Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F04210singletonON1701708991e-125
NDAI0F043901.50ON6671325832e-71
KAFR0D041401.50ON6371335244e-63
YCL025C (AGP1)1.50ON6331335235e-63
NCAS0A004201.50ON6791365247e-63
Smik_3.531.50ON6331335228e-63
Skud_3.381.50ON6331335219e-63
Suva_3.1891.50ON6331335131e-61
KAFR0D04120na 1ON6481335105e-61
Kpol_2000.921.50ON6371325053e-60
NCAS0B085801.50ON6271344991e-59
TPHA0B047501.50ON6391344973e-59
CAGL0K05753g1.50ON6601344871e-57
YDR508C (GNP1)1.50ON6631344852e-57
Kpol_2002.441.50ON6271324833e-57
TPHA0E036601.50ON6471334817e-57
Smik_4.7901.50ON6631344827e-57
SAKL0C01232gsingletonON6131334754e-56
Skud_4.7841.50ON6631344765e-56
CAGL0B01012g1.50ON6231344746e-56
SAKL0C01650g1.50ON6131334721e-55
Suva_2.6881.50ON6611344722e-55
TBLA0A051801.50ON6761344695e-55
KAFR0D00510na 2ON6171334676e-55
TDEL0C065101.50ON6421334678e-55
KAFR0D04130na 2ON6441334642e-54
TBLA0A05190na 1ON6671344643e-54
NDAI0A006401.50ON6411334572e-53
KLLA0C01606g1.50ON6201344381e-50
KAFR0D00520na 1ON5981334352e-50
KLTH0F01584g1.50ON5961324317e-50
ZYRO0F17446g1.50ON6331344283e-49
KAFR0D005001.50ON6171334265e-49
SAKL0D02926g3.285ON5831714202e-48
Kwal_33.132041.50ON6071324203e-48
Ecym_10561.50ON6061324185e-48
KNAG0F002701.50ON6341334179e-48
AFR698C1.50ON6091334152e-47
Ecym_26643.285ON5751333983e-45
KNAG0C005901.50ON6341323978e-45
AGR040C3.285ON5731323894e-44
KLTH0F01606gna 1ON6041333897e-44
Kwal_33.13215na 1ON5981293871e-43
SAKL0D02948gna 3ON5941323843e-43
SAKL0D02970g3.284ON6011343687e-41
AGR039Cna 3ON5861333582e-39
Kpol_1065.133.284ON5961333563e-39
YBR068C (BAP2)3.284ON6091333442e-37
TPHA0M012003.284ON6071333381e-36
Skud_4.3003.284ON6041333372e-36
NDAI0A056203.284ON5711333352e-36
KAFR0A011203.284ON5921323343e-36
AGR038C3.284ON5801323318e-36
Suva_2.2033.284ON6041333292e-35
KNAG0H011503.284ON6171323274e-35
Skud_2.1913.284ON6091333241e-34
ZYRO0D03762g1.244ON6001703186e-34
Smik_4.2843.284ON6041333178e-34
KAFR0C004003.284ON5821333161e-33
Smik_2.2013.284ON6091263161e-33
YDR046C (BAP3)3.284ON6041333152e-33
ZYRO0G12342g3.284ON6201303152e-33
KNAG0J022003.284ON6071323142e-33
SAKL0D00836gna 4ON6011323142e-33
Kwal_27.126811.244ON5931703133e-33
NDAI0A074903.284ON5961263115e-33
NCAS0A106803.284ON5931333116e-33
Smik_2.2023.285ON6171373117e-33
SAKL0D04664g1.244ON5931313091e-32
CAGL0L07546g3.284ON6341333101e-32
KLLA0A06886gsingletonON5871323082e-32
Suva_4.3073.284ON6091333063e-32
KