEIDDIKSRDRQSEISAQST 1090
            K+N  + NL                                    I+ +D QS  S   T
Sbjct: 1007 KVNASDNNLSSRRPSASSSSESASSSSDSDDGESL----------IERQDTQSNFSG--T 1054

Query: 1091 SSAAGSFLEALSQKYAMGQNNPSSPQRDRPVKASQYDFINRVRKNNITPQFLEELSGKVV 1150
            S+  GSFLEAL+QKYA GQ + +SP RD+  +     FINR+++ N+ P FL+EL+ KV 
Sbjct: 1055 SAGPGSFLEALTQKYATGQKS-ASP-RDQSTRMKDNIFINRIKQTNVAPPFLDELTDKVA 1112

Query: 1151 ---PPSSGLSTTTKVVDVTSGGKSETATENVLENTTEPVTEHSFRNAVLSNDKIDREEND 1207
               P  + L+       +    K ET   N+  +  E V + S  N  +S     + +N+
Sbjct: 1113 EAPPVEASLAEPDNNNTINESSKEETGEANLTSSDNEVVAQASLSNPEVS----PKHDNN 1168

Query: 1208 TVISTTEPTEKIGFNAEEKS 1227
            +V    E  +K   +A++ S
Sbjct: 1169 SVKDVNESDDKAEVSAKDTS 1188

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/634 (72%), Positives = 528/634 (83%), Gaps = 16/634 (2%)

Query: 1327 TNGP-KKVXXXXXXXXXXXXFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLY 1385
            T+GP KKV            FENYPRP KKLKQLHWEK++ATDNSIW+ NKAE+FADDLY
Sbjct: 1268 TDGPRKKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLY 1327

Query: 1386 EKGVLSELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITK 1445
            EKGVL++LE AFAAREIKSLASK+K+DL KI+FLS D+SQQFGINLHMYA+L V D++ K
Sbjct: 1328 EKGVLTDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKK 1387

Query: 1446 ILKCDRDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNEL 1505
            ILKCDRDFL TPSVIEFLS+PEIV+VSVNLARNYAPY  DWEG+K+VEDAK PEK+PNEL
Sbjct: 1388 ILKCDRDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNEL 1447

Query: 1506 QRADQIYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKN 1565
            QRADQ+YLQL++NLQSYWGSRMRAL VITTF+KEYNELLTKLRKVD+AVSSLQESENLKN
Sbjct: 1448 QRADQLYLQLIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKN 1507

Query: 1566 VFGVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKF 1625
            VF VILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTN+MTFLNYVEKIVR+NYP+FN F
Sbjct: 1508 VFNVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDF 1567

Query: 1626 LVELEPVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPS 1685
            L ELEPVLDVVKISIEQLV DCKEFSQSIVNVERS+E GNLSDSSKFHP DRVLAKVLP 
Sbjct: 1568 LTELEPVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPI 1627

Query: 1686 LPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQN 1745
            LPDARKKGELLGDEVKLTIMEFLRLMQIYGEDS                ITEYKKAQ QN
Sbjct: 1628 LPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQN 1687

Query: 1746 LRLEEEEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDG----RAIMDTL 1801
            ++ EEEE+VYERHKKMVE+QQ+K QE E     +G++G+++ E+G GD     RA+MD L
Sbjct: 1688 IKAEEEEQVYERHKKMVEDQQKKLQEQE-----NGSNGSENGEEGSGDDSGDRRAMMDKL 1742

Query: 1802 LEQLKNVTPTNKTDPSSARKRALVRKKLMGESTSNILKDIDTEDDSIIYSPDAKKPMATT 1861
            L+QLKN  P+ KTDPSSARKRALVRKKLM EST+ +LKDI+TEDDSIIYSP+ K P    
Sbjct: 1743 LDQLKNAGPS-KTDPSSARKRALVRKKLMTESTA-LLKDIETEDDSIIYSPEGKNPFVNP 1800

Query: 1862 VDMANTTLESELDV-SSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTK 1920
            VD+     ESE+DV SSP + + SP +N  S  + ++++E+ +RA+ALL++L GS++P+K
Sbjct: 1801 VDLDTPHDESEMDVSSSPIQRSLSPSRN--STLLSDDQDEVTDRAKALLMELRGSNTPSK 1858

Query: 1921 RHSLLNEHKEXXXXXXXXTTNEFVSG-KLQFVGE 1953
            R+SLL+EHKE        T ++  SG +LQFVGE
Sbjct: 1859 RNSLLDEHKEKLRARRRKTNSDLHSGTRLQFVGE 1892

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score = 1063 bits (2750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/1189 (51%), Positives = 756/1189 (63%), Gaps = 77/1189 (6%)

Query: 1    MLRNSSNKHNANQEQGTKNNATTSGSNLFQNLKRFAXXXXXXXXXXXXXXXXXXXXXQVK 60
            ML+NS +KH+      +K + + S S +FQNLKR A                      V 
Sbjct: 1    MLKNSGSKHSN-----SKESHSNSSSGIFQNLKRLANSNATNSNTGSPTYASQQQHSPVG 55

Query: 61   RE---------SIPQGSTSSLHSSNEIKPLIKNTTLNTQNLSQYINSK---NIPDHXXXX 108
             E         S  + +  S  +S E +PL K +TLNTQNLSQY+N K   ++P      
Sbjct: 56   NEVSTSPASSSSFRKLNAPSRSTSTEARPLNKKSTLNTQNLSQYMNGKLSGDVP-----V 110

Query: 109  XXXXXXXXXXXXXXXXXXTNPSVTGYKLDRQYTNQS-SAVSVLSQGSYSNLSKFMTHDGK 167
                               N S    KL RQ+T QS SA S+LSQGS +NLSKF T DGK
Sbjct: 111  SSQHARSHSMQSKYSYSKRNSSQASNKLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGK 170

Query: 168  LNLEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKF 227
            + LEMP+DP E+E L+++IM KRNI QSL   KQ+ LM Y I KKWLIVKQDLQNE KK 
Sbjct: 171  IYLEMPSDPYEVEVLFEDIMYKRNIFQSLSEDKQEALMGYSIEKKWLIVKQDLQNELKKM 230

Query: 228  KSKGAKASHSIGPDXXXXXXXXXXXHLILGSPSKSNNMISPKXXXXXXXXXXXXXXXXXX 287
            ++    +S +               H IL + S   ++ SPK                  
Sbjct: 231  RANTTSSSTA------SRTSMASDHHPILTANS---SLSSPKSVLMTSASSPTSTVYSNS 281

Query: 288  XXXXXXXXXXXXPSKRSASNIS-----QPKSTTEVYX--XXXXXXXXTTLTDKTNRLPIE 340
                         + +    +S     QP S   +Y           T   D+TNR PI 
Sbjct: 282  LNHSTTLSSVGTSTSKGKKLVSGSLKKQP-SLNNIYRGGAENNTSASTLPGDRTNRPPIH 340

Query: 341  YVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNEKLT 400
            YV++I++D LTS+EMKDLWVTLRTEQLDWVDAFI+HQGHIAMANVLM SIYKT P E LT
Sbjct: 341  YVQRILADKLTSDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPRENLT 400

Query: 401  SQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKMATEIFVCML 460
             +LLEKENSFFKCFRVLSMLSQGL EF+ H LM  T+A GLFST L+TRKMATEIFVCML
Sbjct: 401  KELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATRKMATEIFVCML 460

Query: 461  NKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVTRAWLFAVEHS 520
             KKN  RF+ +L  LD+KF+IGQNLHM  N KK  +YF  LTL+S+LK+ +AWLFAVE +
Sbjct: 461  EKKNKSRFEAVLTSLDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQT 520

Query: 521  LDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQRMLLRNKLEYC 580
            LDGRGKMGS VGASD++KN GGENA LEYCQW+M+FINHLC CSDNINQRMLLR KLE C
Sbjct: 521  LDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENC 580

Query: 581  GIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHDPTSLVKNLWDA 640
            GI+RIMN+IK L Y+KVI+QI++Y+N+KLDD N  LE +NK  N++LHDP SL+KNLWD 
Sbjct: 581  GILRIMNKIKLLDYDKVIDQIELYDNNKLDDFNVKLEANNKAFNVDLHDPLSLLKNLWDI 640

Query: 641  CKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNVSVAST-DQESTM 699
            CKGTENEKLL+SLVQHLFLSSS+LIE+ Q++++L+KQLKLMDSLVTNVSVAST D+E+ M
Sbjct: 641  CKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVSVASTSDEETNM 700

Query: 700  NMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQDEL 759
            NMAIQRLYDAMQTDEVARR+ILESR LTKKLEE QAE D LS+KL  AEHGLVGQL+DEL
Sbjct: 701  NMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDEL 760

Query: 760  RQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXXXXXXXRKMLTILNARSDKGEIEKKSS 819
             +RDR+ AKNQR+ +QL+A                    RKMLTILN+R ++   + + +
Sbjct: 761  HERDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRKMLTILNSRPEESFNKNEGT 820

Query: 820  KKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNKRLKALRMQMEDI 879
            +    +  S  SS+K NIQKVLQ+GL+R KKD+  DSK FGMT+QPNKRLK LRMQME+I
Sbjct: 821  RG---MNSSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENI 877

Query: 880  ENEARELEMTNFAEFXXXXXX----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQTL 935
            ENEAR+LEMTNFAEF                                         R+ L
Sbjct: 878  ENEARQLEMTNFAEFEKDRLEPPIHIKKPKVKKMKNKDRKPLVKPQEADVNKLNDLRRAL 937

Query: 936  ANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGINFNIDDISEKTTGI 995
            A IQ ESNDISKFNVEERVNELFNEK+S AL+RLKELETKYK FGI+FN+D+I +     
Sbjct: 938  AEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVDEIMDSPK-- 995

Query: 996  DNSGDKSTE----YSSLDPNAYQIKLDELNRITEQLLDAQAKL-NEKNLKDXXXXXXXXX 1050
             N+GD  TE    Y+SLDP  YQ KLDE+NRIT+QLLD Q +  +E  +++         
Sbjct: 996  KNTGDVETEEDANYASLDPKTYQKKLDEINRITDQLLDIQTQTEHEIQVEEDGESDLSSS 1055

Query: 1051 XXXXXXXXXXXXXXXXXXDEEEIDDIKSRDRQSEISAQSTSSAAGSFLEALSQKYAMGQN 1110
                                   D   +++ +SE S  S+ S  GSFL+ALSQKY  GQN
Sbjct: 1056 SSDDESEEIYQ------------DASPTQELRSEHSELSSGSGPGSFLDALSQKYGTGQN 1103

Query: 1111 NPSSPQRDR--------PVKAS-QYDFINRVRKNNITPQ-FLEELSGKV 1149
              +S             P+ +  +  F+NR+RK+ ++   +LEEL+ KV
Sbjct: 1104 VTASAAFGENNNGSGIGPLHSKVEKTFMNRLRKSTVSSAPYLEELTQKV 1152

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/617 (65%), Positives = 488/617 (79%), Gaps = 24/617 (3%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            FE YPRPHKKLKQLHWEK++ TDNSIW   KAE+FADDLYEKGVL++LE AFAAREIKSL
Sbjct: 1348 FEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1407

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
            ASK+K+DLQKITFLS D+SQQFGINLHMY+SL V DL+ KIL CDRDFLQTPSV+EFLS+
Sbjct: 1408 ASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCDRDFLQTPSVVEFLSK 1467

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
             EI++VSVNLARNYAPY  DWEG++N+EDAKPPEK+PN+LQRADQIYLQLMVNL+SYWGS
Sbjct: 1468 SEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQIYLQLMVNLESYWGS 1527

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RMRAL V+T++E+EYNELL KLRKVD+AVS+LQES+NL+NVF VILAVGN+MNDTSKQAQ
Sbjct: 1528 RMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1587

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GFKL+TLQRLTFIKD+TN+MTFLNYVEKIVR NYP+FN FL ELEPVLDVVK+SIEQLV+
Sbjct: 1588 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELEPVLDVVKVSIEQLVN 1647

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DCK+FSQSIVNVERS+EIGNLSDSSKFHP D+VL K LP LP+ARKKG+LL DEVKLTIM
Sbjct: 1648 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDLLEDEVKLTIM 1707

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LM  YGEDSG               I EYKKAQ QNL  EEEE++Y +HKK+VEEQ
Sbjct: 1708 EFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEEERLYIKHKKIVEEQ 1767

Query: 1766 QRKAQEAEISRVNSGTDGTK-DDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRAL 1824
            Q++AQE E  + NS +  ++ ++ED   D RA+MD LLEQLKN  P  K+DPSSARKRAL
Sbjct: 1768 QKRAQEKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLKNAGPA-KSDPSSARKRAL 1826

Query: 1825 VRKKLMGE--STSNILKDIDTEDDSIIYSPDAKKPMATTVDMANT--------TLESELD 1874
            VRKK + E  +   +L D+DTE+ SI+YSP+A  P A TV  A +         + +  D
Sbjct: 1827 VRKKYLSEKDNAPQLLNDLDTEEGSILYSPEAMDPTADTVIHAESPTPLATRGVMNTSED 1886

Query: 1875 VSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLLNEHKEXXXX 1934
            + SP++ ++            E++EEI +RA+ LL +L GS +P K++S+L+EH E    
Sbjct: 1887 LPSPSKTSAL-----------EDQEEISDRARMLLKELRGSDTPVKQNSILDEHLEKLRA 1935

Query: 1935 XXXXTTNEFVSG-KLQF 1950
                +  E  +G +L F
Sbjct: 1936 RKERSIGEASTGNRLSF 1952

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score = 1060 bits (2742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/1287 (49%), Positives = 789/1287 (61%), Gaps = 122/1287 (9%)

Query: 1    MLRNSSNKHNANQEQGTKNNATTSGSNLFQNLKRFAXXXXXXXXXXXXXXXX-XXXXXQV 59
            ML+NS +KH+ ++E  + +N     S LFQNLKR A                       V
Sbjct: 1    MLKNSGSKHSNSKESHSNSN-----SGLFQNLKRLANSNAANNNTGSPTNVSPQQQHSPV 55

Query: 60   KRESIPQ-----------GSTSSLHSSNEIKPLIKNTTLNTQNLSQYINSKNIPDHXXXX 108
            + E+              G + S+  S E +PL K +TLNTQNLSQY+N K   D     
Sbjct: 56   EHEAATSPASSSSFRKLNGPSRSI--STEARPLNKKSTLNTQNLSQYMNGKISAD--VPV 111

Query: 109  XXXXXXXXXXXXXXXXXXTNPSVTGYKLDRQYTNQSSAVS-VLSQGSYSNLSKFMTHDGK 167
                               N S    KL RQ+T QS +VS +LSQGS +NLSKF T DGK
Sbjct: 112  SSQHARSHSMQSKYSYSKRNSSQASNKLTRQHTGQSHSVSSLLSQGSLTNLSKFTTPDGK 171

Query: 168  LNLEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKF 227
            ++LEMP+DP E+E L+++IM KRNI QSL G KQ+ LMSY   KKWLIVKQDLQNE KK 
Sbjct: 172  IHLEMPSDPYEVEVLFEDIMYKRNIFQSLSGDKQEALMSYSTEKKWLIVKQDLQNELKKL 231

Query: 228  KS----KGAKASHSIGPDXXXXXXXXXXXHLILGSPSKSNNMISPKXXXXXXXXXXXXXX 283
            ++        +  SI  D           H IL + S   ++ SPK              
Sbjct: 232  RANTTSSSTASRTSIASDH----------HPILTANS---SLSSPKSVLMTSASSPTSTV 278

Query: 284  XXXXXXXXXXXXXXXXPSKRS----ASNISQPKSTTEVYX--XXXXXXXXTTLTDKTNRL 337
                             + +S      ++ +  S   +Y           T   D+TNR 
Sbjct: 279  YSNSLNHSTTLSSVGTSTSKSKKLMGGSLKKQPSLNNIYRGGSENNTSASTLPGDRTNRP 338

Query: 338  PIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNE 397
            PI YV++I++D LT++EMKDLWVTLRTEQLDWVDAFI+HQGHIAMANVLM SIYKT P +
Sbjct: 339  PIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPRD 398

Query: 398  KLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKMATEIFV 457
             LT +LLEKENSFFKCFRVLSMLSQGL EF+ H LM  T+A GLFST L+TRKMATEIFV
Sbjct: 399  SLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTRLATRKMATEIFV 458

Query: 458  CMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVTRAWLFAV 517
            CML KKN  RF+ +L  LD+KF+IGQNLHM  N KK  +YF  LTL+S+LK+ +AWLFAV
Sbjct: 459  CMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAV 518

Query: 518  EHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQRMLLRNKL 577
            E +LDGRGKMGS VGASD++KN GGENA LEYCQW+M+FINHLC CSDNINQRMLLR KL
Sbjct: 519  EQTLDGRGKMGSLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKL 578

Query: 578  EYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHDPTSLVKNL 637
            E CG++RIMN+IK L Y+KV++QI++Y+N+KLDD N  LE +NK  N++L DP SL+KNL
Sbjct: 579  ENCGVLRIMNKIKLLDYDKVMDQIELYDNNKLDDFNVRLEANNKAFNVDLQDPLSLLKNL 638

Query: 638  WDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNVSVAST-DQE 696
            WD CKGTENEKLL+SLVQHLFLSSS+LIE+ Q+ ++L+KQLK+MDSLVT+VS+AST D+E
Sbjct: 639  WDICKGTENEKLLVSLVQHLFLSSSKLIEENQNPSKLTKQLKVMDSLVTSVSIASTSDEE 698

Query: 697  STMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQ 756
            S MNMAIQRLYDAMQTDEVARR+ILESR LTKKLEE QAE D LS+KL  AEHGLVGQL+
Sbjct: 699  SNMNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLE 758

Query: 757  DELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXXXXXXXRKMLTILNARSDKGEIEK 816
            DEL  RDR+ AKNQR+ +QL+A                    RKMLTILN+R +      
Sbjct: 759  DELHGRDRILAKNQRVMQQLEAELEELKKKHLLEKHQQEVELRKMLTILNSRPE------ 812

Query: 817  KSSKKHKRIPG---SFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNKRLKALR 873
            ++S  ++ I G   S  SS+K NIQKVLQ+GL+R KKD+  DSK FGMT+QPNKRLK LR
Sbjct: 813  ENSSINEGIRGKNSSLNSSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLR 872

Query: 874  MQMEDIENEARELEMTNFAEFXXXX----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 929
            MQME+IENEAR+LEMTNFAEF                                       
Sbjct: 873  MQMENIENEARQLEMTNFAEFEKDHLEPPIQIKKPKLKKIKHKDKKLISRPQEVDMNKLN 932

Query: 930  XXRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGINFNIDDIS 989
              R+ LA IQ ESNDISKFNVEERVNELFNEK+S AL+RLKELETKYK FGI+FN+++I 
Sbjct: 933  DLRRALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEIM 992

Query: 990  E--KTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQLLDAQAKLNEKNLKDXXXXXX 1047
            E  K    +   +    YSSLDP  YQ KLDE+NRIT+QLLD QA+  + +         
Sbjct: 993  ESPKKNSANERKEDGANYSSLDPRTYQNKLDEINRITDQLLDLQAQTKQDD--------- 1043

Query: 1048 XXXXXXXXXXXXXXXXXXXXXDEEEI--DDIKSRDRQSEISAQSTSSAAGSFLEALSQKY 1105
                                 + E++  D   +++ +SE S  S  S +GSFL+ALSQKY
Sbjct: 1044 --------GGVSSLSSSSSSAEGEDVYQDAFPAQEVRSENSELSVESGSGSFLDALSQKY 1095

Query: 1106 AMGQNNPSSPQ-RDR---------PVKASQYDFINRVRKNNITPQ-FLEELSGKV----- 1149
              GQNN  S   RD          P K  +  F+N++RK+  +   +LEEL+ KV     
Sbjct: 1096 GTGQNNTVSVGLRDSDYVSVIGHMPSKVEK-TFMNKLRKSTASSAPYLEELTQKVNKVES 1154

Query: 1150 ----------------VPPSSGLSTTTKVVDVTSG-------GKSETATENVLENTTEPV 1186
                              P + +    KV +   G       G+ +T  E +++N  E +
Sbjct: 1155 YEQDEDEVRSKESSSKNAPRNAVPVIDKVKESFRGHVESREEGRLDTKEEEIVKNDEETI 1214

Query: 1187 TEHSFRNAVLSNDKIDREENDTVISTT 1213
            T +   +AV  +D +   ++ T +S+T
Sbjct: 1215 TTN--LSAVCGSDNVANAKSITTVSST 1239

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/617 (65%), Positives = 489/617 (79%), Gaps = 24/617 (3%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            FE YPRPHKKLKQLHWEK+++TDNSIW   KAE+FADDLYEKGVL++LE AFAAREIKSL
Sbjct: 1347 FEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1406

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
            A+K+K+DL+KITFLS D+SQQFGINLHMY+SL V DL+ KIL CDRDFLQTPSV+EFLS+
Sbjct: 1407 ATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCDRDFLQTPSVVEFLSK 1466

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
            PEI++VSVNLARNYAPY  DWEG+KN++DAKPPEK+PN+LQRADQIYLQLMVNL+SYWGS
Sbjct: 1467 PEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQIYLQLMVNLESYWGS 1526

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RMRAL V+T++EKEYNELLTKLRKVD+AV +LQES+NL+NVF VILAVGN+MNDTSKQAQ
Sbjct: 1527 RMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1586

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GFKL+TLQRLTFIKD+ N+MTFLNYVEKI+R NYP+FN FL ELEPVLDVVK+SIEQLV+
Sbjct: 1587 GFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1646

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DC++FSQSIVNVERS+EIGNLSDSSKFHP D++L K LP LP+ARKKG+LL DEVKLTIM
Sbjct: 1647 DCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEARKKGDLLEDEVKLTIM 1706

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LM  YGEDSG               I EYKKAQ+QNL  EEEE++YE+HKK+VEEQ
Sbjct: 1707 EFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEEEERIYEKHKKIVEEQ 1766

Query: 1766 QRKAQEAEISRVNSGTDGTKDDEDGPG-DGRAIMDTLLEQLKNVTPTNKTDPSSARKRAL 1824
            Q++AQE E  + NS +  ++ +E+    D RA+MD LLEQLKN  P  K+DPSSARKRAL
Sbjct: 1767 QKRAQEREKQKENSNSSSSEGNEEDEAEDRRAVMDKLLEQLKNAGP-GKSDPSSARKRAL 1825

Query: 1825 VRKKLMG--ESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMANT--------TLESELD 1874
            VRK+ +   +++  +L D+D E+ SI+YSP+A  P A  V  A +        TL    D
Sbjct: 1826 VRKRYLSDKDNSQQLLNDLDNEEGSILYSPEALDPDADAVIHAESPTPLTTRGTLNIPED 1885

Query: 1875 VSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLLNEHKEXXXX 1934
            + SP++ ++            E++EEI +RA+ LL +L GS +P K++S+L+EH E    
Sbjct: 1886 LPSPSKASTL-----------EDQEEISDRAKMLLKELRGSDTPVKQNSILDEHLEKLRA 1934

Query: 1935 XXXXTTNEFVSG-KLQF 1950
                T  E  +G KL F
Sbjct: 1935 RKERTIGEGSAGNKLSF 1951

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score = 1059 bits (2739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/1096 (54%), Positives = 714/1096 (65%), Gaps = 37/1096 (3%)

Query: 71   SLHSSNEIKPLIKNTTLNTQNLSQYINSKNIPDHXXXXXXXXXXXXXXXXXXXXXXTNPS 130
            S  +S E +PL K  TLNTQNLSQY+N K   D                       +  S
Sbjct: 75   SRSTSTEARPLNKKATLNTQNLSQYMNGKISTDAPTSSQHARSHSVQSKYSYSKRTS--S 132

Query: 131  VTGYKLDRQYTNQS-SAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIK 189
                KL RQ+T QS SA S+LS GS +NLSKF T DGK++LEMP+DP E+E L+++IM K
Sbjct: 133  QASNKLTRQHTGQSHSATSLLSLGSLTNLSKFTTPDGKIHLEMPSDPYEVEVLFEDIMYK 192

Query: 190  RNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSKGAKASHSIGPDXXXXXXXX 249
            RNI QSL G KQ+ELMSY   KKWLIVKQDLQNE KK ++    +S +            
Sbjct: 193  RNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKIRANTTSSSAASRTSIASDQHPI 252

Query: 250  XXXHLILGSPSKSNNMISPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSKRSASNIS 309
               +  L SP  +  +++                                  K  A  + 
Sbjct: 253  LTANSTLSSPKSA--LMTSASSPTSTVYSNTLNHSTTLSSVGTSTPKGHNNKKTIAGGLK 310

Query: 310  QPKSTTEVYXX--XXXXXXXTTLTDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQL 367
            +  S   +Y           T   D+TNR PI YV++I++D LT++EMKDLWVTLRTEQL
Sbjct: 311  KQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQL 370

Query: 368  DWVDAFIEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREF 427
            DWVDAFI+HQGHIAMANVLM SIYKT P E LT +LLEKENSFFKCFRVLSMLSQGL EF
Sbjct: 371  DWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLSMLSQGLYEF 430

Query: 428  TKHELMAQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHM 487
            + H LM  T+A GLFST L TRKMATEIFVCML KKN  RF+ +L  LD+KF+IGQNLHM
Sbjct: 431  STHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKKFRIGQNLHM 490

Query: 488  AHNLKKFGEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATL 547
              N KK  +YF  LTL+S+LK+ +AWLFAVE +LDGRGKMGS VGASD++KN GGENA L
Sbjct: 491  IQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNGGGENAIL 550

Query: 548  EYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENS 607
            EYCQW+M+FINHLC CSDN+NQRMLLR KLE CGI+RIMN+IK L Y+KVI+QI++Y+N+
Sbjct: 551  EYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQIELYDNN 610

Query: 608  KLDDINKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIED 667
            KLDD N  LE SNK  N++L DP SL+KNLW+ CKGT+NEKLL+SLVQHLFLSSS+LIE+
Sbjct: 611  KLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLFLSSSKLIEE 670

Query: 668  KQDATQLSKQLKLMDSLVTNVSVAST-DQESTMNMAIQRLYDAMQTDEVARRSILESRTL 726
             Q+ ++LSKQLKLMDSLVTNVSVAST D+ES MNMAIQRLYDAMQTDEVARR+ILESRTL
Sbjct: 671  NQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVARRAILESRTL 730

Query: 727  TKKLEESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXX 786
            TKKLEE QAE D LS+KL  AEHGLVGQL++EL  RDR+ AKNQR+ +QL++        
Sbjct: 731  TKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMQQLESELEELKKK 790

Query: 787  XXXXXXXXXXXXRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLN 846
                        RKMLTILN+R ++       SK  K I  S  SS+K NIQKVLQ+GL+
Sbjct: 791  HLLEKHQQEVELRKMLTILNSRPEESS---DLSKGTKDINPSLNSSEKANIQKVLQDGLS 847

Query: 847  RTKKDFTMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFXXXXXXXXXXXX 906
            R KKD+  DSK FGMT+QPNKRLK LRMQME+IENEAR+LEMTNFAEF            
Sbjct: 848  RAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLEPPIEIK 907

Query: 907  XXXXXXXXXXXXXXXXXXXXXXXXX----RQTLANIQNESNDISKFNVEERVNELFNEKR 962
                                         R+ LA IQ ESNDISKFNVEERVNELFNEK+
Sbjct: 908  KPKIKHKKHKIKKSSVKTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVNELFNEKK 967

Query: 963  STALQRLKELETKYKDFGINFNIDDISE--KTTGIDNSGDKSTEYSSLDPNAYQIKLDEL 1020
            S AL+RLKELETKYK FGI+FN+++  E  K   +D   D +  Y SLDP AYQ KLDE+
Sbjct: 968  SLALKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDAA--YPSLDPKAYQSKLDEI 1025

Query: 1021 NRITEQLLDAQAKLNEKNLKDXXXXXXXXXXXXXXXXXXXXXXXXXXXDEEEIDDIKSRD 1080
            NRIT++LLD Q ++ ++  +D                                D   S++
Sbjct: 1026 NRITDELLDLQTQVKQETEEDEDEETKSSSSSSDADDDEIYQ-----------DASPSQE 1074

Query: 1081 RQSEISAQSTSSAAGSFLEALSQKYAMGQN-NPSSPQRDRPVKAS-----QYDFINRVRK 1134
            R+ E S  S  S  GSFL+ALSQKY  GQN   S+  RD           +  FINR+RK
Sbjct: 1075 RRGEYSELSAGSGPGSFLDALSQKYGTGQNVTASAGLRDNRGSGHMPSNVEKSFINRLRK 1134

Query: 1135 NNITPQ-FLEELSGKV 1149
            +  +   +LEEL+ KV
Sbjct: 1135 STASSAPYLEELTQKV 1150

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/616 (64%), Positives = 487/616 (79%), Gaps = 24/616 (3%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            FE YPRPHKKLKQLHWEK+++TDNSIW + KAE+FADDLYEKGVL++LE AFAAREIKSL
Sbjct: 1345 FEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1404

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
            A+K+K+DLQK+TFLS D+SQQFGINLHMY+SL V DL+ KILKCDRDFLQTPSV+EFLS+
Sbjct: 1405 ATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCDRDFLQTPSVVEFLSK 1464

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
            PEI +VSVNLARNYAPY  DWEGI+++EDAKPPEK+PN+LQRADQIYLQLMVNL+ YWGS
Sbjct: 1465 PEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQIYLQLMVNLEQYWGS 1524

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RMRAL V+T++EKEYNELL KLRKVDRAV +LQES+NL+NVF VILAVGN+MNDTSKQAQ
Sbjct: 1525 RMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVILAVGNFMNDTSKQAQ 1584

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GFKL+TLQRLTFIKD+ N+MTFLNYVEKI+R NYP+FN FL ELEPVLDVVK+SIEQLV+
Sbjct: 1585 GFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELEPVLDVVKVSIEQLVN 1644

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DCK+FSQSIVNVERS+EIGNLSDSSKFHP D+VL K LP LP+AR+KG+LL DEVKLTIM
Sbjct: 1645 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLEDEVKLTIM 1704

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LMQ YGEDSG               + EYK+AQ+QNL  EEEE++YE+HKKMVEEQ
Sbjct: 1705 EFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAAEEEERLYEKHKKMVEEQ 1764

Query: 1766 QRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRALV 1825
            Q++AQ+ E  R +S      ++E+   D RA+MD LLEQLKN  P  K+DPSSARKRALV
Sbjct: 1765 QKRAQDKEKHREHSALPEGNEEEET-EDRRAVMDKLLEQLKNAGPA-KSDPSSARKRALV 1822

Query: 1826 RKKLMG--ESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMANTT--------LESELDV 1875
            RKK +   ++++ +L D++ E+ SI+YSP+A  P   TV  A +         + +  D+
Sbjct: 1823 RKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAESPTPLATRGFMNTPEDL 1882

Query: 1876 SSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLLNEHKEXXXXX 1935
             SP++ ++            E++EEI +RA+ LL +L GS +P K++S+L+EH E     
Sbjct: 1883 PSPSKASAL-----------EDQEEITDRARMLLKELRGSDAPVKQNSILDEHLEKLRAR 1931

Query: 1936 XXXTTNEFVSG-KLQF 1950
                  E  +G KL F
Sbjct: 1932 KERANGETNTGNKLSF 1947

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/1097 (51%), Positives = 710/1097 (64%), Gaps = 67/1097 (6%)

Query: 68   STSSLHSS-NEIKPLIKNTTLNTQNLSQYINSKNI--PD-----HXXXXXXXXXXXXXXX 119
            + SS H S ++ +PL K +TLN+QNLSQY+N+     P+     H               
Sbjct: 63   AVSSRHGSIDQSRPLNKKSTLNSQNLSQYVNNGKALSPESGSNHHRTDSTQSGFKYSYSR 122

Query: 120  XXXXXXXTNPSVTG-YKLDRQYTNQS-SAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPS 177
                     PS  G   L R  TN S S+ SVLS GS +NLS+FMT DGK+NL MP+DP 
Sbjct: 123  RSSGQVSMAPSSMGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPY 182

Query: 178  EIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKS--KGAKAS 235
            E+E L+++IM KRNILQSLP  KQ+ELMSY I KKWLIVKQDLQNE+K+ K+  KG   +
Sbjct: 183  EVESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRT 242

Query: 236  HSIGPDXXXXXXXXXXXHLILGSPSKSNNMISPKXXXXXXXXXXXXXXXXXXXXXXXXXX 295
                PD              LGS         P                           
Sbjct: 243  GMSMPD--------------LGS--------DPSNSVSPPGPISSSGSSIFSSDVTSTAP 280

Query: 296  XXXXPSKRSASNISQP--KSTTEVYXXXXXXXXXTTL-TDKTNRLPIEYVKKIISDTLTS 352
                 S +    IS+P   ++TE+Y         +T+ +DK NR PI YVKKI+ D L+ 
Sbjct: 281  STYSRSGKKNIPISKPIAATSTELYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSK 340

Query: 353  EEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFK 412
            +EMKDLWVTLRTEQLDWVDAF+E+QGHIAMAN+LMKSIYKTTP +K++  LL+KEN+FFK
Sbjct: 341  DEMKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFK 400

Query: 413  CFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVIL 472
            CFRVL++LSQGL EFT H LM  TIA+GLFS  L+TRKMATEIFV +L KKN +RF+ +L
Sbjct: 401  CFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVL 460

Query: 473  NVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVG 532
            + LD+ F IGQN HM  + KK  +YF  LT +SNLKV +AWLFAVE +LDGRGKMGS VG
Sbjct: 461  SSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVG 520

Query: 533  ASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSL 592
            AS+DYKN+GGENA LEYCQW+M+FINHLC  S+NINQR LLR KLE CGI+RIMN+IK L
Sbjct: 521  ASEDYKNAGGENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLL 580

Query: 593  HYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLIS 652
             YEKVI+QI++YEN+KLDD N LLE + KN N++L DP SL+KNL DACKGTENEK L+S
Sbjct: 581  DYEKVIDQIELYENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVS 640

Query: 653  LVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNVSVASTDQESTMNMAIQRLYDAMQT 712
            LVQH+FL +S+L+++KQD  +++KQLKLMDSLVTNVSV ST++ S +NMAIQRLYD+MQT
Sbjct: 641  LVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQT 700

Query: 713  DEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRI 772
            DEVARR+ILESRTLTKKLEE +AE D+L +KL  AEHGLVGQL+ E+++RDR+ AKNQR+
Sbjct: 701  DEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRV 760

Query: 773  TEQLQAXXXXXXXXXXXXXXXXXXXXRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESS 832
             +QL++                    RKMLTILN+R  K       +K+ K+  GS E+S
Sbjct: 761  MKQLESELEELKKKHLLEKHEQEVELRKMLTILNSRPAK-------TKEQKKKIGSIEAS 813

Query: 833  KKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFA 892
            +K+++Q+ LQ GL + KKDF  DSK FGMT+QPN+RLK LRMQME IENEAR+LEMTNFA
Sbjct: 814  EKEDLQRALQSGLQKAKKDFKDDSKKFGMTIQPNQRLKVLRMQMESIENEARKLEMTNFA 873

Query: 893  EFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQTLANIQNESNDISKFNVEE 952
            E+                                     R  L  IQ ESND+SKFNV+E
Sbjct: 874  EY----EKKGLKPPANVQKKSKPISELNKEQRIQKLNELRDKLRRIQMESNDVSKFNVDE 929

Query: 953  RVNELFNEKRSTALQRLKELETKYKDFGINFNIDDISEKTTGIDNSGDKSTEYSSLDPNA 1012
            RVNELFN+K+ TALQRLKELETKYK FGI+F ++D + ++T   N G     YSSLDP  
Sbjct: 930  RVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDSSNEG-----YSSLDPKV 984

Query: 1013 YQIKLDELNRITEQLLDAQAKLNEKNLKDXXXXXXXXXXXXXXXXXXXXXXXXXXXDEEE 1072
            YQ KLDE+ +I+E+LL  +   NE  L+                            + ++
Sbjct: 985  YQDKLDEITKISEELLQQK---NE--LETTQTSSSESNSDSESSSDSDDSMEDALTNNKD 1039

Query: 1073 IDDIKSRDRQSEISAQSTSSAAGSFLEALSQKYAMGQNNPSSPQRDRPVKASQYDFINRV 1132
            I+           S+  +  A+GSFL+ L+QKY  GQ  P           ++  F++R+
Sbjct: 1040 ING---------TSSNVSDLASGSFLDTLTQKYGTGQAEPIQSPVGHYSNRNEKSFVDRM 1090

Query: 1133 RKNNITPQFLEELSGKV 1149
            ++N+  P ++EELS K+
Sbjct: 1091 KRNSRVPSYVEELSKKM 1107

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/638 (63%), Positives = 486/638 (76%), Gaps = 15/638 (2%)

Query: 1324 MLPTNGPKKVXXXXXXXXXXXXFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADD 1383
            M+  +  KKV            FENYPRP KKLKQLHWEKVE+TDNSIW + KAE+FADD
Sbjct: 1233 MMTKDSKKKVVSSPLLPQSPSLFENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADD 1292

Query: 1384 LYEKGVLSELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLI 1443
            LYEKGVLSELE AFAAREIKSLA+++K+DLQKI+FLSHD+SQQFGINLHMY++L V   +
Sbjct: 1293 LYEKGVLSELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFV 1352

Query: 1444 TKILKCDRDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPN 1503
             K+LKC+RDF+ TPSVIEFLS+ EIV+VS NLARNYAPY  DWEGIK +EDAK PEK+PN
Sbjct: 1353 EKVLKCERDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPN 1412

Query: 1504 ELQRADQIYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENL 1563
            ELQRADQIYLQLMVNLQSYW SRMRA+++IT++E+EYNELL KL +VD+AV SLQ S+NL
Sbjct: 1413 ELQRADQIYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNL 1472

Query: 1564 KNVFGVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFN 1623
            KN+F VILAVGN+MND++KQA+GFKL+TLQRLTFIKD+ N+MTFLNYVEKIVR+NYP FN
Sbjct: 1473 KNIFNVILAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFN 1532

Query: 1624 KFLVELEPVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVL 1683
             FL+ELEPVL+VVK+SIEQLV+DC +F Q I NVERSIEIGNLSDSSKFHP D+VL KVL
Sbjct: 1533 NFLIELEPVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVL 1592

Query: 1684 PSLPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQT 1743
            P+L +ARKKGELL DE+KLTIMEF ++MQ YGED G               I EYKKAQ 
Sbjct: 1593 PNLSEARKKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQA 1652

Query: 1744 QNLRLEEEEKVYERHKKMVEEQQRKAQE-AEISRVNSGTDGTKDDEDGPGDGRAIMDTLL 1802
            QN+++EEEE  YERHKKMVEEQQRKAQE A     NS   G  D+E+   D RA+MD LL
Sbjct: 1653 QNIKVEEEEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNSDEEEESEDRRAVMDKLL 1712

Query: 1803 EQLKNVTPTNKTDPSSARKRALVRKKLMGESTSNI--LKDIDTEDDSIIYSPDAKKPMAT 1860
            EQLKN     KTDP+SARKRAL+RKK+     S    L ++    DS+IYSPDAK+ +  
Sbjct: 1713 EQLKNAGQV-KTDPTSARKRALLRKKIHSSEESESSPLAEMQVGGDSLIYSPDAKEQIEL 1771

Query: 1861 TVDMANTTLESELDVSSPTRHNS---SPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHS 1917
             + MA+ T +++ D    T  NS   SP+K    +N   E+EEIG+RA+ LL++L GS +
Sbjct: 1772 EIHMASPTPKTKEDGKLGTGENSNGESPLK---KIN---EDEEIGDRAKTLLMELRGSDA 1825

Query: 1918 PTKRHSLLNEHKEXXXXXXXXTTNEFV--SGKLQFVGE 1953
               R++ L+EHKE        T +  +  S +L+FV E
Sbjct: 1826 LMDRNTALDEHKERLRARRKRTDSNKIPSSNRLKFVDE 1863

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/966 (55%), Positives = 644/966 (66%), Gaps = 43/966 (4%)

Query: 79   KPLIKNTTLNTQNLSQYINSKNIPDHXXXXXXXXXXXXXXXXXXXX-XXTNPSVTGYKLD 137
            KPL K +TLNTQNLSQY+      DH                        + S +  +L 
Sbjct: 83   KPLNKKSTLNTQNLSQYM------DHARSSSTNSASASKYSSSRRSSTQVSTSESLRRLS 136

Query: 138  RQYTNQSSAVSVLSQ-GSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQSL 196
            RQ+T QSS+ S+ SQ  SY N SKF+T DGK NLEMP DP EIE L++EIM KRNILQ+L
Sbjct: 137  RQHTGQSSSASIHSQNSSYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQNL 196

Query: 197  PGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKS--KGAKASHSIGPDXXXXXXXXXXXHL 254
               KQ ELM+YD+ KKWLIVKQD+QNE+K+ ++   G K S  +  +             
Sbjct: 197  SVEKQRELMNYDVRKKWLIVKQDIQNEFKRIRATKNGPKNSSLVNVEQ------------ 244

Query: 255  ILGSPSKSNNMISPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSKRSASNISQPKST 314
            ++ SP+ +    +                                P+      +++  ++
Sbjct: 245  LVYSPTTTTTNNNNNNNNSNYNNTSPMASVASNEYYPMTSPQTKKPTSHELYQLTESNAS 304

Query: 315  TEVYXXXXXXXXXTTLTDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFI 374
            T            T  +DKTNR P  YV+KII+D L+ +EM+DLWVTLRTEQLDWVD+F+
Sbjct: 305  T-----------STLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFL 353

Query: 375  EHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMA 434
            E+QGHIAMAN+LMK IYKTTP + L+S+LLEKENSFFKCF+VLSMLSQG+ EF+KH+LM 
Sbjct: 354  ENQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMT 413

Query: 435  QTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKF 494
             TIARGLFST L TRKMA EIFVCML K+N  RF+ ILN LDQ F+IG N HM  NLKK 
Sbjct: 414  DTIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKL 473

Query: 495  GEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSM 554
             +YF  LT DS+LKV +AWLF++E+++DGRGKMGS VGAS D KNSGGENA LEYC W+M
Sbjct: 474  PQYFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTM 533

Query: 555  IFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINK 614
            +F+N LC  S  I QRMLLR KLE  G +RIMN+IK L+YEKVI++I+ YEN+KLDD N 
Sbjct: 534  VFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNL 593

Query: 615  LLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQL 674
            +LE  NKN+N+NL DP SL+ NLW +CKGTENEKLLISL+QHLFLSSS+LIE+  D T+L
Sbjct: 594  MLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKL 653

Query: 675  SKQLKLMDSLVTNVSVAST-DQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEES 733
            SKQLKLMDSLVTNVS +ST D+ESTMNMAIQRLYD+MQTDEVARR+ILESRTLTKKLEE 
Sbjct: 654  SKQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEL 713

Query: 734  QAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXX 793
            QAE DLL +KL  AE+GLVGQL+++L +RD++ AKNQR+T+QLQ+               
Sbjct: 714  QAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSELEELKKKHLLEKHE 773

Query: 794  XXXXXRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFT 853
                 RKMLTILN RS   +  K   K    I       K +NIQKVLQ+GL R K DFT
Sbjct: 774  HEVELRKMLTILNTRSSTNDGAKTIDKDKDNI-SKLNLQKHENIQKVLQDGLIRAKNDFT 832

Query: 854  MDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFXXXX-------XXXXXXXX 906
            +D+K FGMTVQPNKRLK LRMQMEDIENEAR+LEMTNF EF                   
Sbjct: 833  IDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKHRHK 892

Query: 907  XXXXXXXXXXXXXXXXXXXXXXXXXRQTLANIQNESNDISKFNVEERVNELFNEKRSTAL 966
                                     R+ LA IQ ESN+ISKFN+EERVNELFNEK+  AL
Sbjct: 893  KHKIEKINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKAL 952

Query: 967  QRLKELETKYKDFGINFNIDDISE-KTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITE 1025
            QRLKELETKYKDFGINF + D  E K       G    EY SLDP  Y+ KLD+++R+TE
Sbjct: 953  QRLKELETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTE 1012

Query: 1026 QLLDAQ 1031
            QLL+ Q
Sbjct: 1013 QLLNLQ 1018

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/860 (55%), Positives = 573/860 (66%), Gaps = 47/860 (5%)

Query: 313  STTEVYXXXXXXXXXTTLT-DKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVD 371
            ++ E+Y         +TL+ DKTNR P  YV+KII+D L+ +EM+DLWVTLRTEQLDWVD
Sbjct: 291  TSHELYQLTESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVD 350

Query: 372  AFIEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHE 431
            +F+E+QGHIAMAN+LMK IYKTTP + L+S+LLEKENSFFKCF+VLSMLSQG+ EF+KH+
Sbjct: 351  SFLENQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHK 410

Query: 432  LMAQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNL 491
            LM  TIARGLFST L TRKMA EIFVCML K+N  RF+ ILN LDQ F+IG N HM  NL
Sbjct: 411  LMTDTIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNL 470

Query: 492  KKFGEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQ 551
            KK  +YF  LT DS+LKV +AWLF++E+++DGRGKMGS VGAS D KNSGGENA LEYC 
Sbjct: 471  KKLPQYFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCL 530

Query: 552  WSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDD 611
            W+M+F+N LC  S  I QRMLLR KLE  G +RIMN+IK L+YEKVI++I+ YEN+KLDD
Sbjct: 531  WTMVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDD 590

Query: 612  INKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDA 671
             N +LE  NKN+N+NL DP SL+ NLW +CKGTENEKLLISL+QHLFLSSS+LIE+  D 
Sbjct: 591  FNLMLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDP 650

Query: 672  TQLSKQLKLMDSLVTNVSVAST-DQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKL 730
            T+LSKQLKLMDSLVTNVS +ST D+ESTMNMAIQRLYD+MQTDEVARR+ILESRTLTKKL
Sbjct: 651  TKLSKQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKL 710

Query: 731  EESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXX 790
            EE QAE DLL +KL  AE+GLVGQL+++L +RD++ AKNQR+T+QLQ+            
Sbjct: 711  EELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSELEELKKKHLLE 770

Query: 791  XXXXXXXXRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKK 850
                    RKMLTILN RS   +  K   K    I       K +NIQKVLQ+GL R K 
Sbjct: 771  KHEHEVELRKMLTILNTRSSTNDGAKTIDKDKDNI-SKLNLQKHENIQKVLQDGLIRAKN 829

Query: 851  DFTMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFXXXX-------XXXXX 903
            DFT+D+K FGMTVQPNKRLK LRMQMEDIENEAR+LEMTNF EF                
Sbjct: 830  DFTIDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKH 889

Query: 904  XXXXXXXXXXXXXXXXXXXXXXXXXXXXRQTLANIQNESNDISKFNVEERVNELFNEKRS 963
                                        R+ LA IQ ESN+ISKFN+EERVNELFNEK+ 
Sbjct: 890  RHKKHKIEKINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKL 949

Query: 964  TALQRLKELETKYKDFGINFNIDDISE-KTTGIDNSGDKSTEYSSLDPNAYQIKLDELNR 1022
             ALQRLKELETKYKDFGINF + D  E K       G    EY SLDP           +
Sbjct: 950  KALQRLKELETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDP-----------K 998

Query: 1023 ITEQLLDAQAKLNEK--NLKDXXXXXXXXXXXXXXXXXXXXXXXXXXXDEEEIDDIKSRD 1080
            I E+ LD   +L E+  NL+                                        
Sbjct: 999  IYEKKLDDIDRLTEQLLNLQKTQELREESSSSYSSSESDEENDDDEI------------- 1045

Query: 1081 RQSEISAQSTSSAAGS----FLEALSQKYAMGQNNPS--SPQRDRPVKASQYDFINRVRK 1134
                  A S+S  AGS    FLE LS+KY  GQ N +  +    R V  S+  F++R+R+
Sbjct: 1046 ----FVASSSSKPAGSGTRSFLETLSEKYGTGQKNVAMTATPNSRIVTQSEKQFLDRMRR 1101

Query: 1135 NNITPQFLEELSGKVVPPSS 1154
            ++    FL+EL+ KV P  S
Sbjct: 1102 SSTAAPFLQELTEKVAPALS 1121

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/630 (65%), Positives = 481/630 (76%), Gaps = 15/630 (2%)

Query: 1325 LPTNGPKKVXXXXXXXXXXXXFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDL 1384
            LP  G K V            FE YPR  KK+KQLHWEK+E TDNSIW   KAE+FADDL
Sbjct: 1279 LPLMGGKSVSSSPLLPQSPSLFERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDL 1338

Query: 1385 YEKGVLSELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLIT 1444
            +EKGV S LE AFAARE+KSLASK+K DL KITFLS D+SQQFGINLHMY+SL V DL+T
Sbjct: 1339 FEKGVFSNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVT 1398

Query: 1445 KILKCDRDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNE 1504
            KILKCDRDFL TPSVIEFLS+PEI +VSVNLARNY+PY  DWEG+K++EDAKPPEK+PN+
Sbjct: 1399 KILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPND 1458

Query: 1505 LQRADQIYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLK 1564
            LQRADQIYLQLMVNLQ YW SRMRALK+ITT+EKEYNELL KLRKVD+AV SLQESENL+
Sbjct: 1459 LQRADQIYLQLMVNLQPYWASRMRALKIITTYEKEYNELLLKLRKVDKAVGSLQESENLR 1518

Query: 1565 NVFGVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNK 1624
            NVF VILAVGNYMNDTSKQAQGFKL+TLQRLTFIKDSTN+MTFLNYVEKI+R NYP+FN 
Sbjct: 1519 NVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNS 1578

Query: 1625 FLVELEPVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLP 1684
            FL ELEPVL+VVKISIEQL +DCKEF QS+ NVERSIEIGNLSDSSKFHP DRVLAKVLP
Sbjct: 1579 FLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLP 1638

Query: 1685 SLPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQ 1744
            +LPD RKKG+LL DEV LT+MEF  LMQ+YGED+                I EY+KAQ Q
Sbjct: 1639 TLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQ 1698

Query: 1745 NLRLEEEEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQ 1804
            N+++EEEE+ YERHK+MVEEQQRKA+  E    N+  D  +DD+    D R  MD LLEQ
Sbjct: 1699 NIKVEEEEEAYERHKRMVEEQQRKAERKEAKNQNN-IDENEDDDQERTDRRGTMDKLLEQ 1757

Query: 1805 LKNVTPTNKTDPSSARKRALVRKKLMG--ESTSNILKDIDTEDDSIIYSPDAKKPMATTV 1862
            LKNV P+ + DPSSARKRAL RKK++   E T N++ D++TE DSIIYSPD  K + +T 
Sbjct: 1758 LKNVGPS-RADPSSARKRALARKKMLTDKEGTVNMMHDLETESDSIIYSPD-NKAIGSTP 1815

Query: 1863 DMANTTLESELDVSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRH 1922
              AN         +S  + NS+ +        D  EEEI  RA+ LL+ L G+ SP+KR+
Sbjct: 1816 FGANG--------ASSHKQNSNELSPSKGFRDDLSEEEISERAKTLLMGLRGTASPSKRN 1867

Query: 1923 SLLNEHKEXXXXXXXXTTNEFVSG--KLQF 1950
            S+L+EHKE        T N+  SG  KL+F
Sbjct: 1868 SMLDEHKEKLRARRRRTNNDLPSGSNKLKF 1897

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score =  924 bits (2389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/1206 (44%), Positives = 720/1206 (59%), Gaps = 94/1206 (7%)

Query: 1    MLRNSSNKHNANQEQGTKNNATTSGSNLFQNLKRFAXXXXXXXXXXXXXXXXXXXXXQVK 60
            ML+ S +K   +Q  G+ +  + +GS L  NLKRFA                     +V 
Sbjct: 1    MLKGSHSK--GSQGNGSDSRDSNTGSGLLSNLKRFAGSSGSQSGSQRIETSDISSPRKV- 57

Query: 61   RESIPQGSTSSLHSSNEIKPLIKNTTLNTQNLSQYINSKNIPD-----HXXXXXXXXXXX 115
              S+P    S + ++N+++PL K +T+NTQNLS Y+N K+  +     H           
Sbjct: 58   --SVP----SRVSNANDLRPLNKKSTMNTQNLSHYMNGKSSAESLSSNHSRSPSVQSSTK 111

Query: 116  XXXXXXXXXXXTNPSVTGYKLDRQYTNQSSAVSVLSQGS-YSNLSKFMTHDGKLNLEMPT 174
                       + P V    L R+ TNQS + S +     +SNL+ FMT DGK+ L+MP+
Sbjct: 112  YTYSRRSSSHLSTPGVNS-TLTREPTNQSLSSSSVLSQDSFSNLAIFMTPDGKIKLDMPS 170

Query: 175  DPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSKGAKA 234
               E+E L++++M KRNILQ+L   KQ ELM YD+ KKWLIVKQDLQN+   FK   AK 
Sbjct: 171  S-HEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQND---FKKLLAKG 226

Query: 235  SHSIGPDXXXXXXXXXXXHLILGSPSKSNNMISPKXXXXXXXXXXXXXXXXXXXXXXXXX 294
              +                L + SP  S    S                           
Sbjct: 227  VPAAHAAISSSNSDSLPSSLKVSSPRSSMTYES---------------IQQAIKFNKTNN 271

Query: 295  XXXXXPSKRSASNISQPKSTTEVYXXXXXXXXXTTLTDKTNRLPIEYVKKIISDTLTSEE 354
                 P+  + S + Q                 T  T+K NR PI YVK+II+D LT  E
Sbjct: 272  GSSSGPASNNKSKLQQ--------LSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNE 323

Query: 355  MKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCF 414
            M DLWVTLRTEQLDWVD F+EHQGHIAMANVL  SIYKT P   L+  LLEKE++FF+CF
Sbjct: 324  MNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCF 383

Query: 415  RVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNV 474
            RVLS+L+QGL E ++H +MA+T+A GLFS  L+TRKMATEIFVCML KKN  RF+ +LN 
Sbjct: 384  RVLSVLTQGLYELSRHNIMAETVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAVLNA 443

Query: 475  LDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVGAS 534
            LD+KFKIG+NLHM H +K   ++F   T DS  K+ ++WLFAVE SL+GRGKMGS VGAS
Sbjct: 444  LDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGAS 503

Query: 535  DDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHY 594
            +D+K SGGENA LEY QW+M+FINH C  +D INQR+LLR +LE  G +RIMNQ K L Y
Sbjct: 504  EDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDY 563

Query: 595  EKVIEQIDVYENSKLDDINKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLV 654
            +KV+E ++ YEN KLDD+N +LE     ++I+++D  SL+K L+D CKGTE+EKLL SLV
Sbjct: 564  DKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLV 623

Query: 655  QHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNVSVASTDQESTMNMAIQRLYDAMQTDE 714
            +HLFLS+S+L+ED QD T+LSKQL+LMDSLVTNVSV++ D+ S++NMAIQRLYD+MQTDE
Sbjct: 624  KHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDE 683

Query: 715  VARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITE 774
            VARR+ILESRTLTKKLEE+QAE D LSQKL    +GLVGQL+ E++QRD +  KNQR+T 
Sbjct: 684  VARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTL 743

Query: 775  QLQAXXXXXXXXXXXXXXXXXXXXRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKK 834
            QLQ                     RKMLTILN+R + G++ +K S   K  PG  +  KK
Sbjct: 744  QLQDELEELKKKHLLEKHEHEVELRKMLTILNSRPE-GDLSRKGSVHSKAQPGILDPDKK 802

Query: 835  QNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEF 894
              IQ+ LQ+GL +TKKD ++DSK FG+TVQPNKRLK LR+QMEDIE EARELEMTNFA+ 
Sbjct: 803  STIQQALQDGLLKTKKDLSVDSKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADH 862

Query: 895  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQTLANIQNESNDISKFNVEERV 954
                                                 R+ LA+IQ ESN +SKFNVEERV
Sbjct: 863  -NKAVLQAPVKVESSNYVRKENELRAKELKANKLSELRKALADIQKESNGVSKFNVEERV 921

Query: 955  NELFNEKRSTALQRLKELETKYKDFGIN----FNIDDISEKTTGIDNSGDKSTEYSSLDP 1010
            NELF +K+ +AL RL +LE  YK++GI+    F I D  +++   + + +     S+LDP
Sbjct: 922  NELFKQKKLSALDRLNDLENMYKEYGIDLSTHFPIQDEPQESAESEKNAEGP---STLDP 978

Query: 1011 NAYQIKLDELNRITEQLLDAQAKL-NEKNLKDXXXXXXXXXXXXXXXXXXXXXXXXXXXD 1069
             AYQ KLDE++RI+++L++ +++L N+K L+                             
Sbjct: 979  RAYQAKLDEIDRISKELIEMKSELKNDKALR-----------------------RHESPS 1015

Query: 1070 EEEIDDIKSRDRQSEISAQSTSSAAGSFLEALSQKYAMGQNNPSSPQRD-----RPVKAS 1124
            +++ DD + +D  S ++    SS   SFLE+LSQKY  G+N  +    D          S
Sbjct: 1016 KQDTDDDEIQDTGSMVNEDLQSSGTSSFLESLSQKYGTGKNATNMLTNDILNSSERKGHS 1075

Query: 1125 QYDFINRVRKNNITPQFLEELSGKVV-PPSSGLSTTTKVVDVTSGGKSETATENVLENTT 1183
            +  F+ R++K +  P +LEEL  KV   P  G++ T            E +++N+ E+  
Sbjct: 1076 RQSFMERMKKPSGVPAYLEELPLKVPKAPPLGVAET------------EDSSDNIAEDVE 1123

Query: 1184 EPVTEH 1189
            +   EH
Sbjct: 1124 KESAEH 1129

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/588 (63%), Positives = 463/588 (78%), Gaps = 27/588 (4%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            F +YPR  KKLKQLHWEK++ATDNSIW + KAE+FA DLYEKGVL +LE AFAAREIKSL
Sbjct: 1251 FSSYPRARKKLKQLHWEKLDATDNSIWSSGKAEKFAGDLYEKGVLEDLEKAFAAREIKSL 1310

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
            A+K+++DL KITFLS DVSQQFGINLHMY+ L V +L+TKILKC+RDF+ TPSV+EFLS+
Sbjct: 1311 ATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEELVTKILKCERDFMDTPSVLEFLSK 1370

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
            PEI++VS NLARNY+PY  DW+G+  VEDAK PEK+P ELQRADQ+YLQL+ NLQ YWGS
Sbjct: 1371 PEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDPAELQRADQLYLQLIYNLQPYWGS 1430

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RMRAL+VIT++E+EY+EL+TKLRKVD+AV+ +Q+S NL+NVF VILAVGNYMND++KQAQ
Sbjct: 1431 RMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTNLRNVFNVILAVGNYMNDSAKQAQ 1490

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GFKL+TLQRLTFIKD+ N+MTFLNYVEKIVR NYP+FN FL +L+PVLDVVKISIEQL+ 
Sbjct: 1491 GFKLSTLQRLTFIKDANNSMTFLNYVEKIVRDNYPSFNDFLEDLQPVLDVVKISIEQLIS 1550

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DCKEFSQSI NVERSI+IGNL+DSSKFHP D+VL KVLP LP+A K+ ELL +EVKL+IM
Sbjct: 1551 DCKEFSQSITNVERSIDIGNLNDSSKFHPLDKVLVKVLPVLPEASKRVELLDEEVKLSIM 1610

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LMQ YGEDS                I EYK+AQ QNL+ EEEE++Y+ HKKMVEEQ
Sbjct: 1611 EFESLMQRYGEDSADKFAKNSFFKKFADFINEYKRAQAQNLKAEEEERLYQTHKKMVEEQ 1670

Query: 1766 QRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRALV 1825
            Q++A+E E S   +  D ++++E    D RA+MD LLEQLKN  P  K DP SARKRA++
Sbjct: 1671 QKRAEEKERSENATEEDASEENE----DRRAMMDKLLEQLKNAGPV-KADPLSARKRAMI 1725

Query: 1826 RKKLM--GESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMANTTLESELDVSSPTRHNS 1883
            RKK++   E+ S++L  I  EDDS+IYSP                 E +  +++PT  +S
Sbjct: 1726 RKKMLNDSEAVSDVLDSIQQEDDSMIYSP-----------------EKQEGITNPTGDSS 1768

Query: 1884 -SPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLLNEHKE 1930
             SP K   + N  ++EEEI +RA+ALL+ L G  SP+KR+++LN HKE
Sbjct: 1769 QSPSKG--AANNQQDEEEITDRAKALLMGLRGGESPSKRNNVLNGHKE 1814

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/836 (58%), Positives = 597/836 (71%), Gaps = 33/836 (3%)

Query: 332  DKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIY 391
            D+TNR PI YV++I++D LT++EMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLM S+Y
Sbjct: 331  DRTNRPPIHYVQRILADKLTTDEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMNSMY 390

Query: 392  KTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKM 451
            KT P + LT +LLEKENSFFKCFRVLSMLSQGL EF+ H LM  T+A GLFST L+T+KM
Sbjct: 391  KTAPRDNLTKELLEKENSFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATKKM 450

Query: 452  ATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVTR 511
            ATEIFVCML KKN  RF+ +L  LD+KF+IGQNLHM  N KK  +YF  LTL+S+LK+ +
Sbjct: 451  ATEIFVCMLEKKNKSRFEAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQ 510

Query: 512  AWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQRM 571
            AWLFAVE +LDGRGKMGS VGASDD+KN GGENA LEYCQW+M+FINHLC CSDNINQRM
Sbjct: 511  AWLFAVEQTLDGRGKMGSLVGASDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRM 570

Query: 572  LLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHDPT 631
            LLR KLE CG++RIMN+IK L Y+KVI+QID+Y+N+KLDD N  LE +N+  N++L DP 
Sbjct: 571  LLRTKLENCGVLRIMNKIKLLDYDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPL 630

Query: 632  SLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNVSVA 691
            SL+KNLW  CKGTENEKLL+SLVQHLFLSSS+LIE+ Q++++L+KQLKLMDSLVTNVS+A
Sbjct: 631  SLLKNLWGICKGTENEKLLVSLVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVSIA 690

Query: 692  S-TDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHG 750
            S  D+ES +NMAIQRLYDAMQTDEVARR+ILESR LTKKLEE QAE D LS+KL  AEHG
Sbjct: 691  SAADEESNLNMAIQRLYDAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHG 750

Query: 751  LVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXXXXXXXRKMLTILNARSD 810
            LVGQL+DEL +RD + AKNQR+ +QL++                    RKMLTILN+R +
Sbjct: 751  LVGQLEDELHERDHILAKNQRVMQQLESELEELKKKHLLEKHQQEVELRKMLTILNSRPE 810

Query: 811  KGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNKRLK 870
            +     + ++    I  S   S+K NIQKVLQ+GL+R KKD+  DSK FGMT+QPNKRLK
Sbjct: 811  ESSDINEGTRN---IDPSLNFSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLK 867

Query: 871  ALRMQMEDIENEARELEMTNFAEFXXXX----XXXXXXXXXXXXXXXXXXXXXXXXXXXX 926
             LRMQME+IENEAR+LEMTNFAEF                                    
Sbjct: 868  MLRMQMENIENEARQLEMTNFAEFEKERLEPPIQIKKPKLKKNKHKDKNFLARAQEADMN 927

Query: 927  XXXXXRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGINFNID 986
                 R+ LA+IQ ESN+ISKFNVEERVNELFNEK+S AL+RLKELETKYK FGI+FN++
Sbjct: 928  KLNDLRRALADIQMESNNISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVE 987

Query: 987  DISE--KTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQLLDAQAKLNEKNLKDXXX 1044
             I E  K   + +  +    YSSLDP AYQ KLDE+NRIT++LLD Q +  ++  ++   
Sbjct: 988  KIMESPKKLSVADEREGDARYSSLDPKAYQKKLDEINRITDELLDLQTQTKQETKEE--- 1044

Query: 1045 XXXXXXXXXXXXXXXXXXXXXXXXDEEEIDDIKSRDRQSEISAQSTSSAAGSFLEALSQK 1104
                                    D     +I+S +  SE+SA    S  GSFL+ALSQK
Sbjct: 1045 ---ENGKSSFSSSSSDADDDEVYQDASPTHEIRSEN--SELSA---GSGPGSFLDALSQK 1096

Query: 1105 YAMGQN-NPSSPQRDR---------PVKASQYDFINRVRKNNI-TPQFLEELSGKV 1149
            Y  GQN   S+  RD          P K  +  F+NR++++ + +  +LEEL+ KV
Sbjct: 1097 YGTGQNVTASAGLRDSGYVSGLGHTPSKVEK-TFMNRLKRSTVNSAPYLEELTQKV 1151

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/617 (64%), Positives = 482/617 (78%), Gaps = 24/617 (3%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            FE YPRPHKKLKQLHWEK+++TDNSIW + KAE+FADDLYEKGVL++LE AFAAREIKSL
Sbjct: 1341 FEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVLADLEKAFAAREIKSL 1400

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
            A+K+K+DLQKITFLS D+SQQFGINLHMY+SL VPDL+ K+L CDRDFLQTPSV+EFLS+
Sbjct: 1401 ATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCDRDFLQTPSVVEFLSK 1460

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
             EI++VSVNLARNYAPY  DWEG++N++DAKPPEK+PN+LQRADQ+YLQLM+NL+SYWGS
Sbjct: 1461 TEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQVYLQLMINLESYWGS 1520

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RMRAL V+T++E+EYNELL KLRKVD+AV +LQ S+NL+NVF VILAVGN+MNDTSKQAQ
Sbjct: 1521 RMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVILAVGNFMNDTSKQAQ 1580

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GFKL+TLQRLTFIKD+TN+MTFLNYVEKI+R NYP FN FL ELEPVLDVVK+SIEQLV+
Sbjct: 1581 GFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELEPVLDVVKVSIEQLVN 1640

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DCK+FSQSIVNVERS+EIGNLSDSSKFHP D+VL K LP LP+AR+KG+LL DEVKLTIM
Sbjct: 1641 DCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARRKGDLLKDEVKLTIM 1700

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LMQ YGEDSG               I EYKKAQ QNL  EEEE++YE+HKK+VEEQ
Sbjct: 1701 EFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAGEEEERLYEKHKKLVEEQ 1760

Query: 1766 QRKAQEAEISRVNSGTDGTK-DDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRAL 1824
            Q+KAQE E  +  S +   + ++ED   D R +MD LLEQLKN  P  KTDPSSARKRAL
Sbjct: 1761 QKKAQEKEKQKERSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAGPA-KTDPSSARKRAL 1819

Query: 1825 VRKKLMG--ESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMANTT--------LESELD 1874
            VRKK +   +S   +L D+D E+ SI+YSP+A  P   T   A +         + +  D
Sbjct: 1820 VRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAESPTPLATRGLMNTPED 1879

Query: 1875 VSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLLNEHKEXXXX 1934
            + SP++   +P          E++EEI +RA+ LL +L GS    K++S L+EH E    
Sbjct: 1880 LPSPSK---AP--------ALEDQEEISDRARMLLKELRGSEISVKQNSTLDEHLEKLRA 1928

Query: 1935 XXXXTTNEFVSG-KLQF 1950
                 ++E  +G KL F
Sbjct: 1929 RKERASSETNTGNKLSF 1945

 Score =  145 bits (367), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 100/157 (63%), Gaps = 3/157 (1%)

Query: 74  SSNEIKPLIKNTTLNTQNLSQYINSKNIPDHXXXXXXXXXXXXXXXXXXXXXXTNPSVTG 133
           +S E +PL K +TLNTQNLSQY++ K   D                        N S   
Sbjct: 77  TSIEARPLNKKSTLNTQNLSQYMSGKMSAD--VPISSQHARSHSVQSKYSYSKRNSSQAS 134

Query: 134 YKLDRQYTNQS-SAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNI 192
            KL RQ+T QS SA S+LSQGS +NLSKF T DGK++LEMP+DP E+E L+++IM KRNI
Sbjct: 135 NKLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEILFEDIMYKRNI 194

Query: 193 LQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKS 229
            QSL G KQ+ LM Y   KKWLIVKQDLQNE KK ++
Sbjct: 195 FQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRA 231

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/916 (48%), Positives = 574/916 (62%), Gaps = 52/916 (5%)

Query: 306  SNISQPKSTTEVYXXXXXXXXXTTL-TDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRT 364
            +N S     + +Y         TT+ T+K NR P  YVKKII+D LT +E+ DLWVTLRT
Sbjct: 278  TNASSKSLNSNLYSNANANSSNTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWVTLRT 337

Query: 365  EQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGL 424
            EQLDWVDAF+EHQGHIAMANVLMKS+YKTT   KLT + LE+E S+FKCFRVL ML+QGL
Sbjct: 338  EQLDWVDAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKCFRVLVMLAQGL 397

Query: 425  REFTKHELMAQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQN 484
             EFTKH +MA+T+A  LFS  L TRKMATEIFVCML KKN  RF VIL  LD+KF IG+N
Sbjct: 398  YEFTKHAIMAETVAYALFSIRLPTRKMATEIFVCMLEKKNKSRFDVILTALDKKFMIGEN 457

Query: 485  LHMAHNLKKFGEYFGPLTLDSNLKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGEN 544
            LHM   +K   + F  L  DS  K+ +AWL  +E +L GRGKMGS VGAS++ + +GGEN
Sbjct: 458  LHMMQFVKNSPQQFIHLKRDSQFKIVQAWLTGLETALQGRGKMGSLVGASEEVRAAGGEN 517

Query: 545  ATLEYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVY 604
            + LEY QW+M+FINHLC+ +D +NQR+LLR +LE  G +RIMN+ K L Y+K+  QI+ Y
Sbjct: 518  SILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQIEYY 577

Query: 605  ENSKLDDINKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQL 664
            EN KLDDIN LLE   +N  +N+ DP  +++ +WD CKGTENEK  ISL++HLFLSSS++
Sbjct: 578  ENGKLDDINNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLSSSKV 637

Query: 665  IEDKQDATQLSKQLKLMDSLVTNVSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESR 724
             +D+ D ++L+KQLKLMDSLV NVSV++ D+ES++N+AIQRLYDAMQTDEVARR+ILESR
Sbjct: 638  ADDRGDPSKLAKQLKLMDSLVANVSVSAVDEESSVNVAIQRLYDAMQTDEVARRAILESR 697

Query: 725  TLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXX 784
             LTK+LEE QAE D L QKL +   G+VG+L++EL+QRD + AKNQR+   LQA      
Sbjct: 698  QLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVNRHLQAELEELK 757

Query: 785  XXXXXXXXXXXXXXRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEG 844
                          RKMLTILNAR D   +  KS+K  K + G  +  ++ +IQK LQ+G
Sbjct: 758  KKHLLEKHEHEVELRKMLTILNARPDDENL-AKSTKVTKSVNG-LDPDRQTSIQKALQDG 815

Query: 845  LNRTKKDFTMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFXXXXXXXXXX 904
            L RT+KD ++DSK FG+TVQPNKRL+ LRM+ME IE EARELEMTNFAE           
Sbjct: 816  LQRTRKDLSVDSKRFGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEH---------- 865

Query: 905  XXXXXXXXXXXXXXXXXXXXXXXXXXXRQTLANIQNESNDISKFNVEERVNELFNEKRST 964
                                       R+ L++IQ E+N+++KFNVEERV ELFN+KR  
Sbjct: 866  --EEKQLEEPVGTGTKKKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQKRLK 923

Query: 965  ALQRLKELETKYKDFGINFNIDDISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRIT 1024
            AL+RLKELET YK FGI+FN + + E   G  +  D   E    D    Q K+DE++RI 
Sbjct: 924  ALKRLKELETTYKGFGIDFNANALLESKGGDIHWNDD--EIDGQDLQGAQEKMDEMDRIA 981

Query: 1025 EQLLDAQAKLNEKNLKDXXXXXXXXXXXXXXXXXXXXXXXXXXXDEEEIDDIKSRDRQSE 1084
             +L   + K+  +N +                                       D  SE
Sbjct: 982  NELTAMKMKVEIQNQQQHTDSSSTESSSEDDDGATGSRT----------------DTASE 1025

Query: 1085 ISAQSTSSAAGSFLEALSQKYAMGQN----NPSSPQRDRPVKASQYDFINRVRKNNITPQ 1140
             S +S  S AGSFLEALSQKY  GQN    N   P  DR     +  F NR++K+N TP 
Sbjct: 1026 FSQKSFGSGAGSFLEALSQKYGAGQNTTISNSPFPGVDRKSSNHRTSFANRMKKSNATPY 1085

Query: 1141 FLEELSGKVVPPSSGLSTTTKVVDVTSGGKSETATENVLENTTEPVTEHSFRNAVLSNDK 1200
            F +EL+ KV    S       + D +S G +E   ++ L  T+ P    S       ND 
Sbjct: 1086 F-DELTRKVAKAPS-------LNDPSSPGSNEPGDDDTLPATS-PTVPQSI------NDT 1130

Query: 1201 IDREENDTVISTTEPT 1216
            + +++N T      PT
Sbjct: 1131 VSKDKNSTSSPEAPPT 1146

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/596 (62%), Positives = 471/596 (79%), Gaps = 19/596 (3%)

Query: 1347 ENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSLA 1406
            +NYP+PHKKLKQLHWEK++AT++SIW +  AE+FA DLYEKGVL+ LE AFAAREIK+LA
Sbjct: 1257 DNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGDLYEKGVLAGLEKAFAAREIKNLA 1316

Query: 1407 SKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRP 1466
            +K+K+DL+KITFLSHD SQQFGINLHMY+ + V DL+ KILKCDRDF+QTPSVIEFLS+ 
Sbjct: 1317 TKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLVIKILKCDRDFMQTPSVIEFLSKS 1376

Query: 1467 EIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGSR 1526
            EI +VSVNLARN++PY  DW+GIK++EDAKPPEK+PN+LQRADQIYLQL+ NLQ+YWGSR
Sbjct: 1377 EITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPNDLQRADQIYLQLIFNLQAYWGSR 1436

Query: 1527 MRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQG 1586
            MRA+KVIT+++KEY EL+TKLRKVD+AV ++ +SENL N+F VILAVGN+MNDT+K+AQG
Sbjct: 1437 MRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSENLSNIFNVILAVGNFMNDTAKRAQG 1496

Query: 1587 FKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVDD 1646
            FKL+TLQRLTFIKD+ N+MTFLNYVEKI+R NYP+FN FL ELEPVL+V KISI+QLV+D
Sbjct: 1497 FKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSFNDFLKELEPVLNVTKISIDQLVND 1556

Query: 1647 CKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIME 1706
            C E+ Q++ NVERSIEIGNLSDSSKFHP DRVL KVLP LP+ARKK +LL DEV+L+IME
Sbjct: 1557 CNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKVLPVLPEARKKCDLLDDEVRLSIME 1616

Query: 1707 FLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQQ 1766
            F  LMQ YGED+G               + EYKKAQ QNL++EEEE+VYERHKKMVEEQQ
Sbjct: 1617 FENLMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQNQNLKVEEEERVYERHKKMVEEQQ 1676

Query: 1767 RKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRALVR 1826
            R+ Q    +R     +     +D   D RA+MD LL+QLKN  PT  +DPSSARKRAL+R
Sbjct: 1677 RREQTPSKNRDYVVNEDEDIADDDDQDRRAMMDKLLDQLKNAGPTT-SDPSSARKRALMR 1735

Query: 1827 KKLMG--ESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMANTTLESELDVSSPTRHNSS 1884
            +KL    ++ ++++ D+D+ +DSI+YSP+A +  +   + A+ T      V   +  N+ 
Sbjct: 1736 RKLQADKDAAAHLISDLDSNEDSIVYSPNASQDQSANAEEASPT------VHKGSNKNNK 1789

Query: 1885 PIKNEI------SMNVDE----EEEEIGNRAQALLIQLTGSHSPTKRHSLLNEHKE 1930
            P+ +++      S N D     EEEEI ++A+ LL++L+G+ +PT+R  LLN HKE
Sbjct: 1790 PVLSDLESPIKASRNADRNNENEEEEISDKAKNLLMELSGNGAPTRREELLNGHKE 1845

 Score =  115 bits (288), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (71%), Gaps = 6/103 (5%)

Query: 131 VTGYKLDRQYTN------QSSAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQ 184
           VT  +L RQ TN      QSSA SVLSQGS +NL +FM  DGK+ L+MP D  E+E L++
Sbjct: 136 VTPGQLSRQQTNHSHANSQSSAASVLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFE 195

Query: 185 EIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKF 227
           +IM KRNI+Q+LP  KQ EL +YDI KKWLIV+QDL ++ KK 
Sbjct: 196 DIMYKRNIMQTLPPEKQQELRNYDIDKKWLIVRQDLSSDLKKM 238

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/840 (51%), Positives = 549/840 (65%), Gaps = 44/840 (5%)

Query: 328  TTLTDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLM 387
            T  +DKTNRLPI YVKKII+D L+ +E+ DLWVTLRTEQLDWVDAF+++QGHIAMANVLM
Sbjct: 408  TLASDKTNRLPIHYVKKIIADQLSQDELNDLWVTLRTEQLDWVDAFLDNQGHIAMANVLM 467

Query: 388  KSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLS 447
            KS+YKT+PN  L+  LL+KE S+FKCF+VLSML+QGLREFT H L+  TIARGLFS+ L 
Sbjct: 468  KSLYKTSPNVSLSGPLLDKEQSYFKCFKVLSMLAQGLREFTDHRLITDTIARGLFSSRLP 527

Query: 448  TRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNL 507
            TRKMATEIFVCML  KN  RF  ++  LDQ F+IG N HM +NL+K  +YF  L L S L
Sbjct: 528  TRKMATEIFVCMLETKNQTRFDAVITSLDQNFQIGSNAHMVNNLQKMPDYFIHLNLQSTL 587

Query: 508  KVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNI 567
            KV +AWLFA++ +LDGRGKMGS VGASD++K   GEN+ LEYCQW+++F+N  C  S+N+
Sbjct: 588  KVVQAWLFAIDQTLDGRGKMGSLVGASDEFKRIDGENSVLEYCQWTLVFVNKFCQSSNNL 647

Query: 568  NQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINL 627
            NQRMLLR KLE  G +RIMN++K L YEK+ +QI+ YE  KLDD N LLE  NK+ANI++
Sbjct: 648  NQRMLLRTKLENAGFLRIMNKMKLLDYEKIRDQIEFYEAGKLDDFNSLLESQNKHANIDM 707

Query: 628  HDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTN 687
             +P SL++NLWDAC+GT++E LL+SLVQHLFLSS++LI++ +D TQL+KQLKL+DSLVTN
Sbjct: 708  QNPLSLLQNLWDACRGTDSENLLVSLVQHLFLSSTRLIQNNKDPTQLAKQLKLIDSLVTN 767

Query: 688  VS---VASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKL 744
            V     A  D+E+TM+M IQRL+D+MQTDEVARR+I+ESRTLTKK+EE QAE D L  KL
Sbjct: 768  VGSSVSAVADEETTMSMTIQRLFDSMQTDEVARRAIIESRTLTKKMEELQAEKDRLGDKL 827

Query: 745  KNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXXXXXXXRKMLTI 804
              AE GLVG+LQ ++R+RD + AKNQR+ +QL+                     RKMLTI
Sbjct: 828  SKAEGGLVGELQRDIRERDAILAKNQRVNKQLENELEELKRKTLMEKHEHEVELRKMLTI 887

Query: 805  LNARSDKGEIEKKSS---KKH-KRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFG 860
            +N+++     +  S+   K H  +   S  S ++  IQKVLQ+GL RTKKDFT D+K FG
Sbjct: 888  INSKASPNLAQNPSASVLKSHDPKNKESLLSEQQSKIQKVLQDGLTRTKKDFTNDAKKFG 947

Query: 861  MTVQPNKRLKALRMQMEDIENEARELEMTNFAEFXXXXX-----------XXXXXXXXXX 909
            MTVQPNKRL+ LRM++EDIENEAR+LEMTNFA+                           
Sbjct: 948  MTVQPNKRLQLLRMKVEDIENEARQLEMTNFADIEKNATPVILTKGTKKKKSKKKLKTAQ 1007

Query: 910  XXXXXXXXXXXXXXXXXXXXXXRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRL 969
                                  R  L  IQ+ESNDISKFNVEE VNELF E++  ALQRL
Sbjct: 1008 PDKKQRANQRNENQKIEALNKLRMALTAIQSESNDISKFNVEEHVNELFTERKFKALQRL 1067

Query: 970  KELETKYKDFGINFNIDDISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQLLD 1029
            ++LE+K+     NFNIDDI   T     + D   +  SLDP     KLDE+ R+T  L  
Sbjct: 1068 RDLESKFNGLNTNFNIDDIIASTEKALTATD---DGYSLDPRRADNKLDEIERLTNDL-- 1122

Query: 1030 AQAKLNEKNLKDXXXXXXXXXXXXXXXXXXXXXXXXXXXDEEEIDDIKSRDRQSEISAQS 1089
                     L D                           +E           QS++S  +
Sbjct: 1123 -------SKLHDSMKEQEQATLQSDNSSESSDSESVESDNE-------GSTVQSDVSEPT 1168

Query: 1090 TSSAAGSFLEALSQKYAMGQNNPSSPQRDRPVKASQYDFINRVRKNNITPQFLEELSGKV 1149
              S  GSFL +LSQKY  GQ  P+S     PV  +Q  F+ R+++++  P +L+ELS K+
Sbjct: 1169 VGS--GSFLASLSQKYETGQKQPNS-----PVTVNQKAFMTRLKRSSGAPLYLQELSKKI 1221

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/591 (65%), Positives = 461/591 (78%), Gaps = 17/591 (2%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            FE YPRP KKLKQLHWEK+++T+NSIW A+KAE+FADDLYEKGVLS LE AFAARE+KSL
Sbjct: 1373 FEKYPRPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSNLEKAFAAREVKSL 1432

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
            +SK K D  KITFL+ DVSQQFGINLHM+ +L V +L+TKILKCDR+ L +PSVIEFLS+
Sbjct: 1433 SSK-KGDDSKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDREVLNSPSVIEFLSK 1491

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
             E+V+VSVNLARNY+PY  DWEG+K +EDAK PEK+PNELQRADQ+Y+ LMVNLQ YW S
Sbjct: 1492 QEVVEVSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQLYMSLMVNLQPYWSS 1551

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RMRALKVITT+E+EY ELL KLRKVD+AV SLQ+SENLKNV  VILAVGNYMNDTSKQAQ
Sbjct: 1552 RMRALKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVILAVGNYMNDTSKQAQ 1611

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GFKLATLQRLTFIKD+TN+MTFLNYVEKIVR NYP FN FL EL+PVLDVVKISI+QLV 
Sbjct: 1612 GFKLATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQPVLDVVKISIDQLVS 1671

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DC+EFS S+VNVERSIEIGNLSDSSKFHP DRVL KVLP LP+ARKK +LL DEVKLT++
Sbjct: 1672 DCQEFSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARKKADLLTDEVKLTML 1731

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LMQ YGEDS                I EYKKAQ QN+  EEEE+ YERHKK+VEEQ
Sbjct: 1732 EFNNLMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEEEQQYERHKKIVEEQ 1791

Query: 1766 QRKAQEAEISRVNSGTDGTKDD-----EDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSAR 1820
            QR+ +EA     ++  D T  +     +D   D RAIMD LLEQLKN   T K DPSSAR
Sbjct: 1792 QRQGEEARKRLESASPDATNGEDTTAVDDETKDRRAIMDKLLEQLKNAG-TVKADPSSAR 1850

Query: 1821 KRALVRKKLMG--ESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMANTTLESELDVSSP 1878
            KRAL R+KL+G  ++ S +L DIDT+DDS++YSPD K+     +   + T   +L  S+P
Sbjct: 1851 KRALARRKLLGDKDAASALLHDIDTDDDSLVYSPDTKRQSVGHLIGGSPTPGDKLLGSTP 1910

Query: 1879 TRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSH-SPTKRHSLLNEH 1928
            T+  SSP          +++E++ +RA+ALL++L G   SP K+++ L+E 
Sbjct: 1911 TKELSSP-------TAGQDDEDVTDRAKALLMELRGGQSSPMKKNAFLDEQ 1954

 Score =  128 bits (322), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 101/169 (59%), Gaps = 9/169 (5%)

Query: 79  KPLIKNTTLNTQNLSQYINSKNIP----DHXXXXXXXXXXXXXXXXXXXXXXTNPS---V 131
           KPL K  T+N+QNLS Y +  +      D                       T+PS    
Sbjct: 152 KPLSKKATMNSQNLSHYTSGVSATSSDGDGGMASPEYTHSRTQSGQTSRFSYTSPSRRSS 211

Query: 132 TGYKLDRQYTNQSSAVSVLSQGSYSNL-SKFMT-HDGKLNLEMPTDPSEIEYLYQEIMIK 189
           +  KL + +T QSS  S+ SQGS S L ++F++  DGKL LEMP DP+E+E LY++IM K
Sbjct: 212 SDAKLAKYHTAQSSQNSIASQGSLSTLYNRFISPEDGKLRLEMPDDPAEVELLYEDIMYK 271

Query: 190 RNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSKGAKASHSI 238
           RNILQ+LP  KQ ELM+YD+ KKWLIVKQDLQNE KK K+K +    ++
Sbjct: 272 RNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKLKTKTSSHQQTV 320

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/836 (50%), Positives = 552/836 (66%), Gaps = 48/836 (5%)

Query: 331  TDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSI 390
            TD+ NR PI YVKKII+D LTSEEM DLWVTLRTEQLDWVDAF+EHQGHIAMANVLM +I
Sbjct: 323  TDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTI 382

Query: 391  YKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRK 450
            YK  P  +LT +L EKE+SFFKCFRVLSMLSQGL EF KH+LM+ TIA GLFS+ L+TRK
Sbjct: 383  YKCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATRK 442

Query: 451  MATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVT 510
            MATE+ VCM+ K+N  RF+V+L  LD+ F+  +NL+M H  K     +   T ++  K+ 
Sbjct: 443  MATEVLVCMIEKRNNMRFEVVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKII 502

Query: 511  RAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQR 570
            +AWL A++ +L+GRGKMGS VGASDDY+ S GENA LEYC W+M+FINHLC  S  +NQR
Sbjct: 503  QAWLIALDETLNGRGKMGSLVGASDDYR-SAGENAILEYCLWTMVFINHLCSNSSLLNQR 561

Query: 571  MLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHDP 630
            +LLR KLE  G +RIM ++K L YEK+ EQI++Y+N+KLDD N +LE  +KN+ +N+ +P
Sbjct: 562  ILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNP 621

Query: 631  TSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNVSV 690
             SL++NLW++CKG++NEKLL+SL+QHL+LSSS+L+ +K+D T+LSKQLKL+DSL+TNV+ 
Sbjct: 622  NSLIENLWESCKGSDNEKLLLSLIQHLYLSSSKLMGEKEDPTKLSKQLKLIDSLLTNVNG 681

Query: 691  ASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHG 750
            +  D+ES MN+AIQRLYD+MQTDEVARR+ILESRTLTKKLEE+ AE D LS KL NAE+G
Sbjct: 682  SMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENG 741

Query: 751  LVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXXXXXXXRKMLTILNARSD 810
            LVGQL+ +L+QRD +  KNQR+ +QL++                    RKMLTILN+R+ 
Sbjct: 742  LVGQLESDLKQRDNILEKNQRVMKQLESELEDLKKKHLLEKHEHEVELRKMLTILNSRNG 801

Query: 811  KGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNKRLK 870
                +         +  + + +KK +IQK L+  LN+TKKD + DSK FG+TVQPNKRLK
Sbjct: 802  TQNPDVDD------VTITLDPNKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLK 855

Query: 871  ALRMQMEDIENEARELEMTNFAE-----FXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 925
             LRMQMEDIENEAR+LEMTNFA+                                     
Sbjct: 856  MLRMQMEDIENEARQLEMTNFADHKRTNLKKPVIVKKEKKLRKKKKINTEEFDKENEMKT 915

Query: 926  XXXXXXRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGINFNI 985
                  R+ LA IQ+E+NDISKFNVE RVNE+F +K+  ALQRLK+LE KYKDF I F+ 
Sbjct: 916  KKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDKKLKALQRLKQLEAKYKDFEIPFD- 974

Query: 986  DDISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQ--LLDAQAKLNEKNLKDXX 1043
                E     D   D   ++S+LDP   Q K++EL+ I+++  L++  +  N  N     
Sbjct: 975  ----ELQDLDDRELDDEQQHSTLDPTYLQKKINELDEISDELYLMNYDSDANNGN----- 1025

Query: 1044 XXXXXXXXXXXXXXXXXXXXXXXXXDEEEIDDIKSRDRQSEISAQSTSSAAGSFLEALSQ 1103
                                     D +  D ++S       +     S AGSFLE+LSQ
Sbjct: 1026 ---------------TSDSSSSSEADGDGTDSMRSVSN----APSKGISEAGSFLESLSQ 1066

Query: 1104 KYAMGQNNPSSPQ-----RDRPVKASQYDFINRVRKNNITPQFLEELSGKVVPPSS 1154
            KY  GQN  SSP       +R     +  F+NR+++  +   FLEEL+ KV   SS
Sbjct: 1067 KYGTGQNAISSPTSITSPNERIASQGEKSFMNRLKRQTMAAPFLEELTQKVNDTSS 1122

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/592 (62%), Positives = 448/592 (75%), Gaps = 30/592 (5%)

Query: 1350 PRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSLASKQ 1409
            PRP KKLKQLHW+K+++TD+SIW    AE+FADDLYEKGVL  LE AFAAREIKS+ +++
Sbjct: 1272 PRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAFAAREIKSIGTRK 1331

Query: 1410 KKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRPEIV 1469
            K+DL KI+FLSHD+SQQFGINLHMY SL VP+LI K+LKCDR+ + TPSVIEFL++ EIV
Sbjct: 1332 KEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKSEIV 1391

Query: 1470 DVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQI-YLQL------MVNLQSY 1522
            +VSVNLARNYAPY  DWEG+K+++  K         QR  Q+ Y +L      MVNLQSY
Sbjct: 1392 EVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQMTYRELIKFIYNMVNLQSY 1443

Query: 1523 WGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSK 1582
            W SRMRALKVIT++E+EYNEL+TKLRKVD+AV ++Q SENLKNVF VILAVGNYMNDTSK
Sbjct: 1444 WASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSK 1503

Query: 1583 QAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQ 1642
            QAQGFKL+TLQRLTFIKD+TN+MTFLNYVEKIVR NYP+FN F+ +LEPVLDVVK+S+EQ
Sbjct: 1504 QAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQ 1563

Query: 1643 LVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKL 1702
            L+ DC EFSQSIVNVERS+EIGNLSDSSKFHP D+VL KVLP LP+A KK  LL DEVKL
Sbjct: 1564 LISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKL 1623

Query: 1703 TIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMV 1762
            TIMEF  LM+ YGED+G               ITEYKKAQ+QNL+ EEEE+ YE+HK+M+
Sbjct: 1624 TIMEFEALMKKYGEDAGDKFAKNSFFKKFADFITEYKKAQSQNLKQEEEERAYEKHKRMI 1683

Query: 1763 EEQQRKAQ-EAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARK 1821
            EEQQ K   E E SR   G  G +       D RA+MD LLE+LKN  P  K DPSSARK
Sbjct: 1684 EEQQHKQDLEEERSREVEGEPGEEQ-----SDRRAMMDKLLEKLKNAGP-GKADPSSARK 1737

Query: 1822 RALVRKKLMG--ESTSNILKDIDTEDDSIIYSPDAK-KPMATTVDMANTTLESELDVSSP 1878
            RALVRKKL+   E T++IL+DIDT DDSI+YSP+   +     + +A+ T   + D+   
Sbjct: 1738 RALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGPNDIHLASPTPSGKSDL--- 1794

Query: 1879 TRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLLNEHKE 1930
               + SP K   +  +  E+E I +RA+ALL++L GS +  KR+S L E KE
Sbjct: 1795 VLASVSPTKESTADGI-AEDEFISDRAKALLLELRGSEN-MKRNSQLEEQKE 1844

 Score =  145 bits (367), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 103/167 (61%), Gaps = 8/167 (4%)

Query: 74  SSNEIKPLIKNTTLNTQNLSQYINSKNI------PDHXXXXXXXXXXXXXXXXXXXXXXT 127
           +S E++PL K +TLNTQNLSQY++   I      P                         
Sbjct: 58  TSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYSYSRR 117

Query: 128 NPSVTG-YKLDRQYTNQS-SAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQE 185
           + + TG  KL RQ T QS  + SVLSQGSY+NL K++  DGK+NLEMP DP E+E L+++
Sbjct: 118 SSTATGPIKLSRQQTTQSLGSSSVLSQGSYTNLLKYIDSDGKINLEMPRDPHEVEALFED 177

Query: 186 IMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSKGA 232
           +M KRNI Q+LP  KQ ELMSYD+ KKW +VKQDLQNE KK  SK +
Sbjct: 178 LMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKSS 224

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/612 (61%), Positives = 462/612 (75%), Gaps = 29/612 (4%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            +  YPRP KKLKQLHW+K++ ++ SIW +  AEQFADDLYEKGVL  LE AFAAREIKSL
Sbjct: 1260 YSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLEKAFAAREIKSL 1319

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
            A+K+K+DL KI+FLS D+SQQFGINLHM+ SL V +L+ KILKC+RD + TPSVIEFLS+
Sbjct: 1320 ANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSK 1379

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
            PEI DVS+NLARNYAPY+ DWEG+K+VEDAK PEK+ + LQRADQIY+QLMVNLQSYW S
Sbjct: 1380 PEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPS 1439

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RMRA+KVIT++EKEY EL+TKLR++D AVS++Q+S+NL N+F VILAVGNYMND+SKQAQ
Sbjct: 1440 RMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQ 1499

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GFKL TLQRLTFIKDSTN+MTFLNYVEKI+R NYP FN F+ ELEPVLDVVKIS+EQLV+
Sbjct: 1500 GFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVN 1559

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DC EF+QSI+NVERS+EIGNLSDSSKFHP D+V+ KVLP LP+A KK +LL DEVKLT M
Sbjct: 1560 DCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFM 1619

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LMQ +GEDSG               I EYKKA+ QNL+ EEE + YERHK+MVEEQ
Sbjct: 1620 EFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMVEEQ 1679

Query: 1766 QRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRALV 1825
            QRKA+E E + + +G   ++  E   GD R  MD LL QLKN  P  ++DPSSARKRA++
Sbjct: 1680 QRKAKEQEKNYMETGVSDSESAE-AKGDNRGHMDKLLAQLKNAGPA-RSDPSSARKRAVM 1737

Query: 1826 RKKLMGE--STSNILKDIDTEDDSIIYSPDAKKPMATTVDMANTTLES---------ELD 1874
            RKKL+ E  STS IL D++  D SIIYSP   K + T++      L+S         E D
Sbjct: 1738 RKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMILKSPTPKSKDNLETD 1797

Query: 1875 VSSPTRHNSSPIKNEISMNVDE----------------EEEEIGNRAQALLIQLTGSHSP 1918
             +S    N +   +++  N D                 E+E I +RA+ALL++L GS +P
Sbjct: 1798 NNSDKSRNDTLTVDDVEQNTDTNAETDITDDGNSNGDGEDEVITDRAKALLMELRGSQTP 1857

Query: 1919 TKRHSLLNEHKE 1930
            +K++S L++ +E
Sbjct: 1858 SKKNSHLDDQRE 1869

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/840 (46%), Positives = 523/840 (62%), Gaps = 67/840 (7%)

Query: 331  TDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSI 390
            +DKTN  PI YV+KI+SDTL+  E+ DLWVTLRTEQLDWVDAF+EHQGHIA+AN L++ I
Sbjct: 327  SDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCI 386

Query: 391  YKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRK 450
            YKT P   L+ +L+EKE  FFKCFRVL+ML QGL EFTKH+LM  T+A GLFST +STRK
Sbjct: 387  YKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRK 446

Query: 451  MATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVT 510
            MA EI V ++NKKN +RF+ ++  LD+ F++ +NL+M   + +FG  F   + D+  K+ 
Sbjct: 447  MALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIF 506

Query: 511  RAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQR 570
            +A++ ++E +L+GRGKMGS VGASDD+K SGGENA LEYC W++IFIN LC  SD +NQR
Sbjct: 507  QAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQR 566

Query: 571  MLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHDP 630
            ++LR K E  G +R+M ++K + YEK+  Q++ YE+ KLDD N LLE+ + +A IN+ DP
Sbjct: 567  VVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDP 626

Query: 631  TSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNVSV 690
            TSL+ +LW+ CKGTENEKLL+SL+QHLFLSSS+L++DK++  +LSKQLKLMDSL+TN++ 
Sbjct: 627  TSLIGSLWEVCKGTENEKLLLSLMQHLFLSSSKLVDDKREPAKLSKQLKLMDSLMTNITA 686

Query: 691  ASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHG 750
            +  D+++ MN+AIQRLYD+MQTD+VARR+ILE+RTL+KKLEE  AE + L +KL  AE+G
Sbjct: 687  SEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENG 746

Query: 751  LVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXXXXXXXRKMLTILNARSD 810
            LVGQL+ EL QRD +  K+QR+T+QLQA                    RK+LTI+N  +D
Sbjct: 747  LVGQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHEVELRKILTIVNTNTD 806

Query: 811  K-GEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNKRL 869
                +   S KKH             NIQK L+  L+RTKKD   D K FG++VQPNKRL
Sbjct: 807  ADASLNNSSDKKH-------------NIQKALETELSRTKKDLNNDVKKFGISVQPNKRL 853

Query: 870  KALRMQMEDIENEARELEMTNFAEFXXXXXXX--------------XXXXXXXXXXXXXX 915
            + LR+QMEDIE EARELEMTNF+E                                    
Sbjct: 854  RMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNKTKKETKKKSKKKSKSSKSKEEN 913

Query: 916  XXXXXXXXXXXXXXXXRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETK 975
                            R+ LA IQ E+ND+SKFNV++RVNELF EK+  AL RL+ LE K
Sbjct: 914  NRKRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKK 973

Query: 976  YKDFGINFNIDDISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQLLDAQAKLN 1035
            YK F I+F+ +D  +               + LD NA    LD  N +T+++ D      
Sbjct: 974  YKSFEIDFDPNDFKQ---------------AQLDSNASYESLDP-NFVTKKITDI----- 1012

Query: 1036 EKNLKDXXXXXXXXXXXXXXXXXXXXXXXXXXXDEEEIDDIKSRDRQSEISAQSTSSAAG 1095
                 D                           +  E + + +      I  Q       
Sbjct: 1013 -----DRIADELDAFSGDGTSSYSSSSLSDSEKNYYESNAVPT------IGPQKGLIDGS 1061

Query: 1096 SFLEALSQKYAMGQN------NPSSPQRDRPVKASQYDFINRVRKNNITPQFLEELSGKV 1149
            SFLE+LS+KY   QN      +P SPQ +R     +  F+NR ++   + QFLEELS KV
Sbjct: 1062 SFLESLSEKYGTAQNTEGTSLSPLSPQ-NRIASLGEKSFMNRFKRKPSSMQFLEELSQKV 1120

 Score =  134 bits (337), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 102/182 (56%), Gaps = 25/182 (13%)

Query: 74  SSNEIKPLIKNTTLNTQNLSQYINSK------------------------NIPDHXXXXX 109
           S +++KPL K T+LN QNLSQYIN K                        NI D      
Sbjct: 64  SMDDLKPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNH 123

Query: 110 XXXXXXXXXXXXXXXXXTNPSVTGYKLDRQYTNQS-SAVSVLSQGSYSNLSKFMTHDGKL 168
                            ++ S    +L RQ TN S S  SV SQGSY+NLSK+M  +G+L
Sbjct: 124 NRSASVQSSAKYSYSRRSSNSTAATRLSRQSTNFSGSTPSVFSQGSYANLSKYMDSNGRL 183

Query: 169 NLEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFK 228
           NL+MPTD  EIE L++E+M KRNILQ+L   KQ ++M+YD  KKW+IVKQDLQNE K+ K
Sbjct: 184 NLDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRIK 243

Query: 229 SK 230
            K
Sbjct: 244 LK 245

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/855 (48%), Positives = 540/855 (63%), Gaps = 52/855 (6%)

Query: 332  DKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIY 391
            D+TNRLP +Y+K+I++D L+ +EM DLWVTLRTEQL WV+ F+E QGHIAMAN LMKSIY
Sbjct: 416  DRTNRLPNDYIKEILNDRLSVDEMNDLWVTLRTEQLTWVNTFLEDQGHIAMANSLMKSIY 475

Query: 392  K-TTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRK 450
            +  T    L++ L++KE +FFKCFRVLSMLSQGL EF KH+LM  T+ +GLFST L+TRK
Sbjct: 476  RINTMQNSLSTYLIDKEYNFFKCFRVLSMLSQGLTEFIKHKLMTDTLVQGLFSTRLATRK 535

Query: 451  MATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPL--TLDSNLK 508
            +ATEIFV ML K N +   ++L   D+ F I +NL+M + LK   + +  L  T  + +K
Sbjct: 536  IATEIFVLMLQKINDDGLNILLTTFDKTFSINENLNMVYLLKNVPDKYHYLNSTNTTQIK 595

Query: 509  VTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNIN 568
            V  +WL+AVE +LDGRGKMGS VGAS D+K +GGENA LEYCQW+M+ IN LC  S  IN
Sbjct: 596  VLVSWLYAVESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVLINRLCNASTIIN 655

Query: 569  QRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLH 628
            QR+LLR KLE  G +RIMN++K L YEK+ EQ++ YEN KLDD+N LLE   K++ ++L 
Sbjct: 656  QRVLLRTKLENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLLEQDTKSS-VDLD 714

Query: 629  DPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNV 688
            +P SL+ +L + CK TE E+ L S++QHL+LSSS+L +DK D T+LSKQLKLMDSL+T+ 
Sbjct: 715  NPISLLSHLLEVCKDTEGEQSLTSIIQHLYLSSSKLFDDKDDPTKLSKQLKLMDSLMTDA 774

Query: 689  SVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAE 748
            ++++ D ES MNMAIQ LYD+M TD+VARR+ILESR LTKKLEE QAE D LS +L  AE
Sbjct: 775  TLSTVDNESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQAERDFLSNRLSEAE 834

Query: 749  HGLVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXXXXXXXRKMLTILNAR 808
            +GLVG+L++EL QRD + AKNQR+T+QL+                     RKMLTILN+R
Sbjct: 835  NGLVGKLENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHEVELRKMLTILNSR 894

Query: 809  SD----------------KGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDF 852
             +                K EIEK    K K++           I+K LQ+GL +TKKD 
Sbjct: 895  PETELDNTMSSISRTKRNKHEIEKLELLKRKKV-----------IEKALQDGLQKTKKDL 943

Query: 853  TMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFA----------EFXXXXXXXX 902
            ++DSK FG+TVQPNKRL+ALR+QMEDIENEAR+LEMTNF           E         
Sbjct: 944  SLDSKRFGITVQPNKRLQALRLQMEDIENEARQLEMTNFTDPVRTPKKGQEKRDSHNKHP 1003

Query: 903  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQTLANIQNESNDISKFNVEERVNELFNEKR 962
                                         R+ LA+IQ E+NDIS+FNVEE VNELFN K+
Sbjct: 1004 SLKPGIPIAKKNKDRSEEMAKKQQKLAELRKALADIQQETNDISRFNVEEHVNELFNAKK 1063

Query: 963  STALQRLKELETKYKDFGINFNIDDISEK-TTGIDNSGDKSTEYSSLDPNAYQIKLDELN 1021
              A++RLKELET Y++FG++FN+++  EK  T        S  Y +LDPN +  K+DEL+
Sbjct: 1064 IQAMERLKELETMYQNFGVDFNMEEFLEKNNTSTKELDPDSPAYETLDPNLFIDKMDELD 1123

Query: 1022 RITEQLLDAQAKLNEKNLKDXXXXXXXXXXXXXXXXXXXXXXXXXXXDEEEIDDIKS--- 1078
            + + +L    + LN  N                              DEE  +   S   
Sbjct: 1124 KFSMKLDQLTSDLN--NTMSAKQNSLSTTNSNQISTPSSTSSSDFESDEENENTALSNNV 1181

Query: 1079 RDRQSEISAQSTSSAAGSFLEALSQKYAMGQNNPSSPQRDRPVKASQYD----FINRVRK 1134
             D  S  S QST+S   SFLE+LSQKY  GQ N S P        S Y+    F++R++K
Sbjct: 1182 NDNSSTFSHQSTTSGGSSFLESLSQKYGTGQ-NASGPMSSNTPNVSHYNPERKFMSRMKK 1240

Query: 1135 NNITPQFLEELSGKV 1149
             + TP ++ EL+ KV
Sbjct: 1241 QHATPNYIRELNQKV 1255

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/632 (61%), Positives = 473/632 (74%), Gaps = 35/632 (5%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            FE YPR  KKLKQLHWEK++ TDNSIW   KAE+FADDL+EKGVL  LE+AFAAREIKSL
Sbjct: 1436 FEKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLESAFAAREIKSL 1495

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
            ASK+K+D  KIT+LS D+SQQFGINLHM+++L V  LI KI++CDR  L TPSVI+FLS+
Sbjct: 1496 ASKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSILNTPSVIDFLSK 1555

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
             EIV+VSVNLAR+YAPY  DWEG+K+V+DAKPPEK+PNELQRADQIYLQLMVNLQSYWGS
Sbjct: 1556 QEIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQIYLQLMVNLQSYWGS 1615

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RM ALKV+T++EK+++EL+ KLR+VD AV S+Q+SENLKNVF VILAVGN+MND SKQAQ
Sbjct: 1616 RMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVGNFMNDASKQAQ 1675

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GFKLATLQRLTFIKDSTN MTFLNYVE I+R NYP FN FL EL+PVLDVVK+SIEQLV 
Sbjct: 1676 GFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLDVVKVSIEQLVR 1735

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DCKEFSQ I+NV RS+EIG LSDSSKFHP D+VL KVLP LP+A KK +LL DEVKL+IM
Sbjct: 1736 DCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKADLLSDEVKLSIM 1795

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LMQ++GEDS                I EYK+AQ QNL++EEEE++YE HKK +EEQ
Sbjct: 1796 EFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERIYENHKKRIEEQ 1855

Query: 1766 QRKAQEAEI---SRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKR 1822
            Q++ ++++    S   S TDGT+++ED   D R +MD LLEQLKNV P  KTDP+SARKR
Sbjct: 1856 QKRLEDSKKKSHSDDTSNTDGTEEEED--EDRRDVMDKLLEQLKNVGPV-KTDPTSARKR 1912

Query: 1823 ALVRKKLMG--ESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMANTTLESELDVSSPTR 1880
            A+VRKKL    E+ S ILK+ +T +DSI+YSP   K   T   ++N  L+      SPT 
Sbjct: 1913 AMVRKKLQNEKETASQILKEFETGEDSIVYSPTDSK--ITPKKVSNEYLQ------SPTP 1964

Query: 1881 HNSSPIKNEISMNV------------------DEEEEEIGNRAQALLIQLTGSHSPTKRH 1922
               S + +  S                     D+ ++EI +RA++LL +L GS +PT+++
Sbjct: 1965 GEKSSLADMTSTPNPTTITTTTDGKVTNDSSNDDLDQEIVDRAKSLLFELRGSQTPTRKN 2024

Query: 1923 SLLNEHKEXXXXXXXXTTNEFVSGKLQFVGED 1954
            S+L E KE        T+ +  S KL+FV  D
Sbjct: 2025 SVLEERKEKLRARRRNTS-DLTSNKLKFVSSD 2055

 Score =  130 bits (328), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (81%)

Query: 140 YTNQSSAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQSLPGT 199
           ++N  ++ S+LSQGS  NL KFMT DGK+NLEMP +P+E+E LY++IM KRNILQ+LP  
Sbjct: 177 HSNNPNSSSILSQGSLHNLMKFMTPDGKVNLEMPNNPAEVEALYEDIMYKRNILQNLPAD 236

Query: 200 KQDELMSYDIGKKWLIVKQDLQNEWKKFKSKG 231
           KQ ELMSYD+ KKWLIVKQDLQ+E KK +SK 
Sbjct: 237 KQRELMSYDVSKKWLIVKQDLQSELKKMRSKN 268

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/583 (61%), Positives = 445/583 (76%), Gaps = 20/583 (3%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            FE YPRP KKLKQLHWEK++  ++SIW+  KAEQFADDLYEKG+LS LE AFAAREIKSL
Sbjct: 1315 FERYPRPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGILSRLEKAFAAREIKSL 1374

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
             S++KKD  K+TFLS DVSQQFGINLHMY+SL V +++TKILKCD+DFL TPSVIEFLS+
Sbjct: 1375 TSRKKKDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCDKDFLTTPSVIEFLSK 1434

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
             EIV+VS NLARN+APY  DWEGI NV+DAKPPEK+P+ELQRAD++YL+L VNLQ YW S
Sbjct: 1435 QEIVEVSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADRLYLELFVNLQGYWSS 1494

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RMRALKVIT++EKEY++L+ KLR +D+A  ++Q+SENL+NV  VILAVGN+MND+SKQAQ
Sbjct: 1495 RMRALKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1554

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GF+LATLQRLTFIKD  N+MTFLNYVEKIVR  YP FN FL ELEPV+  VKISIEQ+  
Sbjct: 1555 GFRLATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELEPVVAAVKISIEQVSQ 1614

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DCKEFSQS++NVERS++IGNLSDSSKFHP DR L KVLP LP+ARKKG+LL DE+KLT++
Sbjct: 1615 DCKEFSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEARKKGDLLMDEMKLTLL 1674

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LM+++GED+                + EYKKAQT N++LEEEEK YER KKMVEEQ
Sbjct: 1675 EFDNLMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEEEEKAYERRKKMVEEQ 1734

Query: 1766 QRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRALV 1825
            QR+A+E+  +   +  DG  DD       R +MD LLE+LKN  P  K+DPSSARKRA+ 
Sbjct: 1735 QRRARES--NEQENSVDGNADDNTAASGDRDVMDRLLEKLKNAGP-GKSDPSSARKRAIA 1791

Query: 1826 RKKLMGESTSN--ILKDIDT---EDDSIIYSPDAKKPMATTVDMANTTLESELDVSSPTR 1880
            R+KL+  S+SN  IL + +    E  S++YSP+ +  ++ +VD + T      DV    +
Sbjct: 1792 RRKLLQGSSSNSTILDNFEIEKPEGKSLVYSPE-QVTLSNSVDHSPTP-----DV---RK 1842

Query: 1881 HNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHS 1923
                   +E+  +   E  ++ +RA+ LLI+L G  SP++R S
Sbjct: 1843 REGQSTASEVQTS---ESSDLTDRARNLLIELRGPESPSRRAS 1882

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/1096 (36%), Positives = 592/1096 (54%), Gaps = 106/1096 (9%)

Query: 79   KPLIKNTTLNTQNLSQYINSKNIPDHXXXXXXXXXXXXXXXXXXXXXXTNPSVTG--YKL 136
            KPL K +TLN  NLS Y +  +  +                       ++   T    KL
Sbjct: 71   KPLSKQSTLNIANLSAYTDVASTHNRSSSAASNSSPTKYSYSRRASQWSSNGGTAPSTKL 130

Query: 137  DRQYTNQS-SAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQS 195
             RQ TNQS S+ S+ SQGS+SNLSKF+  DG + LE P DP EIE L++E++ KRN+ QS
Sbjct: 131  SRQQTNQSISSASIFSQGSFSNLSKFVGPDGSIRLEKPRDPREIEELFEEVLYKRNVYQS 190

Query: 196  LPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSKGAKASHSIGPDXXXXXXXXXXXHLI 255
            LP + Q EL +YD+ KKWL+V+QDLQ+E KKF +     S S  P               
Sbjct: 191  LPPSAQKELNNYDLEKKWLMVRQDLQSEVKKFMNN---KSVSKSP--------------- 232

Query: 256  LGSPSKSNNMISPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSKRSASNISQPKSTT 315
              + S   ++I+P+                               +  S S    P ++ 
Sbjct: 233  -AAASTGISLIAPESPSTGHFASNSSINESL--------------AGSSRSRAQNPGTSD 277

Query: 316  EVYXXXXXXXXXTTLT-DKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFI 374
            + Y         TTL+ D ++  P  YV+KII + ++++ + DLWV+LRTEQLDWV  F+
Sbjct: 278  QFYGSNNGTSSTTTLSQDPSHLSPDYYVRKIICNNISAKRLNDLWVSLRTEQLDWVVGFL 337

Query: 375  EHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFT---KHE 431
            E QG +A+ANV++K+ Y+ +P+  L  ++L+KE ++FKC +    L +G  E       +
Sbjct: 338  EAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLKEGADEAVLSNSAK 397

Query: 432  LMAQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNL 491
            ++   I  GL S  ++TR++A+E+ V +     P  F  ++N LDQ+ +   N+H+   L
Sbjct: 398  IIISAIIEGLLSLRVATRRIASELLVSLSQWALPHGFTHVMNALDQESRFCDNVHLQARL 457

Query: 492  ------KKFGEYF-GPLTLDSN----LKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNS 540
                  K+        L  D+N    ++    W+  VE++LDGRGKMGS VGAS+D++ S
Sbjct: 458  LSQTSNKEIKNSLRSSLLADNNGDRIMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTS 517

Query: 541  GGENATLEYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQ 600
            GGENA +EY   +++ +NHLC    ++ QR +LR +L+  G+ RI+N++K L+YEKV EQ
Sbjct: 518  GGENAIMEYAYLTLLLVNHLCQTPVDVKQRTILRARLKNAGLPRILNKMKRLNYEKVDEQ 577

Query: 601  IDVYENSKLDDINKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLS 660
            + ++E+S  DD + L         IN+ DP S+ +NLWD CKGTE E+ L+SL+Q+L +S
Sbjct: 578  LAIFEDSTTDDFDTLYSQGPNGELINMQDPVSMTQNLWDLCKGTEAEEHLMSLLQNLLIS 637

Query: 661  SSQL-IEDKQDATQLSKQLKLMDSLVTNVSVASTDQESTMNMAIQRLYDAMQTDEVARRS 719
            + +L    K+D  Q +KQLKL+D+LV+NVS+AS D +S+ N AIQRLYDAMQTDE+ARR+
Sbjct: 638  TGELGGTSKEDPAQRTKQLKLIDALVSNVSMASVDLQSSFNSAIQRLYDAMQTDEIARRA 697

Query: 720  ILESRTLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAX 779
            ILE+R   K+ EE +AE + L +KL NAE GLVGQLQ+EL+QRD +  K+QR+T QLQ  
Sbjct: 698  ILENRDWVKRYEEIKAERNNLKEKLSNAEGGLVGQLQEELKQRDHILEKSQRVTAQLQHE 757

Query: 780  XXXXXXXXXXXXXXXXXXXRKMLTILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQK 839
                               RK LT LN++    ++ +   +     P   +  +   IQ+
Sbjct: 758  LDESKKKLILAKHQHEVELRKTLTALNSKGGDIQLTEDGGQ-----PKPLKPERMLAIQR 812

Query: 840  VLQEGLNRTKKDFTMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFXXXXX 899
             LQ  L +T K+ T++S   G++++PNKRL+ LR +ME+IEN+ARELEMTNF+E+     
Sbjct: 813  ALQIKLEKTSKEITVESSRLGVSLEPNKRLRLLRSRMEEIENQARELEMTNFSEYREDAD 872

Query: 900  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQTLANIQNESNDISKFNVEERVNELFN 959
                                            R+ LA++QNESNDISKFNVE R +E+F+
Sbjct: 873  KEIEMAHEGTHMYPSDVDVGTTQDSNLKLEQLRRKLASLQNESNDISKFNVEGRFHEMFS 932

Query: 960  EKRSTALQRLKELETKYKDFGINFNIDDISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDE 1019
            +++  AL RLK+LE  Y  FGIN+   D +E  +     G    +  +LDP      +DE
Sbjct: 933  DQKIQALDRLKKLENDYSGFGINY---DPAESPSLKQEQGQDVNKSRTLDPKGPNNSVDE 989

Query: 1020 LNRITEQLLDAQAKLNEKNLKDXXXXXXXXXXXXXXXXXXXXXXXXXXXDEEEIDDIKSR 1079
                T++   A A ++                                 +EE++   KS 
Sbjct: 990  SQLETDR---ANASID-------------------------SSPASESLEEEDVHLTKS- 1020

Query: 1080 DRQSEISAQSTSSAAGSFLEALSQKYAMGQNNPSSPQ----RDRPVKASQY---DFINRV 1132
                     +T    GSFLE LSQKY  GQ N S+      R+     S Y    F+NRV
Sbjct: 1021 ---------TTEEIGGSFLERLSQKYGKGQANLSNRNSVVGRENSYPGSGYHRKSFMNRV 1071

Query: 1133 RKNNITPQFLEELSGK 1148
            +K++  P +LEELSGK
Sbjct: 1072 KKSDNVP-YLEELSGK 1086

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/625 (58%), Positives = 459/625 (73%), Gaps = 29/625 (4%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            FE YPRP KKLKQLHWEK+E T NSIW+  KAE++ADDLYE+GVL++LE AFAAREIK L
Sbjct: 1307 FERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGVLAQLEKAFAAREIKLL 1366

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
            A+++K+DL K+TFLS DVSQQFGINLHMYA+L V +++ KIL+CD+DFL + SVI+FL +
Sbjct: 1367 ANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRCDKDFLGSASVIDFLLK 1426

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
            PEIV+VS NLARN+APY  +WEG+ +V++AK PEK+P ELQRADQ+YL++MVNLQ YW S
Sbjct: 1427 PEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRADQLYLEMMVNLQGYWAS 1486

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RMRALKVITT+EKEY++LLTKLR +D+AVSS+Q S+NL++VF VILAVGNYMND+SKQA 
Sbjct: 1487 RMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFEVILAVGNYMNDSSKQAH 1546

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GFKLATLQRLTFIKD  N+MTFLNYVEKI+R NY  FN FL ELEPVLDVVKIS+EQL  
Sbjct: 1547 GFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQELEPVLDVVKISVEQLAA 1606

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DC+EFSQ+IVNVERSIE+GNLSDSSKFHP+DRVL KVLP LP+ARK+ +LL DEVKLT+M
Sbjct: 1607 DCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPEARKRSDLLSDEVKLTLM 1666

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LMQ++GED+                I EYKKAQ  N+++EEEE+ YER KKMVEEQ
Sbjct: 1667 EFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNIKMEEEERAYERRKKMVEEQ 1726

Query: 1766 QRKAQ-EAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRAL 1824
             ++A+ EAE   V+ G++         G+ R +MD LLE+LKN  P  K+DPSSARKRAL
Sbjct: 1727 HKRARLEAEKGGVDDGSEAEGVTAVSRGE-RDVMDKLLEKLKNAGP-GKSDPSSARKRAL 1784

Query: 1825 VRKKLMG--ESTSNILKDIDTED-----DSIIYSPDAKKPMATTVDMANTTLESELDVSS 1877
             RKKL+    S++NIL + + ++      S++YSP+      TT+  AN    +E     
Sbjct: 1785 ARKKLLDGKRSSANILDNFEVDEAAPVNQSLVYSPE------TTLKAANAA-HAESPTPK 1837

Query: 1878 PTRHNS--------SPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLLNEHK 1929
             +R  S        +P+    S       E++ +RA+ LL +L G  S  KR  LL +H+
Sbjct: 1838 ASRQGSVAGSGATATPLLESPSKQASAGPEDVADRARNLLKELRGPES-EKRKPLLEDHR 1896

Query: 1930 EXXXXXXXXTTNEFVSG--KLQFVG 1952
            E          NE  S   KL FVG
Sbjct: 1897 E-KMRARRRRVNEGASSENKLVFVG 1920

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/848 (41%), Positives = 503/848 (59%), Gaps = 65/848 (7%)

Query: 338  PIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNE 397
            P  YV+KIISD ++++++KDLWV+LRTEQLDWV  F++ QG +A+ANVL++  +K +P+ 
Sbjct: 301  PDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDA 360

Query: 398  KLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKMATEIFV 457
             L  + L+KE +FFKC + L  L +G  E  + +L+   I  GL S  +STR++A+E+ V
Sbjct: 361  LLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTRRIASEMLV 420

Query: 458  CMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVTR------ 511
             +     P     ++  LDQ+  +  N+H+   L    +    L  D  L +TR      
Sbjct: 421  FITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDLTRDHASKK 480

Query: 512  --AWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQ 569
               WLF VE++LDGRGKMGS VGAS+D+K++GGENA LEY   +++ +N LC    ++NQ
Sbjct: 481  FEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQ 540

Query: 570  RMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHD 629
            R LLR++ + CG+ RIM +++ L+Y+K+ EQ+ ++E+   DD N ++   + N N+++ +
Sbjct: 541  RTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMEN 600

Query: 630  PTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNVS 689
            P SL++NLW++ KGT  EK L+SLVQHLF++SS++ ++  D T+ SKQLKL+DSLV+NV+
Sbjct: 601  PLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVT 660

Query: 690  VASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEH 749
            ++S D ES+ N AIQRLYD+MQTDEVARR+I+E+R LT+K EE +AE D L +KL  AE 
Sbjct: 661  MSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEG 720

Query: 750  GLVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXXXXXXXRKMLTILNARS 809
            GLVGQLQ+EL QRDR+  KNQR+TEQLQA                    RK+LTILN+R 
Sbjct: 721  GLVGQLQNELSQRDRILEKNQRVTEQLQADLEELKKKHLLEKHEHEVELRKLLTILNSRP 780

Query: 810  DKGEI--EKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSK----SFGMTV 863
                   E+++       PG   + +K  IQK LQ+ L +TKKD T +SK    + G T+
Sbjct: 781  QGSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTL 840

Query: 864  QPNKRLKALRMQMEDIENEARELEMTNFAEFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 923
            +PN+RLK LR +MEDIENEARELEMTNFA+                              
Sbjct: 841  EPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEEQTVVPALPPPAVPVLDRAPKAK 900

Query: 924  XXXXXXXX------RQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYK 977
                          RQ LA++Q ESND+SKFNVEER+NELFN+K+ +AL RLKELETKYK
Sbjct: 901  KQVKEDQVRKLRELRQRLASVQKESNDVSKFNVEERINELFNDKKLSALDRLKELETKYK 960

Query: 978  DFGINFNID-DISEKTTGI---DNSGDKSTEYSSLDPNAYQIKLDELNRITEQLLDAQAK 1033
             FGI+F  D ++S   +     ++       + SLDP     K++E+++I ++L   + +
Sbjct: 961  GFGIDFQADPELSAMLSDAPPENHHAKDGQAHPSLDPKHLSRKIEEMSKIVDELTAFKKE 1020

Query: 1034 LNEKNLKDXXXXXXXXXXXXXXXXXXXXXXXXXXXDEE-EIDDIKSRDRQSEISAQSTSS 1092
            +                                  DEE E DD          S  S ++
Sbjct: 1021 IE----------------------NGPPSSSSSSSDEELEQDD--------RASIHSGNA 1050

Query: 1093 AAGSFLEALSQKYAMGQN-NPSSPQRDRPVKASQY--------DFINRVRKNNITPQFLE 1143
            + GSFLE LSQKY  GQN  P++  R    + S Y         F+ RV+K++  P FL 
Sbjct: 1051 STGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVKKSDAAP-FLS 1109

Query: 1144 ELSGKVVP 1151
            EL+ KV P
Sbjct: 1110 ELTQKVAP 1117

 Score =  133 bits (334), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 76/156 (48%), Positives = 94/156 (60%), Gaps = 5/156 (3%)

Query: 79  KPLIKNTTLNTQNLSQYINSKNIPDHXXXXXXXXXXXXXXXXXXXXXX---TNPSVTGYK 135
           KPL K TTLNTQNLS Y++  N P H                          N    G +
Sbjct: 69  KPLSKQTTLNTQNLSSYVD-MNTPHHNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGGR 127

Query: 136 LDRQYTNQS-SAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQ 194
           L RQ TNQS S+ S+ SQGS +NL+KFM  DGK+ L+ P++P EIE L+ E+M KRN  Q
Sbjct: 128 LSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQ 187

Query: 195 SLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSK 230
           SLP   Q ELM+YD+ KKWL+VKQDLQ+E KK  +K
Sbjct: 188 SLPAAGQKELMNYDLDKKWLLVKQDLQSELKKLANK 223

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/591 (57%), Positives = 426/591 (72%), Gaps = 46/591 (7%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            FE YPRP KKLKQLHWEK++  DNSIW   +AE+FADDLYEKGVLSELE AFAAREIKS 
Sbjct: 1367 FERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAFAAREIKSF 1426

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
              ++K +  KITFLS D+SQQFGINLHMY+SL V  +++KILKCD+DFL T S IEFLS+
Sbjct: 1427 KGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQSAIEFLSK 1486

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
            PEIV+VS N+AR++APY  DWEG+ +VEDAK PEK+P+ELQR+DQ++L L+VNLQSYW S
Sbjct: 1487 PEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQLFLNLIVNLQSYWSS 1546

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RMR LK+ITT+EK+YN+L+ KLR +D+AV ++Q+SENL+NVF VILAVGNYMNDTSKQAQ
Sbjct: 1547 RMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDTSKQAQ 1606

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GFKL+TLQRLTFIKD  N+MTFLNYVE+IV  NYP+FN FL ELEPVL VVKISIEQL +
Sbjct: 1607 GFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELEPVLQVVKISIEQLAN 1666

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DC EF  ++ NVERS+EIGNLSDSSKFHP DRVLAKVLP LP+ARKK  LL DEV+L++M
Sbjct: 1667 DCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEARKKANLLADEVQLSLM 1726

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LM+++GED+                I EYK+AQ  N +++EEE+ YER K M++EQ
Sbjct: 1727 EFENLMRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFNRKIDEEERAYERRKLMIQEQ 1786

Query: 1766 QRKAQ------EAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSA 1819
            QR+A+      E   +R+++ +          GD R +MD LLE+LKN  P+ K DPSSA
Sbjct: 1787 QRRAKLVQEGDETTCARLSAIS--------ASGDDRDVMDKLLEKLKNAGPS-KGDPSSA 1837

Query: 1820 RKRALVRKKLM-GESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMANTTLESELDVSSP 1878
            RKRAL RKKLM G   S IL+ +D +D                           L  ++P
Sbjct: 1838 RKRALARKKLMGGREGSIILEGLDVDD---------------------------LQSAAP 1870

Query: 1879 TRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLLNEHK 1929
                 +P++   + +     +   +RA+ LL++L     P  R S+L+EHK
Sbjct: 1871 DVQPDTPLR---AASASPPPDPAADRARHLLLELRNGEHPESRKSMLDEHK 1918

 Score =  491 bits (1263), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 294/707 (41%), Positives = 420/707 (59%), Gaps = 26/707 (3%)

Query: 338  PIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNE 397
            P  YV+KIISD +T++E+ DLW++LRTE +DWV  FI+ QG +A+AN L+K + + + + 
Sbjct: 296  PDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDI 355

Query: 398  KLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKMATEIFV 457
                  LEKEN+++KC RVL+ L +G++E  K +L+  ++  GL S+ LSTR++ATE  +
Sbjct: 356  LHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLL 415

Query: 458  CMLNK-------KNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVT 510
             ML+           +    +L  LDQ+ K   N+H+   L +  +     T  ++  V 
Sbjct: 416  YMLSDDELKTADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHVV 475

Query: 511  ----RAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDN 566
                  WL+ +E++LDGRG+MGS VGASDDYK  GGEN  LEY  +SMI +N LC    +
Sbjct: 476  AKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK--GGENTVLEYLLYSMILLNLLCSNHPD 533

Query: 567  INQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANIN 626
            + QR LLR++L+  G+ RI+ +++ L Y  +  ++  +E++ LDD N L+  +  ++ ++
Sbjct: 534  VQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVD 593

Query: 627  LHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVT 686
            + DP +L ++ W   +GTE E  L+SL+QHLFL S    E +  A  + KQLKL+D+LVT
Sbjct: 594  MKDPAALWQDFWTQHRGTEAEGHLLSLLQHLFLWSRAFAEYRDPAESI-KQLKLLDALVT 652

Query: 687  NVSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKN 746
            NV+ +S D ES  N AIQRLYDAMQTDEVARR+ILESR LTKK EE +AE D L+ KL  
Sbjct: 653  NVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLSQ 712

Query: 747  AEHGLVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXXXXXXXRKMLTILN 806
            A++GLVGQLQ E+ Q +R+  K+ R+T+QL+                     RKMLTILN
Sbjct: 713  AQNGLVGQLQSEVEQLERILEKSNRVTDQLKGELHALKKKHLLEKHEHEVELRKMLTILN 772

Query: 807  ARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPN 866
            ++   GE    S + +   P   +  KK  IQK LQ+ L +T+KD T DSK       PN
Sbjct: 773  SKP-HGE-NGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPAPN 830

Query: 867  KRLKALRMQMEDIENEARELEMTNFAEFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 926
            +RLK LR +M+ IE EAR LEMTNFA+F                                
Sbjct: 831  RRLKMLRSKMDIIEKEARLLEMTNFADF----KKEPEEENEPKLLSPPKIQRSLRGEQVK 886

Query: 927  XXXXXRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGINFNID 986
                 R+ LA IQ ESN++SKFNVEERVNELF EK++ AL RL++LE KYK FGI+FN D
Sbjct: 887  ELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKYKGFGIDFNED 946

Query: 987  D------ISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQL 1027
                   ++  +  +D         + LDP     K++E+ +I ++L
Sbjct: 947  PELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKIEEMTKILDRL 993

 Score = 92.8 bits (229), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 60/93 (64%), Gaps = 1/93 (1%)

Query: 136 LDRQYTNQSSAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQS 195
           L RQ TNQS+  S  S  S S L K    DG L LE P DP EIE LYQE++ KRNI QS
Sbjct: 152 LTRQMTNQSN-YSASSYTSLSLLHKATDIDGTLTLEKPEDPQEIEELYQELLQKRNIPQS 210

Query: 196 LPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFK 228
           +      ELMSY I KKWL+VKQDLQ E+KK K
Sbjct: 211 VSVHGHRELMSYGIDKKWLMVKQDLQTEYKKMK 243

 Score = 37.4 bits (85), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 52/114 (45%), Gaps = 34/114 (29%)

Query: 1095 GSFLEALSQKYAMGQNNP----SSPQRDRPV-----KASQ---------YDFINRVRKNN 1136
             SFLE LSQKY  G  +     SS +  R V     + SQ           F+NR+ K  
Sbjct: 1086 ASFLETLSQKYGTGSQSGAASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSFVNRM-KRT 1144

Query: 1137 ITP---QFLEELSGKVVPP-------SSGLSTTTKVV-----DVTSGGKSETAT 1175
            ITP    FLEEL+ KV P        S G +TT + +     D+ + G+ +TA 
Sbjct: 1145 ITPTSSNFLEELTQKVSPARSQSARSSRGSATTPQSIKSDAADIFTAGQDKTAV 1198

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/621 (57%), Positives = 452/621 (72%), Gaps = 32/621 (5%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            F+ YPRP KKLKQLHWEK++  ++SIWR  KAE+FADDLYEKGVLS LE AFAAREIKSL
Sbjct: 1332 FDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIKSL 1391

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
            AS++KKD  K++FLS DVSQQFGINLHMY+SL V ++++KIL+CDRDFL TPSVI+FLS+
Sbjct: 1392 ASRKKKDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSK 1451

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
             EIV+VS NLARN+APY  DWEG+ +VE+AKPPEK+P ELQRAD++YL+L VNLQ+YW S
Sbjct: 1452 QEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSS 1511

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RMRALKVITT+EK+Y++L+ KL  +D+A  S+Q+SENL+NV  VILAVGN+MND+SKQAQ
Sbjct: 1512 RMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQ 1571

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GF+LATLQRLTFIKD  N+MTFLNYVEKI+R  YP FN FL ELEPV+  VKISIEQ+  
Sbjct: 1572 GFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQ 1631

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DC+EFSQS++NVERS++IGNLSD +KFHP DRVL KVLP+LP+ARKKG+LL DE+KLT++
Sbjct: 1632 DCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLL 1691

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LM+++GED+                + EYKKAQ  NL+LEEEE+ YER KK+VE+Q
Sbjct: 1692 EFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEEEERAYERRKKLVEDQ 1751

Query: 1766 QRKAQEAEISRVNSGTDGTKDD-EDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRAL 1824
             ++ +E+E S+    TD   D   +   + R +MD LLE+LKN  P  K+DPSSARKRA+
Sbjct: 1752 LKRTRESE-SKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGPA-KSDPSSARKRAV 1809

Query: 1825 VRKKLMGESTSN--ILKDIDTEDD---SIIYSPDAKKPMATTVDMANTTLESELDV---- 1875
             RK+L+  S+SN  IL + D ED    S++YSPD        ++ A+T+   E  V    
Sbjct: 1810 ARKRLLQGSSSNSTILDNFDIEDSDGKSLVYSPD-NNSSEVQLNEADTSPTPERRVRDSN 1868

Query: 1876 -SSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLLNEHKEXXXX 1934
             +SP  H             D    ++ +RA+ LLI+L G  SP  + S   +H+     
Sbjct: 1869 ATSPASH-------------DTGSSDLTDRARNLLIELRGPESPGVKMSA--QHQRLSKL 1913

Query: 1935 XXXXTTNEFVSG---KLQFVG 1952
                  +   SG   +L FVG
Sbjct: 1914 RARRKNDSSSSGSENRLNFVG 1934

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1110 (37%), Positives = 605/1110 (54%), Gaps = 112/1110 (10%)

Query: 79   KPLIKNTTLNTQNLSQYINSKNIPDHXXXXXXXXXXXXXXXXXXXXXXTN--PSVTGYKL 136
            KPL K +TLN  +LS Y ++    +                       +N   +V+G KL
Sbjct: 72   KPLSKQSTLNMASLSAYTDAVGAHNRSASNASVGSPTKYSYSRRASQWSNNNSAVSGSKL 131

Query: 137  DRQYTNQS-SAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEIEYLYQEIMIKRNILQS 195
             RQ TNQS S+ S+ SQGS+SNLSKF+  DG + LE P DP EIE L++E++ KRN+ QS
Sbjct: 132  SRQQTNQSMSSASIFSQGSFSNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQS 191

Query: 196  LPGTKQDELMSYDIGKKWLIVKQDLQNEWKKF-KSKGAKASHSIGPDXXXXXXXXXXXHL 254
            LP + Q EL +YD+ KKWL+V+QDLQ+E KKF  SK A                      
Sbjct: 192  LPASAQRELNNYDLEKKWLMVRQDLQSEVKKFMNSKNA---------SKSSTVVGGSSSA 242

Query: 255  ILGSPSKSN--NMISPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSKRSASNISQPK 312
            +  SPS SN  +  SP                                   S + +S+PK
Sbjct: 243  VPDSPSASNFTSSTSPNG---------------------------------SFTGLSRPK 269

Query: 313  STT-------EVYXXXXXXXXXTTLT-DKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRT 364
             +T       + Y         TTL+ D ++  P  YV+KII + ++++ + DLWV+LRT
Sbjct: 270  ISTSSVNTSEQFYSSNLGTSSTTTLSQDPSHLSPDYYVRKIICNDISAKRLNDLWVSLRT 329

Query: 365  EQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGL 424
            EQLDWV  F+E QG +A+ANV++K+ Y+ +P+  L  ++L+KE ++FKC +    L +G 
Sbjct: 330  EQLDWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLREGA 389

Query: 425  REFT---KHELMAQTIARGLFSTTLSTRKMATEIFVCMLNKKNPERFKVILNVLDQKFKI 481
             E        ++   I  GL S  ++TR++A+E+ + +     P  F  +++ LDQ+ + 
Sbjct: 390  DEAVMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHGFNHVMDALDQESRF 449

Query: 482  GQNLHMAHNL--------KKFGEYFGPLTLDSNLKVTRA---WLFAVEHSLDGRGKMGSF 530
              N+H+   L         K G    P       +V R    W+  VE++LDGRGKMGS 
Sbjct: 450  CDNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSL 509

Query: 531  VGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIK 590
            VGAS+D++ SGGENA +EY   +++ INHLC    ++ QR +LR +L+  G+ RI+N++K
Sbjct: 510  VGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMK 569

Query: 591  SLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLL 650
             L+YEKV EQ+  +++S  DD + L    +    +++ DP S+ +NLW+ CKGT+ E+ L
Sbjct: 570  LLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHL 629

Query: 651  ISLVQHLFLSSSQL-IEDKQDATQLSKQLKLMDSLVTNVSVASTDQESTMNMAIQRLYDA 709
             SL+Q+L +S+ +L  ++K D TQ +KQLKL+D+LV+NVS+AS D +S+ N AIQRLYDA
Sbjct: 630  TSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSSFNSAIQRLYDA 689

Query: 710  MQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKN 769
            MQTDE+ARR+ILE+R   K+ EE +A+ D L +KL NAE GLVGQLQDE+RQRD +  K+
Sbjct: 690  MQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKS 749

Query: 770  QRITEQLQAXXXXXXXXXXXXXXXXXXXXRKMLTILNARSDKGEIEKKSSKKHKRIPGSF 829
            QR+  QLQ                     RK LT +N+  +     +   +K    P   
Sbjct: 750  QRVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMR--DEKGSENPRPL 807

Query: 830  ESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNKRLKALRMQMEDIENEARELEMT 889
               +K  IQK LQ  L +T K+  ++SK  G++++PNKRLK LR +MEDIEN+ARELEMT
Sbjct: 808  RPERKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMT 867

Query: 890  NFAEFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQTLANIQNESNDISKFN 949
            NF+++                                     R+ LA++Q ESNDISKFN
Sbjct: 868  NFSDYQKDDIKEPEVSNEDDHKAVSESEEKAQQISALKLEELRKKLASLQQESNDISKFN 927

Query: 950  VEERVNELFNEKRSTALQRLKELETKYKDFGINFNIDD-ISEKTTGIDNSGDKSTEYSSL 1008
            VE R +E+F+ ++S AL RLK+LET YK FGINF+ D  + +   G   S D      +L
Sbjct: 928  VEGRFHEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPLGQALAGKSVSSDDKAR--TL 985

Query: 1009 DPNAYQIKLDELNRITEQLLDAQA--KLNEKNLKDXXXXXXXXXXXXXXXXXXXXXXXXX 1066
            DP      ++E++ I   L  ++A  K NE  L+                          
Sbjct: 986  DPKEALNIVEEVSNILSGLDSSKAAEKSNETPLR---------------------TATSS 1024

Query: 1067 XXDEEEIDDIKSRDRQSEISAQSTSSAAGSFLEALSQKYAMGQNNPSSPQR----DRPVK 1122
               E+E+DD K+ D+   I+A ST   + SFLE+LSQKY   QN+ S+       +    
Sbjct: 1025 DSSEDEMDD-KNGDK---IAADSTLPTS-SFLESLSQKYGGAQNSLSNRHSFAGGEINYP 1079

Query: 1123 ASQY---DFINRVRKNNITPQFLEELSGKV 1149
             S Y    F+NRV++    P +L ELSGK+
Sbjct: 1080 GSGYHRKSFMNRVKRTGAVP-YLGELSGKI 1108

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/610 (58%), Positives = 440/610 (72%), Gaps = 27/610 (4%)

Query: 1346 FENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSL 1405
            FE YPRP K+LKQLHWEK++  DNSIW   +AE+FADDLYE+GVL+ELE AFAAREIKSL
Sbjct: 1400 FEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADDLYERGVLTELEKAFAAREIKSL 1459

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
             S+ KKD  K+TFLS D+SQQFGINLHMY+SL V  ++TKILKCD+DFL T S IEFLS+
Sbjct: 1460 ISR-KKDENKVTFLSRDISQQFGINLHMYSSLTVDQIVTKILKCDKDFLNTQSAIEFLSK 1518

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
             EIV+VS+N+AR +APY  DWEG+ +VE+AK PEK+PNELQRADQ+YL L+VNLQSYW S
Sbjct: 1519 HEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPNELQRADQLYLDLIVNLQSYWNS 1578

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            RMRALK+ITT+EK+YN+L+ KLR +D+AV ++Q+SENL+NVF VILAVGNYMND+SKQAQ
Sbjct: 1579 RMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVILAVGNYMNDSSKQAQ 1638

Query: 1586 GFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
            GFKL+TLQRLTFIKD  N+MTFLNYVEKIVRTNYP F+ FL ELEPVL VVKISIEQL +
Sbjct: 1639 GFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFDVFLQELEPVLQVVKISIEQLAN 1698

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            DC EF  ++ NVERS+EIGNLSDSSKFHP DRVLAKVLP LP+ARK+  LL DEV+L++M
Sbjct: 1699 DCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVLPVLPEARKRANLLADEVQLSLM 1758

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            EF  LM+++GEDS                I EYK+AQ  N ++EEEE+ YER K M+EEQ
Sbjct: 1759 EFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQEFNKKMEEEERAYERRKIMIEEQ 1818

Query: 1766 QRKAQ---EAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKR 1822
            Q++A+   + + S    G+  +       GD R +MD LLE+LKN  P+ K DPSSARKR
Sbjct: 1819 QKRARKNIQIDTSFSRRGSSLSTSSISASGDDRDVMDRLLEKLKNAGPS-KADPSSARKR 1877

Query: 1823 ALVRKKLMG--ESTSNILKDIDTEDDSIIYS---PDAKKPMATTVDMANTTLESELDVSS 1877
            AL RKKLM   +S S IL  +D E+ + I S    D        +    +T+ +  DV  
Sbjct: 1878 ALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQSDSNPAILGSPTSTVGATADVEG 1937

Query: 1878 PTRHN---SSPIKNEISMNVDE-------------EEEEIGNRAQALLIQLTGSHSPTK- 1920
                +   S+PI  E                    +E+ + +RA+ LL +L  S   T+ 
Sbjct: 1938 LNPDHDLPSAPISAEKGSVSSALSHSSESPSKKILDEDAVTHRARNLLQELRSSDDHTED 1997

Query: 1921 RHSLLNEHKE 1930
            R SLL+EHKE
Sbjct: 1998 RKSLLDEHKE 2007

 Score =  523 bits (1347), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 307/720 (42%), Positives = 426/720 (59%), Gaps = 30/720 (4%)

Query: 332  DKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIY 391
            D ++  P  YV+KIISD +T+ E+ DLWV+LRTE +DWV  FI+ QG +A+AN L+K   
Sbjct: 286  DPSHLSPDHYVRKIISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQ 345

Query: 392  KTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKM 451
            + +    L S LLEKE +++KC RVL+ L +G++     +L+   +  GL S  L+TR++
Sbjct: 346  RESLESLLDSDLLEKETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRI 405

Query: 452  ATEIFVCMLN----KKNPERFKVI---LNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLD 504
            ATE  + ML     K     F  I   L+ LDQ+ K   ++H+   L +  +     T  
Sbjct: 406  ATETLLYMLTDDELKTADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGR 465

Query: 505  SNLKVT----RAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHL 560
            ++L V       WL+ +E++LDGRG+MGS VGAS+DYKN  GEN  LEY  +SMI IN L
Sbjct: 466  ADLHVIAKKIEQWLYVLEYTLDGRGRMGSLVGASEDYKN--GENTVLEYLLYSMILINLL 523

Query: 561  CLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSN 620
            C    +++QR LLR++L+  G+ R++ +++ L Y  +  ++  +E+  LDD N L+  S 
Sbjct: 524  CSSHPDLHQRNLLRSRLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASST 583

Query: 621  KNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKL 680
             ++++++ DP SL  N W   KGTE+E  L+SL+QHLFL SS+   +  D  + SKQLKL
Sbjct: 584  VDSSVDMKDPESLWNNFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKL 643

Query: 681  MDSLVTNVSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLL 740
            +D+LV+NV+ +S D ES  N AIQRLYDAMQTDEVARR+ILESR LTKK EE +AE D L
Sbjct: 644  LDALVSNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHL 703

Query: 741  SQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXXXXXXXRK 800
              KL  A+ GLVGQLQ E++Q  R+  K+ R+T+QL+A                    RK
Sbjct: 704  QTKLAQAQDGLVGQLQGEVQQLQRILEKSNRVTDQLKADLHDLKKKHLLEKHEHEVELRK 763

Query: 801  MLTILNARSDKGEIEKKSSKK-HKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSF 859
            MLTILN++ +    +  S    + + P   +  KK  IQK LQ+ L +T+KD T DS+ F
Sbjct: 764  MLTILNSKPNDASNDAVSPDGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRF 823

Query: 860  GMTVQPNKRLKALRMQMEDIENEARELEMTNFAEFXXXXXXXXXXXXXXXXXXXXXXXXX 919
            G    PN+RLK LR +M+DIE EA  LEMTNFAEF                         
Sbjct: 824  GTVPAPNRRLKMLRSKMDDIEKEALMLEMTNFAEF----KKETKVEDLPRLQSPPKIERN 879

Query: 920  XXXXXXXXXXXXRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDF 979
                        RQ LA IQ ESN+ISKFNVEERVNELF EK++ AL RL++LE KY+ F
Sbjct: 880  VRSEKVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSF 939

Query: 980  GINFNIDDISEKTTGIDNSGDKSTEYSS------------LDPNAYQIKLDELNRITEQL 1027
            GI+FN++      T  +  GD S   +S            LDP     K++E+ +I E+L
Sbjct: 940  GIDFNMESELLIETDREGDGDASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTKILEEL 999

 Score = 89.4 bits (220), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 98/232 (42%), Gaps = 22/232 (9%)

Query: 9   HNANQEQGTKNNATTSGSNLFQNLKRFAXXXXXXXXXXXXXXXXXXXXXQVKRESIPQGS 68
           H +N   GT       G  LF NL +                         K+ SIP   
Sbjct: 17  HFSNGHGGTNTPINGGGGGLFSNLMKLTGSSSALSQQRIATSDISSP----KKVSIP--- 69

Query: 69  TSSLHSSNEIKPLIKNTTLNTQNLSQYIN------------SKNIPDHXXXXXXXXXXXX 116
            SSL  S   KPL K++TLNT +LSQY +            S   P              
Sbjct: 70  -SSLDLST-AKPLSKHSTLNTSSLSQYADEIAQSRTPSGPVSLGSPSKYSYSKRSSQWSG 127

Query: 117 XXXXXXXXXXTNPSVTGYKLDRQYTNQSSAVSVLSQGSYSNLSKFMTHDGKLNLEMPTDP 176
                       P  + + L RQ TNQS+        S + L K    DG L+LE P  P
Sbjct: 128 GNSNKQLLLLPQPQHSQHTLSRQPTNQSNNSDNSFS-SVTLLQKITDSDGNLSLEKPKYP 186

Query: 177 SEIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFK 228
            EIE LYQE++ KRNIL S+      ELM YD+ KKWL+VKQDLQ E K+ K
Sbjct: 187 QEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELKRMK 238

 Score = 36.2 bits (82), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 20/75 (26%)

Query: 1096 SFLEALSQKYAMGQN-NPSSPQRDRPVKASQY---------------DFINRVRKNNITP 1139
            SFLE+LSQKY  G N  P+     R   +S +                F+NR++KN+ TP
Sbjct: 1110 SFLESLSQKYGTGTNLQPAEDGAKRLSSSSAFRAGDSSQRNSGYHRKSFVNRMKKNS-TP 1168

Query: 1140 Q---FLEELSGKVVP 1151
            +   F++E+S K+ P
Sbjct: 1169 KSSSFVDEVSQKMTP 1183

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/633 (54%), Positives = 447/633 (70%), Gaps = 37/633 (5%)

Query: 1328 NGPKKVXXXXXXXXXXXXFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEK 1387
            N PK              FE YPRP KKLKQLHWEK++   +SIW+  +AE+ ADDL+E+
Sbjct: 1208 NTPKATVTSPLLPQSPSLFERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFER 1267

Query: 1388 GVLSELENAFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKIL 1447
            GVLS+LE AFAARE KSL  K K+  +KITFLS DVSQQFGINLHM+++LDV D++ K++
Sbjct: 1268 GVLSQLEKAFAARETKSLKGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVM 1327

Query: 1448 KCDRDFLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQR 1507
            KCDR+FL TPSVIEFLS+P I++V+ NLAR + PY  DWEG+ +V+DAKPPEK+PNELQR
Sbjct: 1328 KCDREFLSTPSVIEFLSKPTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQR 1387

Query: 1508 ADQIYLQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVF 1567
            ADQ+Y++ M+NLQ YWGSRMRA+ +ITT+EK+Y++L+TKLRK+DRAV  +++SE+L++VF
Sbjct: 1388 ADQLYVEFMINLQPYWGSRMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVF 1447

Query: 1568 GVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLV 1627
             VILAVGNYMND+SKQAQGFKL+TLQRLTFIKD  N+MTFLNYVEKI+R NYP ++ F+ 
Sbjct: 1448 DVILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVE 1507

Query: 1628 ELEPVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLP 1687
            ELEP+  V KISIEQLV DCKEFSQS++NVERSIEIGNLSD SKFHP DRVL KV+P LP
Sbjct: 1508 ELEPIFSVTKISIEQLVTDCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLP 1567

Query: 1688 DARKKGELLGDEVKLTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLR 1747
            +ARKK +LL DE+KL+++EF  LM+ +GED+                ITE+KKA+T N++
Sbjct: 1568 EARKKADLLSDEIKLSLLEFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVK 1627

Query: 1748 LEEEEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKN 1807
            LEEEE+ YER KKM+E+QQRK QEA+ S+  +    T  +   P D R  ++ LL++LKN
Sbjct: 1628 LEEEERAYERRKKMIEDQQRKQQEAD-SKATAKNLSTSQE---PSDDRDDIEKLLDKLKN 1683

Query: 1808 VTPTNKTDPSSARKRALVRKKLM-GESTSNILKDIDTEDDSIIYSPDAKKPMATTVDMAN 1866
              P+ K DPSS RKRAL RKKL+ G+S ++I  +I T D +I             V+   
Sbjct: 1684 AAPS-KGDPSSTRKRALARKKLLDGKSGASIFDNI-TADSTI----------EAFVEQNR 1731

Query: 1867 TTLESELDVSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTG-------SHSPT 1919
            T  E      SPT   S+ +    S++  +++    +RA+ LL++L G       S SP 
Sbjct: 1732 TLTE------SPTAKKSASLPETESLSSSKQDP--ADRARNLLLELRGPDERKDASPSPI 1783

Query: 1920 KRHSLLNEHKEXXXXXXXXTTNEFVSGKLQFVG 1952
            K    L + K+          N     KLQFVG
Sbjct: 1784 KAKDKLRDLKKKDSSVKVDQPN-----KLQFVG 1811

 Score =  496 bits (1276), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 282/705 (40%), Positives = 423/705 (60%), Gaps = 39/705 (5%)

Query: 338  PIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSIYK-TTPN 396
            P  YV++IIS  + ++E+ DLWV+LRTE LDWV +F+E QG +A+AN+++ S+++ TT N
Sbjct: 268  PEYYVRQIISKKIKNKELNDLWVSLRTEPLDWVISFLEAQGQVAIANLIITSMHQDTTDN 327

Query: 397  EKLTS--QLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKMATE 454
            +   +  Q LE+E + FKC RVL  + + L E     L+   +  GL ST + TR++ATE
Sbjct: 328  QNAVTDPQFLERETALFKCLRVLLNIRECLEEAVNSTLVTNALVEGLLSTKIPTRRLATE 387

Query: 455  IFVCMLNK--------KNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLT---L 503
              + ++ K           + F +++  L+ +  + QN+HM        +   P +   L
Sbjct: 388  TLIYLVTKDEDFKSRTAGLDCFSLVMESLNHETSLVQNIHMKAKFST-NDSTDPESNPQL 446

Query: 504  DSNLKVTRAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLC 563
                K+ + WL+ VE +LDGRGKMGS VGASD+Y+N+ GEN+  EY   S++ I+ LCL 
Sbjct: 447  YQVCKILQQWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLIDQLCLN 506

Query: 564  SDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNA 623
            ++++ +R ++R +L+  G+ RI+ +++ L Y  +   +  +E++ +DD N L++      
Sbjct: 507  NEDVKKRHMMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLIDSQKFTE 566

Query: 624  NINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDS 683
            N+++ DP S+++ L  + KGTE E  L+S++Q+LFLSS++  ++  D  +  +QLKL+DS
Sbjct: 567  NVDMDDPVSILQKLTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDDPGKNVQQLKLIDS 626

Query: 684  LVTNVSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQK 743
            L++NV++ + D ES  N+AIQRLYD+MQTDE+ARR+ILESR LTKKLEE +AE D L+ K
Sbjct: 627  LISNVAITTLDSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAERDYLNDK 686

Query: 744  LKNAEHGLVGQLQDELRQRDRMFAKNQRITEQLQAXXXXXXXXXXXXXXXXXXXXRKMLT 803
            +  AE+GLVGQLQ EL +RD +  K QR+TEQLQ+                    RKMLT
Sbjct: 687  ISKAENGLVGQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIELRKMLT 746

Query: 804  ILNARSDKGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTV 863
            I+N+++   ++E  S+ ++   P      +K  IQ VLQ  L +T++D   +S+  G  V
Sbjct: 747  IVNSKT-SDDLESGSTVQND--PKPLNPERKTAIQNVLQRSLQKTEQDLLNESRRLGTAV 803

Query: 864  QPNKRLKALRMQMEDIENEARELEMTNFAEFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 923
                RLK LR +MEDIEN+ARELEMTNFA+                              
Sbjct: 804  GSKSRLKLLRSKMEDIENQARELEMTNFADV--------------KPKQNQKFKEQVKGQ 849

Query: 924  XXXXXXXXRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGINF 983
                    R+ LA IQNESNDI+KFN+E RVNELF +K+  AL RLK+LE KY  F I+F
Sbjct: 850  QATKLAELRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRLKDLENKYNGFHIDF 909

Query: 984  NID-DISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQL 1027
              D ++ E  T   N G       SLDP   Q K++E+N I ++L
Sbjct: 910  ADDPELKELLTQSSNGG------PSLDPTIVQRKVEEMNSIIDEL 948

 Score = 91.3 bits (225), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 117/246 (47%), Gaps = 40/246 (16%)

Query: 5   SSNKHNANQEQGTKNNATTSGSNLFQNLKRFAXXXXXXXXXXXXXXXXXXXXXQVKRESI 64
           SS     N+   +++ + + GS+LF NLK+ A                     Q ++E I
Sbjct: 6   SSRGPTGNENSHSRSLSNSQGSSLFSNLKKLATGGNHGSSQPS----------QTRKELI 55

Query: 65  PQG----STSSLHSSNEI---KPLIKNTTLNTQNLSQYINSKNIPDHXXXXXXXXXXXXX 117
                  +T+SL S+  I   KPL K ++LNT NLS Y                      
Sbjct: 56  SSPKRVFTTASLESATPIGGSKPLNKISSLNTHNLSHY---------------TMDPEAN 100

Query: 118 XXXXXXXXXTNPSVTGY-----KLDRQYTNQSSAVSVLSQGSYSN---LSKFMTHDGKLN 169
                    T+P+   Y     +L R  TN+S   S     S ++   L++F+T+DG L 
Sbjct: 101 SRSQSASLLTSPTKYSYSRRSSQLTRSSTNKSIISSSAVSVSSNSTSILNRFLTNDGTLK 160

Query: 170 LEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKS 229
           L+ P +P EI  L+ +++IKRN+  S+    Q ++++Y I KKWL+VKQDLQ+E+K+ KS
Sbjct: 161 LDRPENPEEINGLFMDLLIKRNVFDSVSSQDQKDMLNYPIEKKWLMVKQDLQSEFKRLKS 220

Query: 230 KGAKAS 235
              + S
Sbjct: 221 TKPRFS 226

 Score = 40.8 bits (94), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 23/115 (20%)

Query: 1092 SAAGSFLEALSQKYAMGQNNPSSPQRDRPVKASQY--------DFINRVRKNNITPQ--- 1140
            S   SFLE+LSQKY+ GQ   +S    R  + ++Y         F+NR++   + P    
Sbjct: 995  SNGSSFLESLSQKYSTGQQTATSTNGGRVGRETRYPGSGYHRKSFLNRLKNTTVNPTATS 1054

Query: 1141 -----FLEELSGKVVPPSSGLSTTTKVVDVTSGGKSETATENVLENTTEPVTEHS 1190
                 FL EL  KV         T  + DV  G     +    L++T +PV++ +
Sbjct: 1055 EHLPPFLTELKSKV-------KMTDDIDDVPVGIGISVSPGASLKSTEKPVSQFT 1102

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  319 bits (818), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 180/485 (37%), Positives = 284/485 (58%), Gaps = 26/485 (5%)

Query: 1354 KKLKQLHWEKVEATDNSIW-RANKAEQFADDLYEKGVLSELENAFAAREIKSLASKQK-- 1410
            KK+KQ+HWEK+E  +N+ W    + E+   +L   G+  ++E+ F  + +  +  K+K  
Sbjct: 818  KKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSVIMKKKKVV 877

Query: 1411 -KDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRPEIV 1469
                + I+FLS D++QQFGINLH++  L   +L++K+L+CD D L+  SV+EF  + E+ 
Sbjct: 878  SSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLEFFCKEEMT 937

Query: 1470 DVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGSRMRA 1529
             ++ +L R+  PY  D+   ++V     P KNP+ELQRAD+I+L+L  NL+SYW  R + 
Sbjct: 938  HINPSLVRHLTPYSTDYMNPESV-----PTKNPDELQRADKIFLKLSFNLRSYWNERSQC 992

Query: 1530 LKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQGFKL 1589
            L ++ T+EK+Y +LL KL+K+D A+  +  SE  KN+  +I+ +GN+MN  ++   G +L
Sbjct: 993  LLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--TRPVSGIRL 1050

Query: 1590 ATLQRLTFIK-DSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVDDCK 1648
            + L +L FIK ++ N ++FL+Y+E+++R +Y     F+ +L  V ++ KIS++Q+   C+
Sbjct: 1051 SALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISMDQVALQCE 1110

Query: 1649 EFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIMEFL 1708
            EF   I  +  +I  G LSD  K HP D++L KV   +  AR KGELLGD  KL+  +F 
Sbjct: 1111 EFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHFKLSNNDFE 1170

Query: 1709 RLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQQRK 1768
            ++M+ YGED                  T +KK   +N+  EE E+VY + KK++E   RK
Sbjct: 1171 KVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERVYAQRKKIMEASTRK 1230

Query: 1769 AQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRALVRKK 1828
                  S V+SGTD         G+  A+ D+LL QL+ V    K +P   RK   V   
Sbjct: 1231 D-----SDVDSGTDNID------GENTAV-DSLLAQLRGV--DKKPEPLRTRKSVKVVTI 1276

Query: 1829 LMGES 1833
              GES
Sbjct: 1277 KSGES 1281

 Score = 41.2 bits (95), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 102/188 (54%), Gaps = 27/188 (14%)

Query: 599 EQIDVYENSKLDDINKLLELSNKNANINLHDPT-SLVKNLWDACKGTENEKLLISLVQHL 657
           EQ+ ++++++      +LE++++ + +++  P  S+++ L +    T+ E  + SL+  L
Sbjct: 392 EQVKLFKDTE----ENILEVTSRESGVHIDSPYGSILQQLTNLTSNTQLEPQINSLLD-L 446

Query: 658 FLSSSQLIEDKQDATQLSKQLKLMDSLVTNVSVASTDQ------ESTMNMAIQRLYDAMQ 711
            L S     +K+  ++ SK L+ M+S +   S+ +++       E+    ++  L D++Q
Sbjct: 447 ILKSV----NKKTYSESSKLLQFMESFL-QYSLDNSNHNHYEHPETLFQESVNNLMDSLQ 501

Query: 712 TDEVARRSILESRTLTKKLEESQAEIDLLSQ---KLKNAEHGLVGQLQDELRQRDRMFAK 768
           +DE+A+R++LE       L+E Q+++++LS    KL+N +      + D+L+Q   +   
Sbjct: 502 SDEIAKRAMLE-------LDEKQSQMNILSNQLTKLRNEKTMDKSDILDQLKQVTDLLES 554

Query: 769 NQRITEQL 776
             R  E+L
Sbjct: 555 KDREQEKL 562

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  299 bits (765), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 159/460 (34%), Positives = 283/460 (61%), Gaps = 24/460 (5%)

Query: 1355 KLKQLHWEKVEATDNSIWRANKAEQFADD-LYEKGVLSELENAFAAREI---KSLASKQK 1410
            KL+Q+HW+ +E    + W   +  +     L E GV  E+E  F  ++    K   +K  
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAKTS 918

Query: 1411 KDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRPEIVD 1470
            ++L+K++FLS D++QQFGINLHM+++  V +L+ K+L C+ + ++  SV+EF ++ ++ +
Sbjct: 919  QNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDLTN 978

Query: 1471 VSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGSRMRAL 1530
            +S ++ +N+ PY        NV   + P K+ +EL+RAD+I+L+L  NL+SYW +RMR L
Sbjct: 979  ISQSVKKNFEPYST------NVLTGEGPTKDVSELERADRIFLELCYNLRSYWRARMRCL 1032

Query: 1531 KVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQGFKLA 1590
             ++ T+EK+Y ++L KL+K+D A  +++ S+ LK +  +I+ +GNYMN+  +QA+G KL+
Sbjct: 1033 LILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIKLS 1090

Query: 1591 TLQRLTFIKDSTNT-MTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVDDCKE 1649
            +L +L F+K STN  M+FL+Y+E+I+RT Y      + +L  +  + K++++Q+  DC+E
Sbjct: 1091 SLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDCRE 1150

Query: 1650 FSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIMEFLR 1709
            F++ I N+ERS + G+LS +  FHP D +++K    +P A++K  LL D+ KLT+ +  +
Sbjct: 1151 FNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDLEK 1210

Query: 1710 LMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQQRKA 1769
            LM   GE+                 ++ +KKA  +N+  EE E++YE+ KK++E ++R  
Sbjct: 1211 LMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLLEIKERSC 1270

Query: 1770 QEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVT 1809
               E    +  +D + ++ D        +D L+ +L+ VT
Sbjct: 1271 GNME----SQNSDESAENND-------TVDVLIHKLRGVT 1299

 Score = 49.3 bits (116), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 115/242 (47%), Gaps = 32/242 (13%)

Query: 548 EYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENS 607
           +YC  ++  IN +   + +  ++ LL  K + CGI R+  + K      + ++I  Y+  
Sbjct: 319 DYCLSTLFLINSIIQVTTSYREKELLIKKFKECGIHRMFYKTKDFGSGLLDDEIRKYKEV 378

Query: 608 KLDDINK-------LLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLS 660
           + + I +        L++S            S++K L    + T  E  L  L++ +   
Sbjct: 379 EEEVITRSSPELPTFLDISY----------GSILKTLILETRSTPLEHPLYQLLEGVLQ- 427

Query: 661 SSQLIEDKQDATQLSKQLKLMDSLVTNVSVASTDQ------ESTMNMAIQRLYDAMQTDE 714
               I   + +++  K  KL  S++  +   + D       ES +  ++ ++ D++Q+DE
Sbjct: 428 ----ISVTRTSSESIKLFKLFHSILCYLKDHTFDSDSGEGPESALKTSLNQMMDSLQSDE 483

Query: 715 VARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQ---DELRQRDRMFAK-NQ 770
           +ARR++ E  +L + +++  AE++ L ++ K  +  ++ QL+   + LR +D    + N+
Sbjct: 484 IARRAMKELNSLQETVDQLTAEVESLKEERKVTKGEVIMQLEEARESLRDKDETLKQLNE 543

Query: 771 RI 772
           RI
Sbjct: 544 RI 545

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  295 bits (754), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 163/480 (33%), Positives = 278/480 (57%), Gaps = 32/480 (6%)

Query: 1350 PRPH--KKLKQLHWEKVEATDNSIWRAN-KAEQFADDLYEKGVLSELENAFAAREIKSLA 1406
            P+P   K LKQ+HW+KVE  DN+IW+ N +  +   +L    + +++E++F  +E+    
Sbjct: 993  PKPQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKK 1052

Query: 1407 SKQKKDLQKI---TFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFL 1463
            SK +K+ +K    +FLS D++QQFGINLHMY++    + +  +L C  + ++  SV+EF 
Sbjct: 1053 SKTEKNKEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFF 1112

Query: 1464 SRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYW 1523
             + +++++  +++RNYAPY +D+         + P K+ +EL+RAD+++L+L  NL+ YW
Sbjct: 1113 CKEDLINIPGSISRNYAPYSRDYLS------GEEPVKDSSELERADKLFLELCYNLRYYW 1166

Query: 1524 GSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQ 1583
              R + L ++ T+E++Y +L+ KL+K+D A+  L  S+  ++   ++L +GNYMN   K 
Sbjct: 1167 ADRSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKT 1224

Query: 1584 AQGFKLATLQRLTFIKDSTNT-MTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQ 1642
             +G K+++L +L FIK S+N  ++FL+++EK++RT YP    F+ +L  V D+ K+++E 
Sbjct: 1225 VEGVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEH 1284

Query: 1643 LVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKL 1702
            +  +C EF   + +V  S+  G LS S K HP D +L KV   +  A+ K ELL D+  L
Sbjct: 1285 IGTECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNL 1344

Query: 1703 TIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMV 1762
            T  +  +L+  YGED                 ++ +KK   +N+  EE E+VYE+ K M+
Sbjct: 1345 TKHDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVYEQRKNML 1404

Query: 1763 EEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKR 1822
            E Q +K             DG  ++ED      A+ D LL +L+ V    +  P   R+R
Sbjct: 1405 ESQSKKE-----------GDGI-NEEDDKSTSDAV-DLLLSKLRGV----EGKPEPLRRR 1447

 Score = 43.9 bits (102), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 96/232 (41%), Gaps = 47/232 (20%)

Query: 548 EYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENS 607
           EY    +  IN +     N  ++  L   L+  GI  I + +K L    + EQI +Y   
Sbjct: 357 EYLTTCLFLINSILQVVPNFERKYKLIENLKEFGIHHIFHLLKDLASTVIKEQISIYSKI 416

Query: 608 KLDDINKLLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIED 667
           + D I   L +SN N+               D   G E        +Q L LS SQ    
Sbjct: 417 EQDII---LSISNNNSM------------FIDVSYGNE--------IQ-LLLSQSQKTPL 452

Query: 668 KQDATQL-------------SKQLKLMDSLVTNVSV----------ASTDQESTMNMAIQ 704
           +Q   +L             S+ +KL  S  + +                 EST+  +I 
Sbjct: 453 EQPIGELLNFLNKILTSRTQSESMKLFKSFGSTLGYLLDHFYKDNDTLLSPESTVQNSIN 512

Query: 705 RLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQ 756
            L D +Q+DE+ARR++ E ++L + ++  Q+EI  L ++ +  +  L+ QL+
Sbjct: 513 ELMDRLQSDEIARRAMNEMKSLEQIIDNLQSEISSLKEERQLDKGELIAQLK 564

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  288 bits (738), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 173/505 (34%), Positives = 285/505 (56%), Gaps = 42/505 (8%)

Query: 1350 PRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAF----AAREIKSL 1405
            P+   +LKQ+HWEKV+    ++W         D L ++GV S++E  F      ++ K L
Sbjct: 816  PKSTIRLKQIHWEKVDDVGGTLWEDVSGIPL-DHLKDEGVFSQIEKYFKILEPVKKTKVL 874

Query: 1406 ASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSR 1465
            A  + K   KI+FL+ D++QQFGINLHMY+ L V + +TK+LKC+ D +Q  SV+ F ++
Sbjct: 875  AENENKP-TKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFFTK 933

Query: 1466 PEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGS 1525
             ++  +   L R +APY  ++      +D+  PEK+P EL+RAD IYL+L  NL+SYW +
Sbjct: 934  EDLTQIPSGLERKFAPYSTNYL----TDDS--PEKDPRELERADHIYLELFYNLRSYWSA 987

Query: 1526 RMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQ 1585
            R   L V+TT+E++Y +L+ KL K+D A+  L +S  +K +  +I  +GNYMN  S    
Sbjct: 988  RSHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS--VT 1045

Query: 1586 GFKLATLQRLTFIKDST-NTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLV 1644
            G KL +L +L+F+K S+   ++FL++VE++VR ++P    F  ++  V D+ K+++E + 
Sbjct: 1046 GIKLNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHVE 1105

Query: 1645 DDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTI 1704
             +C+EF++ + +V  S+  G LSD +K HP D +  K+   +  A+ K ELL ++ +LT 
Sbjct: 1106 LECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELTK 1165

Query: 1705 MEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEE 1764
                RLM+ YGE+                    +KK   +N+  EE  ++YE+ K ++E+
Sbjct: 1166 RSLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLLEQ 1225

Query: 1765 QQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKR-- 1822
            + +K +E E S          DDE         +D L+ +L++     K  P+  R+R  
Sbjct: 1226 RNKKIEEQEHS----------DDEINA------VDDLITKLRD---AKKQHPAPLRRRRS 1266

Query: 1823 --ALVRKKLMGES----TSNILKDI 1841
              A++ +K  GE     T  +L DI
Sbjct: 1267 TKAVLNEKRAGEPLLERTQALLSDI 1291

 Score = 42.0 bits (97), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 116/264 (43%), Gaps = 43/264 (16%)

Query: 547 LEYCQWSMIFINHLCLCSDNINQRMLLRNKLEYC-GIVRIMNQIKSLHYEKVIEQIDVYE 605
           +EYC   M  +N +     +  ++  +    E       ++  I++L  E    QI  Y 
Sbjct: 267 VEYCTLFMFMVNSIIEGYQSFEKKSAIIASFENVEKFTPLITLIENLDDENTSTQIKKYR 326

Query: 606 NSKLDDINKLLELSNKNANI-NLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQL 664
           + KL       E+  +N+ + ++ +  S  + L D    T+N  L   L  +LF    Q+
Sbjct: 327 DVKL-------EIMTRNSCVPSILEDVSYSQVLTDLVIQTKNTALESGL-GNLFTLVFQV 378

Query: 665 IEDKQDATQLSKQLKLMDSLVTNVSVASTDQESTMNM------AIQRLYDAMQTDEVARR 718
           I  K+   +  K LKL+  LV  ++   T ++S  N       AI  L D +Q++++ RR
Sbjct: 379 IHTKK-LNECIKFLKLIALLVPYLNKVLTVEDSLENPDYFFKDAITTLVDNLQSEDLTRR 437

Query: 719 SILESRTLTKKLEESQAEIDLLS-----------QKLKNAEH-------------GLVGQ 754
           +++E +TL K + E  + I  L            Q+LK AEH              L+ Q
Sbjct: 438 AMVEIKTLEKNITELNSHIAELENEAHMDKRTIIQQLKQAEHMLEEKTIENESSIRLINQ 497

Query: 755 LQDELRQRDRMFAKNQRITEQLQA 778
           L+ +LR++ + +  +Q +  Q  A
Sbjct: 498 LKGQLREKQKKY--DQLLVHQRMA 519

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  284 bits (726), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 159/481 (33%), Positives = 266/481 (55%), Gaps = 31/481 (6%)

Query: 1351 RPHKKLKQLHWEKVEATDNSIWR-ANKAEQFADDLYEKGVLSELENAFAARE--IKSLAS 1407
            +P + LKQ+HWEK+   + ++W   N+ ++   +L   G+ S++E +F  +E  IK   +
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKELKRGGIFSQIEESFKVKERTIKQTKN 857

Query: 1408 KQKKDLQKI-TFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRP 1466
            K K++     +FL  DV+QQFGINLHM++       + K+L+CD + +Q  + +EF +R 
Sbjct: 858  KDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTRE 917

Query: 1467 EIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGSR 1526
            ++V+V+ +L R + PY  D+      ED   P K+P EL R D+I+L+L  NLQ YW  R
Sbjct: 918  DLVNVTQSLRRAFDPYSTDYLS----EDG--PSKDPAELDRPDRIFLELCYNLQYYWYER 971

Query: 1527 MRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQG 1586
               L  +TT+E++Y + + +L+K+D  +  L+     K++  +I+ +GNYMN   + A+G
Sbjct: 972  SFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAEG 1029

Query: 1587 FKLATLQRLTFIKDSTNTMT-FLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
             KL++L +L F+K S +  T FL+++E+I+R  YP    F  +L  V D+ KIS++ L  
Sbjct: 1030 IKLSSLNKLAFVKSSVDKNTSFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHLEQ 1089

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
            +C EF   I  V  +++ G LSD S+ HP D ++ K+   +  A+ K +LL D+ KL  +
Sbjct: 1090 ECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLINI 1149

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            +  +LM  +GED                    +KK   +N+  E+ ++VYE+ K M+E +
Sbjct: 1150 DLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLESR 1209

Query: 1766 QRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRALV 1825
            QR A        N  +D   +DED        +D LL +L+      +  P   R+R + 
Sbjct: 1210 QRTAS-------NHNSDLQGEDEDA-------VDVLLAKLRGT----EEKPGLVRRRKIT 1251

Query: 1826 R 1826
            R
Sbjct: 1252 R 1252

 Score = 43.9 bits (102), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 94/191 (49%), Gaps = 19/191 (9%)

Query: 541 GG---ENATLEYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKV 597
           GG   E    ++   S++ +N +       +Q++ L   L+ CGI    + IK L  +  
Sbjct: 317 GGLKPEKCRADFMTTSLLVVNSILQALPTKDQKVSLMQTLKECGIHHCFHLIKQLQVDDT 376

Query: 598 IEQIDVYENSKLDDINKLLELSNKNANIN--LHDPTSLVKNLWDACKGTENEKLLISLVQ 655
            +QI +Y    L+   +L+E ++    I+  ++ P   +  L    KGT  E+ L     
Sbjct: 377 DKQIAIY----LELETELIEATSAADQIDDSVYQPA--LHYLLSRTKGTLIEQDL----A 426

Query: 656 HLFLSSSQLIEDK--QDATQLSKQL-KLMDSLVTNVSVA-STDQESTMNMAIQRLYDAMQ 711
           HLF S ++++  +   ++ +L + L  ++D L+ N   A ST+  S +  +I +  D ++
Sbjct: 427 HLFESLNKILATRTTSESIKLFRSLGSILDYLIDNFCQAVSTEPASLVQESINKFLDNLE 486

Query: 712 TDEVARRSILE 722
           ++E+ RR++ E
Sbjct: 487 SEEIGRRAMKE 497

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  284 bits (727), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 163/491 (33%), Positives = 274/491 (55%), Gaps = 45/491 (9%)

Query: 1350 PRP-HKKLKQLHWEKVEATDNSIWRAN-KAEQFADDLYEKGVLSELENAFAAREIKSLAS 1407
            P P  K+LKQ+HW+KVE   +++W    + ++    L   G+ S++E+ F  +    +A+
Sbjct: 870  PVPTEKRLKQIHWDKVEDIKDTLWEDGLQRQETIRGLQTDGIFSQIEDIFKMKSPTKIAN 929

Query: 1408 K---------------QKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRD 1452
            K                  +L+KI+FLS D++QQFGINLHM++ L   + + K+LKCD D
Sbjct: 930  KTSAISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDND 989

Query: 1453 FLQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIY 1512
             +Q  ++++F  + E+V++  +L   Y PY +   G           K  ++LQRAD+I+
Sbjct: 990  IVQNVNILKFFCKEELVNIPKSLLNKYEPYSRGENG-----------KAASDLQRADRIF 1038

Query: 1513 LQLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILA 1572
            L+L +NL+ YW  R ++L  ++T+E++Y +L+ KL+ +D  +S L  S+  KN+  +I  
Sbjct: 1039 LELCINLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIITE 1098

Query: 1573 VGNYMNDTSKQAQGFKLATLQRLTFIKDSTN-TMTFLNYVEKIVRTNYPAFNKFLVELEP 1631
            +GN+MN   +  +G KL +L +L F++ ST+ TM+FL+++EKI+R  YP    F+ +L+ 
Sbjct: 1099 IGNHMN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLKK 1156

Query: 1632 VLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARK 1691
            V D+ KIS+E +  +C EF   I N+    + G LS+     P D+++ KV   +  AR 
Sbjct: 1157 VEDLGKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRARI 1216

Query: 1692 KGELLGDEVKLTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEE 1751
            K ELL D+ KLT+++  +LM+ YGED                 +T +KK   +N+  EE 
Sbjct: 1217 KSELLMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKENIEKEEM 1276

Query: 1752 EKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPT 1811
            E+VYE+ K ++E +         +  N   DG  ++E    +  A+ D L+ +L+ V   
Sbjct: 1277 ERVYEQRKNLLEMR---------TNGNKKCDGNDENEGEEVNTDAV-DLLISKLREV--- 1323

Query: 1812 NKTDPSSARKR 1822
             K DP   R+R
Sbjct: 1324 -KKDPEPLRRR 1333

 Score = 38.9 bits (89), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 65/127 (51%), Gaps = 19/127 (14%)

Query: 629 DPTSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLV--- 685
           +P  L K L    K +  E  +  ++  L+    ++++ ++  ++  K LKLM+SL+   
Sbjct: 427 EPVCLEKCLLLKAKDSPVETPINEIIHSLW----KILDSQRPYSESIKLLKLMNSLLFYL 482

Query: 686 -------TNVSV-----ASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEES 733
                  TN S      ++ + +S    ++ +L D++Q+DE+ARR++ E   L KK+   
Sbjct: 483 IDSFQVPTNPSFDENIESAENADSVFQDSVNKLLDSLQSDEIARRAVTEIDDLNKKISHL 542

Query: 734 QAEIDLL 740
             ++DL+
Sbjct: 543 NEKLDLV 549

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  283 bits (724), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 170/522 (32%), Positives = 280/522 (53%), Gaps = 53/522 (10%)

Query: 1350 PRPHKKLKQLHWEKVEATDNSIWR-ANKAEQFADDLYEKGVLSELENAFAAREIKSLASK 1408
            P P ++LKQ+HW++VE   +++W  A + ++   +L   GV S++E+ F  R    +ASK
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASK 930

Query: 1409 QKK---------------DLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDF 1453
                              +L+K++FLS D++QQFGINLHM++ L   + + K+L CD D 
Sbjct: 931  NNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 990

Query: 1454 LQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYL 1513
            +Q  ++++F  + E+ ++  +L   Y PY Q  EG           K  ++LQRAD+I+L
Sbjct: 991  IQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEG-----------KAVSDLQRADRIFL 1039

Query: 1514 QLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAV 1573
            +L +NL+SYW  R + L  ++T+E++Y +LL KL+K+D  +S L  S   KN+  +I  +
Sbjct: 1040 ELCINLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEI 1099

Query: 1574 GNYMNDTSKQAQGFKLATLQRLTFIKDSTN-TMTFLNYVEKIVRTNYPAFNKFLVELEPV 1632
            GN+MN   K  +G KL +L +L F++ S +  M+FL+++EKI+R  YP    F+ +L+ +
Sbjct: 1100 GNHMN--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKKI 1157

Query: 1633 LDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKK 1692
             D+ KIS+E +  +C EF   I N+    + G LS      P D+++ KV   +  A+ K
Sbjct: 1158 EDLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKIK 1217

Query: 1693 GELLGDEVKLTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEE 1752
             ELL  + KLT+++  +LM+ YGED                 +  +KK   +N+  EE E
Sbjct: 1218 SELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEME 1277

Query: 1753 KVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDE-DGPGDGRAIMDTLLEQLKNVTPT 1811
            +VYE+ K ++E            R N+      +DE +G       +D L+ +L+ V   
Sbjct: 1278 RVYEQRKSLLE-----------MRTNNNKKSNGNDENEGEEVNTDAVDLLISKLREV--- 1323

Query: 1812 NKTDPSSARKRALVRKKLMGESTSNI----LKDIDTEDDSII 1849
             K DP   R+R   R   + E   N+    LK  D ED  ++
Sbjct: 1324 -KKDPEPLRRRKSTR---LSEVAVNVNDEDLKMKDDEDHILL 1361

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  281 bits (720), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 166/482 (34%), Positives = 274/482 (56%), Gaps = 26/482 (5%)

Query: 1355 KLKQLHWEKVEATDNSIW-RANKAEQFADDLYEKGVLSELENAFAA-----REIKSLASK 1408
            KLKQ+HW+K++    ++W   N+    +  L   GV  E+E+ F       +   S +  
Sbjct: 771  KLKQIHWDKIDNIKETVWNEHNERISTSTKLETFGVFKEIEDLFKVVPATPKTASSNSPT 830

Query: 1409 QKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRPEI 1468
            Q     KI  LS+D++Q FGINLH+++     +LI  +L C  + LQ   VIEF S+ +I
Sbjct: 831  QTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQNQRVIEFFSKDDI 890

Query: 1469 VDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGSRMR 1528
              +  +  R +APY        N    K P+K+P  L+RAD+IYL+L  NL+SYW +R +
Sbjct: 891  NHIPQSTQRMFAPYE------TNYLTGKTPDKDPAVLERADRIYLELFYNLRSYWAARSK 944

Query: 1529 ALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQGFK 1588
             L V+ T+E++Y ++L KL+++D A  +++ S+ LK +F +I+ +GNYMN+  KQA G +
Sbjct: 945  YLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGNYMNN--KQALGIQ 1002

Query: 1589 LATLQRLTFIKDST-NTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVDDC 1647
            L+++ +L F K S  N ++F++ +E+I+RT YP  + F  +LE V D+  I ++ +  + 
Sbjct: 1003 LSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQDMANIIVQHVQQEA 1062

Query: 1648 KEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIMEF 1707
            +EF + I N+ERS+ +G LSDSS+FHP D+ L+K   S+  ARKK ELL D+  LT+ +F
Sbjct: 1063 QEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAELLIDQSTLTMGDF 1122

Query: 1708 LRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQQR 1767
             +L+  +GED+                +  +KKA  +N  +E EE    + K+++E    
Sbjct: 1123 EKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKEN--IEREEIRRSQVKRVIERVPS 1180

Query: 1768 KAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVT---PTNKTDPSSARKRAL 1824
              +   ++R    + GT+ DE      +  +D LL++L++V    P +  D +   K   
Sbjct: 1181 PEKTKSVARSTPLSVGTEVDE------QHAVDVLLKRLRDVRYQEPKSSKDHTEPYKSQT 1234

Query: 1825 VR 1826
            VR
Sbjct: 1235 VR 1236

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  280 bits (716), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 158/468 (33%), Positives = 265/468 (56%), Gaps = 27/468 (5%)

Query: 1352 PHKKLKQLHWEKVEATDNSIW-----RANKAEQFADDLYEKGVLSELENAFAAREIKSLA 1406
            P  KLKQ+HW+K++    ++W     R +K+ + A      G+  E++  F         
Sbjct: 958  PKLKLKQIHWDKIDDIKETVWCDQSQRVSKSTELAS----FGIFQEIDELFQLNPTSPAI 1013

Query: 1407 SKQKKDL-----QKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIE 1461
            +    +L      K++ LS +++Q+FGINLH+++   V +L +K+L CD + L+  SVIE
Sbjct: 1014 ANATANLLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKVLNCDNEVLKNQSVIE 1073

Query: 1462 FLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQS 1521
            F  + EI ++  ++ + +APY        N    + P+++PNEL RAD+IYL+L  NL+S
Sbjct: 1074 FFCKEEINNIPKSVQQLFAPYS------ANYITGEQPDRDPNELDRADRIYLELFYNLRS 1127

Query: 1522 YWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTS 1581
            YWG+R + L VI TF+K+Y ++L KL ++D A  +LQ S  LK +F +I+ +GNYMN   
Sbjct: 1128 YWGARSKYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKELFFIIVEIGNYMNQ-- 1185

Query: 1582 KQAQGFKLATLQRLTFIKDST-NTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISI 1640
            +   G +L++L +L F K ST N M+F++ +E+IVR  YP+ + F+  L+ +L+V  I +
Sbjct: 1186 RPVAGIQLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDFVEGLDKILEVQNIIV 1245

Query: 1641 EQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEV 1700
            + +  +  EF   I ++ER   IG LSD S+FHP D+ + K    +  A+KK +LL D+ 
Sbjct: 1246 QHVQQEAHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESKILLAKKKADLLKDQC 1305

Query: 1701 KLTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKK 1760
             LT+ +F +LM  +GE+                 IT ++KA  +N   EE  ++YE+ ++
Sbjct: 1306 TLTMSDFEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKENSEREEMTRIYEKRRR 1365

Query: 1761 MVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNV 1808
             +E+     ++         T  + DD     D    +DTL+++L+NV
Sbjct: 1366 ALEQSASSQRQRR-RASRLSTAASMDDGTQQEDA---VDTLIKKLRNV 1409

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  279 bits (714), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 160/475 (33%), Positives = 275/475 (57%), Gaps = 32/475 (6%)

Query: 1354 KKLKQLHWEKVEATDNSIWRANKAEQ-FADDLYEKGVLSELENAF---AAREIKSLASKQ 1409
            ++LKQ+HW+K+E    +IW   +     A  L E G+L E+ + F    +   K+   + 
Sbjct: 919  QRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAPTKANTGRL 978

Query: 1410 KKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRPEIV 1469
             ++   +  L  D++QQFGINLHM+++L V D + K+L CDR  +   SV+EF +R ++V
Sbjct: 979  NEE-GPLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLEFFARDDLV 1037

Query: 1470 DVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGSRMRA 1529
            ++  +L+  + PY  D+         K P K+ ++L+RAD+I+L L  NL+SYW  R   
Sbjct: 1038 NIPHSLSLKFEPYSSDFRL------GKGPLKDSSKLERADRIFLALCYNLRSYWRQRSIC 1091

Query: 1530 LKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQGFKL 1589
            L  + T+EK+Y +++ KL++VD A++ ++ S  LK+   +I+ +GNYMN   KQA G KL
Sbjct: 1092 LLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--RKQAPGIKL 1149

Query: 1590 ATLQRLTFIKDSTN-TMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVDDCK 1648
            ++LQ+L F+K S +  ++FL+ VE+ +R    A   F+ EL  VLD+  + + Q+  D +
Sbjct: 1150 SSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVVGQVEQDFQ 1209

Query: 1649 EFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIMEFL 1708
            E+ + I  V++S++ G LSDS  FHP DR+L KV P +  A +K  LL ++ KLT+    
Sbjct: 1210 EYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQFKLTMRALE 1269

Query: 1709 RLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQQRK 1768
             LM++YGED                 I ++KKA  +N+  EE E++Y   K++++++   
Sbjct: 1270 NLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYNHRKELLQQK--- 1326

Query: 1769 AQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRA 1823
                  ++ +S  D + ++E+        +D L+++L++V  ++K    S+ KRA
Sbjct: 1327 ------TKASSKNDASSEEEEDDA-----VDILIQRLRDVNKSSK----SSTKRA 1366

 Score = 47.4 bits (111), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 113/242 (46%), Gaps = 31/242 (12%)

Query: 548 EYCQWSMIFINHLCLCSDNINQRMLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENS 607
           +YC  S+  IN +   + ++ +++    +L+   I R+   +  L + ++  +ID Y++ 
Sbjct: 348 DYCLTSLFLINSILQITSSVAEKLAYFKRLKELNIHRLFQLMHQLEHHEIDGEIDKYKSL 407

Query: 608 KLDDINK-------LLELSNKNANINLHDPTSLVKNLWDACKGTENEKLLISLVQHLFLS 660
           + + I K       LL +S      N+   T   +N  + C            +  LF +
Sbjct: 408 EEEVIQKTNPEFPQLLNVSYGKFLTNIIHQTH--QNPLEHC------------MHQLFET 453

Query: 661 SSQLIEDKQDATQLSKQLKLMDSLVTNVSVASTDQE-----STMNMAIQRLYDAMQTDEV 715
            S+ +  +  +  L K L L  S++  +   S  +E     S +N+++  L D +Q+DE+
Sbjct: 454 LSKTLVARTMSDNL-KVLTLFHSVIDYLKEYSYGEENINIDSVVNISLNHLVDGLQSDEI 512

Query: 716 ARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQ 775
           A+R++ E     K++E  ++EI  L +  +  + G++     ELRQ  +  A+ +   E+
Sbjct: 513 AKRAMSELELAQKEIENLESEIRALRKDKEITKGGVLS----ELRQTQQALAEKETAIEK 568

Query: 776 LQ 777
           L+
Sbjct: 569 LE 570

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  278 bits (712), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 163/480 (33%), Positives = 270/480 (56%), Gaps = 28/480 (5%)

Query: 1351 RPHKKLKQLHWEKVEATDNSIWRANKAEQ-FADDLYEKGVLSELENAFAAREI-----KS 1404
            +P KKLKQ+HW+KVE  +++IW   +  +     L   GVL E+E+ F  +E      KS
Sbjct: 867  KPVKKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAKKS 926

Query: 1405 LASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLS 1464
             A++     + ++FLS D++Q FGINLHM+++L V + + K+L CD D ++   V+EF +
Sbjct: 927  CATEGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEFFN 986

Query: 1465 RPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWG 1524
            R E+  +S +  R YAPY   +    +  +    E  P  L+R D+I+L+L   L+ YW 
Sbjct: 987  REELGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLP-PLERGDEIFLKLCYVLRDYWS 1045

Query: 1525 SRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQA 1584
             R   L V+ T+EK+Y +++ KL+K++ A+  L+ES  L+N   +I+ +GNYMN  +K A
Sbjct: 1046 VRSHCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYMN--TKAA 1103

Query: 1585 QGFKLATLQRLTFIKDSTN-TMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQL 1643
             G K+++L +L FIK S N  ++FL+Y+E+++RT YP   +F+ +L+ V D+ K++++QL
Sbjct: 1104 SGVKISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVEDLGKLTLDQL 1163

Query: 1644 VDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLT 1703
              +C E+   I  +  +++ G LSD +K +P D VL K+      A  K +LL  ++KL+
Sbjct: 1164 ELECSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLLESQMKLS 1223

Query: 1704 IMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVE 1763
              +  +LM+ YGED                 +  +KK   +N+  EE ++VYE+ +K++E
Sbjct: 1224 SNDMNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYEQRRKLLE 1283

Query: 1764 EQQRKAQEAEISRVNSGTDGTKDDEDGPGD---------GRAIMDTLLEQLKNVT-PTNK 1813
            ++Q        SR  SG  G     D  G              +D LL++L+ V  P  K
Sbjct: 1284 DKQS-------SRSKSGK-GNSAAADAAGGNEDDDENEDEEDAVDKLLDKLREVAKPVGK 1335

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  279 bits (714), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 162/480 (33%), Positives = 266/480 (55%), Gaps = 48/480 (10%)

Query: 1350 PRPHKKLKQLHWEKVEATDNSIW-----RANKAEQFADDLYEKGVLSELENAFAAREIK- 1403
            P    KLKQ+HW+K+E    ++W     R +K+     +L   G+  E+E  F   EIK 
Sbjct: 1160 PSTRIKLKQIHWDKIENIKETVWCDEQQRVSKS----SELESLGIFKEIEELF---EIKP 1212

Query: 1404 -------SLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQT 1456
                   + AS  K    +I+ LS +++Q+FGINLH+++   V +L+ K+L CD + ++ 
Sbjct: 1213 ASTNLANATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSCDSEVMKN 1272

Query: 1457 PSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLM 1516
              V+EF  + E  +V  ++ R + PY        N    + PEK+P EL+RAD+IYL+L 
Sbjct: 1273 QGVLEFFCKEEANNVPQSIQRLFGPYE------TNYLTGERPEKDPAELERADRIYLELF 1326

Query: 1517 VNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNY 1576
             NL+SYW +R   L VI+TFE++Y ++L KL+++D A  ++Q S  LK +F +I+ +GNY
Sbjct: 1327 YNLRSYWAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFFIIVEIGNY 1386

Query: 1577 MNDTSKQAQGFKLATLQRLTF---IKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVL 1633
            MN   K  QG +L++L +L F   IKD  N ++F++ +E+IVRT YP+ + F+  +  + 
Sbjct: 1387 MNQ--KPVQGIQLSSLNKLAFTKTIKD--NNLSFIHVLERIVRTRYPSVHDFVEGINSIT 1442

Query: 1634 DVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKG 1693
             V  I ++ +  +  EF   I N++RS+  G LSD SKFHP DR L +    L  A+KK 
Sbjct: 1443 GVANIIVQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKLAQAKKKA 1502

Query: 1694 ELLGDEVKLTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEK 1753
             LL D+  LTI +F +LM  +GE+                 I  ++KA  +N   EE ++
Sbjct: 1503 RLLRDQCSLTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKENTEREELDR 1562

Query: 1754 VYERHKKMVE-----EQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNV 1808
             YE+ ++++E     + +R++        ++G    KD           +DTL+ +L+++
Sbjct: 1563 TYEKRRRLLEQTAALQDRRRSSGLSSVPSSAGDSADKD----------AVDTLMRRLRDL 1612

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  277 bits (708), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 165/505 (32%), Positives = 278/505 (55%), Gaps = 32/505 (6%)

Query: 1354 KKLKQLHWEKVEATDNSIW-RANKAEQFADDLYEKGVLSELENAFAAREIKSLASKQKKD 1412
            KKLKQ+HW+K+E   N++W  A+  +    +L   G+  +++  F+   ++ L  K K+ 
Sbjct: 857  KKLKQIHWDKIENVKNTLWDHADGRQDTILELEHAGIFEKVQGMFS---VQDLVVKPKRA 913

Query: 1413 L------QKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRP 1466
            +      + ++FLS D SQQ  INLH++A L   +++ K+L CD D +Q  SV+EF  + 
Sbjct: 914  VNVRESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFFCKD 973

Query: 1467 EIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGSR 1526
            E+V++     R++ PY  D+     +  ++ P KNP+EL+RAD+++L L  NL+ YW  R
Sbjct: 974  EMVNIGSARIRHFTPYSADY-----LNASEQPAKNPDELERADKLFLYLPFNLRRYWAER 1028

Query: 1527 MRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQG 1586
             + L VI+T+E+EY ++L  L+K+D A+ +++ SE  K    +I+ +GNYMN  +K  +G
Sbjct: 1029 SQCLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKAVEG 1086

Query: 1587 FKLATLQRLTFIKDSTN-TMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVD 1645
             +L +L +L FIK + N   +FL++VEK++R +YP    F+ +L  V D+ KI+I+Q+  
Sbjct: 1087 IRLNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQVQL 1146

Query: 1646 DCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIM 1705
             C+E+   I  +  S+  G LSD ++ HP D++L KV   +  A+ K ELL  + KLT  
Sbjct: 1147 QCEEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKLTNN 1206

Query: 1706 EFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQ 1765
            +F + M  YGED                  + ++K   +N+  EE ++ YE+ KK+ E +
Sbjct: 1207 DFRKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRKKIAELR 1266

Query: 1766 QRKAQE--------AEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPS 1817
             +K +          EI  V+S     +D E  P   R +  +     K   P+ +    
Sbjct: 1267 NKKNERNDTVHDTSEEIDSVHSLLAQLRDVEKQPEPMRRVKSS-----KYTLPSEQVSVG 1321

Query: 1818 SAR-KRALVRKKLMGESTSNILKDI 1841
             A  ++ +  K  + E T N+L DI
Sbjct: 1322 EANDEKDISEKHSLLERTQNMLSDI 1346

 Score = 36.2 bits (82), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 54/98 (55%), Gaps = 8/98 (8%)

Query: 680 LMDSLVTNV-SVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEID 738
           LMD+   N  SVAS   E+    A+ +L D++ ++E+ +R++ E + L K ++    EID
Sbjct: 478 LMDNFQNNQKSVAS---ETLFQEAVTKLMDSLHSNEITKRAMSELKELEKTVQSLNEEID 534

Query: 739 LLSQKLKNAEHGLVGQLQDELRQRDRMFAKNQRITEQL 776
            L +++ N + G V    +EL+Q + +     R  E+L
Sbjct: 535 RL-REINNMDKGDV---LEELKQANELIESRDRENEEL 568

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  277 bits (708), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 153/490 (31%), Positives = 276/490 (56%), Gaps = 44/490 (8%)

Query: 1350 PRPHKKLKQLHWEKVEATDNSIWRAN-KAEQFADDLYEKGVLSELENAFAAREIKSLASK 1408
            P   K+LKQ+HW+KVE   +++W    + ++   +L   G+ S++E+ F  +    +A+K
Sbjct: 872  PPTEKRLKQIHWDKVEDIKDTLWEDTFQRQETIKELQTDGIFSQIEDIFKMKSPTKIANK 931

Query: 1409 Q---------------KKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDF 1453
            +                 +L+KI+FLS D++QQFGINLHM++ L   + + K+L CD D 
Sbjct: 932  RNAESSIALSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 991

Query: 1454 LQTPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYL 1513
            +Q  ++++F  + E+V++  ++   Y PY Q  +G           K  ++LQRAD+I+L
Sbjct: 992  VQNVNILKFFCKEELVNIPKSMLNKYEPYSQGKDG-----------KAVSDLQRADRIFL 1040

Query: 1514 QLMVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAV 1573
            +L +NL+ YW +R ++L  ++T+E++Y +L+ KL+K+D A+S L  S   K++  +I  +
Sbjct: 1041 ELCINLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDAISHLNRSPKFKSLMFIITEI 1100

Query: 1574 GNYMNDTSKQAQGFKLATLQRLTFIKDSTN-TMTFLNYVEKIVRTNYPAFNKFLVELEPV 1632
            GN+MN   +  +G KL +L +L F++ S +  ++FL+++EK++R  YP    F+ +L+ +
Sbjct: 1101 GNHMN--KRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKVIRIKYPDIYGFVDDLKNI 1158

Query: 1633 LDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKK 1692
             D+ KIS+E +  +C EF + I ++    ++G LS      P D+++ KV   +  A+ K
Sbjct: 1159 EDLGKISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDPRDQIIKKVKFKINRAKTK 1218

Query: 1693 GELLGDEVKLTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEE 1752
             ELL  + KLT+++  +LM+ YGED                 +  +KK   +N+  EE E
Sbjct: 1219 SELLIGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEFLAMFKKCAKENIEKEEME 1278

Query: 1753 KVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTN 1812
            +VYE+ K +++ +         +  N  ++G+ D+ DG    R  +D L+ +L+ V    
Sbjct: 1279 RVYEQRKSLLDMR---------TSSNKKSNGS-DENDGEKVNRDAVDLLISKLREV---- 1324

Query: 1813 KTDPSSARKR 1822
            K DP   R+R
Sbjct: 1325 KKDPEPLRRR 1334

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  275 bits (702), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 156/481 (32%), Positives = 278/481 (57%), Gaps = 32/481 (6%)

Query: 1346 FENYPRPH-KKLKQLHWEKVEATDNSIW-RANKAEQFADDLYEKGVLSELENAFAAREI- 1402
            F + P+P  K LKQ+HW+K+E   +++W          +DL EKGV +E+ N F  + + 
Sbjct: 792  FVSKPKPEVKPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLFEQKAVR 851

Query: 1403 ---KSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSV 1459
               KS  +  KK+ +K++ LS D++QQFGINLHM++S  V DL+ K+L+CD D ++  SV
Sbjct: 852  MKKKSNVTASKKN-EKVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNHSV 910

Query: 1460 IEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNL 1519
            +EF ++ +   +  ++ R++ PY  DW+        K P+++ ++L+RAD+IYL++  N+
Sbjct: 911  LEFFNKDDFETIPQSIIRSFEPYASDWKT------GKAPKEDVSKLERADRIYLEMFYNM 964

Query: 1520 QSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMND 1579
            + YW  R  +L +  T+EK+Y ++L +L+K+D   S ++ S  LK  F +++ +GN+MN+
Sbjct: 965  RYYWKIRSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFMNN 1024

Query: 1580 TSKQAQGFKLATLQRLTFIK-DSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKI 1638
              K+ QG KL++L +L+ +K +S   ++FL+ +E+I+R  YP    F  +L  + D+ KI
Sbjct: 1025 --KKTQGIKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLGKI 1082

Query: 1639 SIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGD 1698
            +IE +  +  E+ + I+ ++ S E G LS + K HP D+   K+   LP A +K ELL +
Sbjct: 1083 NIESIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELLHN 1142

Query: 1699 EVKLTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERH 1758
            + KLT+ +F   M+  GED                 +T + K   +N   E   +V+E+ 
Sbjct: 1143 QCKLTMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHEQR 1202

Query: 1759 KKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSS 1818
            ++++   Q+ + E ++ +       + DDE         +D L+++L++V P  +T P S
Sbjct: 1203 QQLL---QKASTETQVEK-------SADDE-----AADTIDILIKKLRSVDP-QQTIPGS 1246

Query: 1819 A 1819
            +
Sbjct: 1247 S 1247

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  273 bits (699), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 159/461 (34%), Positives = 262/461 (56%), Gaps = 21/461 (4%)

Query: 1355 KLKQLHWEKVEATDNSIWRANKAE-QFADDLYEKGVLSELENAF-----AAREIKSLASK 1408
            KLKQ+HW+K++    ++W  +K     + +L   GV  E+E  F     A +   ++ + 
Sbjct: 815  KLKQIHWDKIDDISKTVWSDDKERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMFTA 874

Query: 1409 QKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRPEI 1468
            Q     K+T LS+D++QQFGINL+++++  V +L+ K+L CD + ++  SVIEF S+ +I
Sbjct: 875  QNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKDDI 934

Query: 1469 VDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGSRMR 1528
              +  ++ R +APY        N      PEK+   L RAD+IYL+L  NL+SYW  R +
Sbjct: 935  NHIPQSIQRMFAPYET------NYLTGDKPEKDSRSLDRADRIYLELFYNLRSYWAPRAK 988

Query: 1529 ALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQGFK 1588
             L  + T+EK+Y ++L KL+++D   ++++ S+ LK +  +I+ VGNYMN+  KQA G +
Sbjct: 989  YLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALGIQ 1046

Query: 1589 LATLQRLTFIKDST-NTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVDDC 1647
            L++L +L F K S  N ++F++ +E IVR NYP  + F+ +LE +LDV  I ++ +  + 
Sbjct: 1047 LSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQEA 1106

Query: 1648 KEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIMEF 1707
            +EF + I  +ERS+ +G LSDSSKFHP D+ L     ++  A KK +LL  +  LT+ EF
Sbjct: 1107 QEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMGEF 1166

Query: 1708 LRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQQR 1767
             +LM  +GED                    +KKA  +N+   E  +V E  + ++E    
Sbjct: 1167 DKLMVFWGEDPNNVFSKNTFFQKFLDFALLFKKANKENIE-REVRRVCESRRYLLE---- 1221

Query: 1768 KAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNV 1808
            K   + I RV+     T        D +  ++ L+++L+NV
Sbjct: 1222 KTGNSHI-RVDRSERCTLPSLPADSDDQQAVEILIKRLRNV 1261

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  269 bits (687), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 155/480 (32%), Positives = 270/480 (56%), Gaps = 26/480 (5%)

Query: 1348 NYPRPHKKLKQLHWEKVEATDNSIWRANKAEQ-FADDLYEKGVLSELENAFAAREI---K 1403
            N  +  KKLKQ+HW +V     +IW+ N  ++    +L   GV   ++++F  +++   K
Sbjct: 1135 NIQKEDKKLKQIHWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKK 1194

Query: 1404 SLASKQKKDLQKI-TFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEF 1462
            +    + KD Q++ +FLS D++QQFGINLH++AS +V +L+ K+L+CD D  +  +++EF
Sbjct: 1195 NTDEAKTKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITILEF 1254

Query: 1463 LSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSY 1522
             ++ E   +S ++ARNYAPY  D++            K+ +EL+RAD+I+L+L  NL++Y
Sbjct: 1255 FNKEEFTHISGSVARNYAPYGVDYQT------NNEATKDASELERADRIFLELFYNLRAY 1308

Query: 1523 WGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSK 1582
            W  R + L ++ T+EK+Y +L+ KL+++D AV  L  S   K    ++L +GN+MN   K
Sbjct: 1309 WAERSQCLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN--KK 1366

Query: 1583 QAQGFKLATLQRLTFIKDS-TNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIE 1641
             A+G  +++L +L FIK S  N ++FL+++EK +RT +P    F+ +L  V ++  +S++
Sbjct: 1367 PAEGILISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVSLD 1426

Query: 1642 QLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVK 1701
             +  +CKEF   +     ++  G LS     HP D++L KV   +  A+ K   L D+  
Sbjct: 1427 HITMECKEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQQI 1486

Query: 1702 LTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKM 1761
            LT    +++++ YGED                  T +KK   +N+  EE E++YE+ K M
Sbjct: 1487 LTNHSIVKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRKYM 1546

Query: 1762 VEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARK 1821
            ++ + +K         NS  D +  +++   D    +D LL +L+ V   NK +P   R+
Sbjct: 1547 LDNKLQKN--------NSSGDDSDLEKNTENDDA--VDKLLLKLRGV--ENKPEPLRRRR 1594

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  268 bits (684), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 141/420 (33%), Positives = 242/420 (57%), Gaps = 16/420 (3%)

Query: 1351 RPHKKLKQLHWEKVEATDNSIWRAN-KAEQFADDLYEKGVLSELENAF-----AAREIKS 1404
            +P + LKQ+HWEK++  + ++W  N + E+   +L   G+  +++  F       +++K+
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1405 LASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLS 1464
              S  KK  Q  +FLS D++QQFGINLHMY+   V + + K+L+CD D LQ  SV+EF +
Sbjct: 908  DNST-KKTTQLKSFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFFN 966

Query: 1465 RPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWG 1524
              E+ ++  +L+R++APY  D+      ++ K P  +PNEL+R D+I+L+L  NL+SYW 
Sbjct: 967  NEELTNIPASLSRSFAPYSADF------QENKSPTVDPNELERPDRIFLELCYNLRSYWR 1020

Query: 1525 SRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQA 1584
             R + L +  T+E++Y +L+ KL+ +D A+  ++ +  LK +  +I+ +GNYMN   K  
Sbjct: 1021 ERSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKNV 1078

Query: 1585 QGFKLATLQRLTFIKDST-NTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQL 1643
             G +L +L +L+F+K S  N ++FL+++EK+VR  YP    F  +L     +  IS + +
Sbjct: 1079 SGIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDHI 1138

Query: 1644 VDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLT 1703
              +C+E+   + +V R    G LS  S  HP D ++ KV   +  A+ K +LL D+ KL 
Sbjct: 1139 QSECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKLI 1198

Query: 1704 IMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVE 1763
              +  +LM+ +GE+                    +KK   +N+  EE  +VYE+ KK+++
Sbjct: 1199 SADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKCAKENIEKEEAYRVYEQRKKLLD 1258

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  259 bits (663), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 150/438 (34%), Positives = 247/438 (56%), Gaps = 16/438 (3%)

Query: 1355 KLKQLHWEKVEATDNSIWRANKAEQ-FADDLYEKGVLSELENAFAAREIKSLASKQKKDL 1413
            KLKQ+HW+K+E    +IW      Q  A  L   G L E+   F  R  +SL  K K + 
Sbjct: 920  KLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELF--RVNQSLPIKAKSET 977

Query: 1414 Q----KITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRPEIV 1469
                 K++ L  D++QQFGINLHM+++L V + + K+L CDRD +   SV+EF +R ++ 
Sbjct: 978  SSGKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLS 1037

Query: 1470 DVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGSRMRA 1529
             +  ++A    PY  D +        + P  +  +L+RAD+I+L+L  NL+SYW  R   
Sbjct: 1038 IIPRSIASKLEPYATDHQ------PNEAPLLDREKLERADRIFLELCYNLRSYWRPRSLC 1091

Query: 1530 LKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQGFKL 1589
            L  ++T+EK+Y +L+ KL++VD A++ ++ S  LK+   +I+ +GNYMN   KQA G +L
Sbjct: 1092 LLTLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIRL 1149

Query: 1590 ATLQRLTFIKDSTN-TMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVDDCK 1648
            ++LQ+LTF+K S +  M+ L+ VE+ +R    +   F+ +L  VLD+  + + Q+  D  
Sbjct: 1150 SSLQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFH 1209

Query: 1649 EFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIMEFL 1708
            E++Q I  V++S+E G LS    FHP DR+L KV P +  A +K  LL ++  LT+    
Sbjct: 1210 EYTQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALE 1269

Query: 1709 RLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQQRK 1768
             LM++YGED                 ++++KK   +N   E  E++Y + K++++ + ++
Sbjct: 1270 NLMKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELLQNRSKE 1329

Query: 1769 AQEAEISRVNSGTDGTKD 1786
               +     + G D T D
Sbjct: 1330 HSSSSQGSASEGEDNTVD 1347

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  259 bits (661), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 155/509 (30%), Positives = 277/509 (54%), Gaps = 43/509 (8%)

Query: 1352 PHKKLKQLHWEKVEATDNSIWRANKAE-QFADDLYEKGVLSELENAFAARE--IKSLASK 1408
            P K +KQ+HWEKV  T  S+W  +        +L   G+ SE+E+ F +++  IK    K
Sbjct: 966  PTKNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDAVIKRRNPK 1025

Query: 1409 QKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRPEI 1468
             +   + +T L  +++QQFGINLHM++ +   DL  K+L+CD    Q  SVIEF +  ++
Sbjct: 1026 DQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNEDL 1085

Query: 1469 VDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGSRMR 1528
             ++  N+ R + PY  D++          P K+ +EL R D I+L L  NL+SYW  R +
Sbjct: 1086 TNIPSNICRTFEPYSIDYKT-----PGSKPTKDISELSRVDHIFLLLCYNLRSYWKERSQ 1140

Query: 1529 ALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQGFK 1588
             L ++ T+EK+Y +L+ KL ++D A+++++ S+ LK+V  +I+A+GN+MN   K   G +
Sbjct: 1141 CLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGIR 1198

Query: 1589 LATLQRLTFIK-DSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVDDC 1647
            L++L +LT+IK +S +  +FL+++E+++R  YP    F  +L  V ++  ++++ L  + 
Sbjct: 1199 LSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLEY 1258

Query: 1648 KEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIMEF 1707
             + S  I  V RSI+ G LS+    HP D +L KV   +  A  K  +L D+  LT ++ 
Sbjct: 1259 DDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRTILQDKFTLTNIDL 1318

Query: 1708 LRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQQR 1767
             +L+  +GED                 +T ++K   +N+  EE ++VYE+ +++++    
Sbjct: 1319 EKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADRVYEQRRQLLD---- 1374

Query: 1768 KAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRALVRK 1827
                   S++ +  D + D+ +   D +  +D LL++L+ V       P++A +R    K
Sbjct: 1375 -------SKIQAQWDSSMDEIE--EDQQDAVDQLLKKLRGV-----EQPTTAVRRRKSSK 1420

Query: 1828 KL--------------MGESTSNILKDID 1842
            +L              + E T+N+ KD++
Sbjct: 1421 RLDQMDQIPSRLSQDDLWERTANLRKDLE 1449

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  257 bits (656), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 156/490 (31%), Positives = 267/490 (54%), Gaps = 45/490 (9%)

Query: 1355 KLKQLHWEKVEATDNSIWR-ANKAEQFADDLYEKGVLSELENAFAAREIK------SLAS 1407
            +LKQ+HWEKVE  ++++W  + + E+ A +L   G+  ++ + F  + IK      + AS
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIKMKKRDTTTAS 911

Query: 1408 KQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEFLSRPE 1467
            K+    Q  T L  +++QQFGINLHM++SL   + + K+L+C+ D +   SV+EF ++ E
Sbjct: 912  KK----QNGTLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEE 967

Query: 1468 IVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSYWGSRM 1527
            +  +  +L + + PY ++              K+  EL+RAD+I+ +L   L SYW  R 
Sbjct: 968  LTSIPTSLIQKFTPYAENI-------------KSKFELERADRIFFELCFQLHSYWRERS 1014

Query: 1528 RALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSKQAQGF 1587
              L ++ T+EK+Y +L+ KL+KVD  +  L  S   ++   +I+ +GNYMN   K   G 
Sbjct: 1015 NCLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGI 1072

Query: 1588 KLATLQRLTFIKDST-NTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIEQLVDD 1646
            ++ +L +L F+K S  N ++FL+++EKI+R  YP    F+ EL  + D+ K+SI+QL  D
Sbjct: 1073 RIGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYD 1132

Query: 1647 CKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVKLTIME 1706
             +EF   I  +   +E G LS + +  P D++L K    +  A+ K EL+  ++KL   +
Sbjct: 1133 SQEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHD 1192

Query: 1707 FLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKMVEEQQ 1766
            + ++M+ +GED+                I  +KK   +N+  EE E+VYE+ +KM +   
Sbjct: 1193 YAKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENIEKEEMERVYEQRQKMFD--M 1250

Query: 1767 RKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTDPSSARKRALVR 1826
            RK +E E ++     D          + R+I+D L+ QL+ V   N  +P   R++    
Sbjct: 1251 RKKEEEEQTQEKEQND----------ENRSIVDALIMQLRVVEKPN--EPLRDRRKT--- 1295

Query: 1827 KKLMGESTSN 1836
             K+ G S +N
Sbjct: 1296 -KITGNSHTN 1304

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  256 bits (653), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 133/422 (31%), Positives = 244/422 (57%), Gaps = 26/422 (6%)

Query: 1355 KLKQLHWEKVEATDNSIWR-ANKAEQFADDLYEKGVLSELENAFAAREIKSLASKQKKDL 1413
            +LKQ+HW+KVE   +++W    + ++   +L   G+ S++E+ F  ++   +ASK+  + 
Sbjct: 881  RLKQIHWDKVEEIKDTLWEDTTQRQETLKELQTDGIFSQIEDIFKMKDPVKIASKKNGNS 940

Query: 1414 QK-----------ITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIEF 1462
                         ++FLS D++QQFGINLHM++ +   + + K+L CD + +   ++++F
Sbjct: 941  STSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNILKF 1000

Query: 1463 LSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQLMVNLQSY 1522
              + E+V +  ++   Y PY Q  +G K+V D          LQRAD+I+L+L +NL+SY
Sbjct: 1001 FCKEELVSIPKSMLSKYEPYSQG-KGGKSVSD----------LQRADRIFLELCINLRSY 1049

Query: 1523 WGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGNYMNDTSK 1582
            W +R ++L  ++T+E++Y +L+ KL+K+D  +  L  S   K++  +I  +GN+MN   K
Sbjct: 1050 WNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN--KK 1107

Query: 1583 QAQGFKLATLQRLTFIKDSTN-TMTFLNYVEKIVRTNYPAFNKFLVELEPVLDVVKISIE 1641
              +G KL +L +L F++ S +  ++FL+++EK++RT YP    F+ +L+ + D+ K+S+E
Sbjct: 1108 MVKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKVSLE 1167

Query: 1642 QLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGELLGDEVK 1701
             +  +C+EF   +       + G LS+     P D+++ KV   +  A+ K +LL D+ K
Sbjct: 1168 HVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVDQCK 1227

Query: 1702 LTIMEFLRLMQIYGEDSGXXXXXXXXXXXXXXXITEYKKAQTQNLRLEEEEKVYERHKKM 1761
            LT+++  +LM+ YGED                 +  +KK   +N+  EE E+VYE+ K +
Sbjct: 1228 LTLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQRKNL 1287

Query: 1762 VE 1763
            +E
Sbjct: 1288 LE 1289

>Skud_8.137 Chr8 complement(226303..228618,228619..229584) [3282 bp,
           1093 aa] {ON} YHR077C (REAL)
          Length = 1093

 Score = 35.4 bits (80), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 460 LNKKNPERFKVILNVLDQKFKIGQNLHMAHN-LKKFGEYF-------GPLTLDSNLKVTR 511
           + KK+P  F ++  VL+ KFK+G    +A   +KKF  +F         L  DSNLK T 
Sbjct: 174 IGKKDPLLFSILREVLNYKFKLGFTTTIATAFIKKFAPFFHDDNNSWDDLISDSNLKCTL 233

Query: 512 AWLFAV 517
             LF +
Sbjct: 234 QSLFKI 239

>KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {ON}
            Anc_6.223 YGL064C
          Length = 540

 Score = 34.7 bits (78), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 57/112 (50%), Gaps = 9/112 (8%)

Query: 1350 PRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAFAAREIKSLASKQ 1409
            PR HK  K+L ++ V++T N  ++ +K +  A  LY     SE E     R I  +   +
Sbjct: 324  PRLHKLPKKLDFKIVDSTLNP-FKGSKIKTLAQILYAVA-HSETEPGLEKRTI--VFVNK 379

Query: 1410 KKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTPSVIE 1461
            K D++KI      +  ++G + H++  L   D + K L+  RDFLQ P  +E
Sbjct: 380  KSDVEKIV---QVLKSEYG-HEHVFG-LTGSDTVEKRLETIRDFLQPPKRLE 426

>Kwal_55.20247 s55 (318090..320861) [2772 bp, 923 aa] {ON} YHR077C
           (NMD2) - Highly acidic C-terminus [contig 152] FULL
          Length = 923

 Score = 34.3 bits (77), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 49/109 (44%), Gaps = 14/109 (12%)

Query: 417 LSMLSQGLREFTKHELMAQTIARGLFSTTLSTRKMATEIFVC-MLNKKNPERFKVILNVL 475
           ++ L   +R FT+  L+      GLF       K    +FV   L+KK P  F V+  VL
Sbjct: 25  MAKLKLHIRIFTELYLV------GLFRNLDYLSKDNLPLFVLKRLSKKEPIIFSVLKEVL 78

Query: 476 DQKFKIGQNLHMAH-NLKKFGEYFG------PLTLDSNLKVTRAWLFAV 517
           + +FK G    +A   + KF E+FG      PL L  + K     LF V
Sbjct: 79  NYRFKTGMTAEIATLFITKFPEFFGEEEQYKPLNLQVDTKKLLQSLFKV 127

>KLTH0F13222g Chr6 (1086482..1088044) [1563 bp, 520 aa] {ON} similar
            to uniprot|P40010 Saccharomyces cerevisiae YER006W NUG1
            GTPase that associates with nuclear 60S pre- ribosomes
            required for export of 60S ribosomal subunits from the
            nucleus
          Length = 520

 Score = 34.3 bits (77), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 59/139 (42%), Gaps = 27/139 (19%)

Query: 1737 EYKKAQTQNLRLEEEEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRA 1796
            E +KAQ      E EEK+    +K+ EE+QR A+  EI       D  +DDE G  D  A
Sbjct: 65   EVRKAQ------EAEEKLANLQRKL-EEKQRAAESGEII-----MDEMEDDEGGESDLTA 112

Query: 1797 IMDTLLEQLKNVTPTNKTDPSSARKRALVRKKL---MGESTSN------------ILKDI 1841
            ++++  +        N  D  S+  + +V   +    G+S S             I K +
Sbjct: 113  LVESAQQAAAEFNGENGVDQESSEPQEVVEYDIDFFAGDSESTTELEKSRKAYDKIFKTV 172

Query: 1842 DTEDDSIIYSPDAKKPMAT 1860
                D I+Y  DA+ P  T
Sbjct: 173  VDASDVILYVLDARNPEGT 191

>Smik_8.127 Chr8 complement(190428..193079) [2652 bp, 883 aa] {ON}
           YHR056C (REAL)
          Length = 883

 Score = 33.9 bits (76), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 43/85 (50%)

Query: 670 DATQLSKQLKLMDSLVTNVSVASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKK 729
           D  +L   L+L+ S +T + + S DQE+   +AI + Y+++   +  + ++ E       
Sbjct: 442 DVLKLLNNLRLIRSQITLIDLESYDQETIKFIAITKFYESLYMHDDQKSNLDEDLNCLLS 501

Query: 730 LEESQAEIDLLSQKLKNAEHGLVGQ 754
            + +  ++    +K+  + H L+GQ
Sbjct: 502 FQINDFKLFHFLKKMYYSRHSLLGQ 526

>NDAI0C06390 Chr3 complement(1479232..1480365) [1134 bp, 377 aa] {ON}
            Anc_8.63 YPL018W
          Length = 377

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 43/73 (58%), Gaps = 9/73 (12%)

Query: 944  DISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGINFNID-DISEKTTGIDNSGDKS 1002
            D+ +F ++E   +L NE R+T LQ +KELE K ++  I+  ID DI+      D  G++ 
Sbjct: 55   DLKRFKLQEEKEQLLNE-RNTLLQEIKELEEKKRN-DISHAIDKDIT------DEEGEEE 106

Query: 1003 TEYSSLDPNAYQI 1015
            T  + +D NA Q+
Sbjct: 107  TNSNIIDENALQL 119

>Smik_8.154 Chr8 complement(229050..232316,232428..232433) [3273 bp,
           1090 aa] {ON} YHR077C (REAL)
          Length = 1090

 Score = 33.1 bits (74), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 460 LNKKNPERFKVILNVLDQKFKIGQNLHMAHN-LKKFGEYF-------GPLTLDSNLKVTR 511
           + KK+P  F ++  +L+ KFK+G    +A   +KKF  +F         L  D+NLK T 
Sbjct: 176 IGKKDPLLFSILREILNYKFKLGFTTTIATAFIKKFAPFFHEDDDSWDGLISDTNLKFTL 235

Query: 512 AWLF 515
             LF
Sbjct: 236 QSLF 239

>SAKL0H21384g Chr8 complement(1869636..1872065) [2430 bp, 809 aa]
           {ON} similar to uniprot|P53008 Saccharomyces cerevisiae
           YGL027C CWH41 Processing alpha glucosidase I involved in
           assembly of cell wall beta 1 6 glucan and asparagine-
           linked protein glycosylation ER type II integral
           membrane N-glycoprotein disruption leads to a K1 killer
           toxin- resistant phenotype
          Length = 809

 Score = 33.1 bits (74), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%)

Query: 360 VTLRTEQLDWVDAFIEHQGHIAMANVLMKSIYKTTPNEKLTSQLLEKENSFFKCFRVLSM 419
           +T+  E  D V  F+ H+G+I++    +K + + +PN K   +L+      F  F +LS+
Sbjct: 641 LTINDESDDDVRDFVCHEGYISLLPFALKLLPRDSPNLKYIVELMSDSEKLFSDFGLLSL 700

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 185,414,462
Number of extensions: 7795443
Number of successful extensions: 35669
Number of sequences better than 10.0: 286
Number of HSP's gapped: 36710
Number of HSP's successfully gapped: 384
Length of query: 2022
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 1897
Effective length of database: 39,148,149
Effective search space: 74264038653
Effective search space used: 74264038653
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 74 (33.1 bits)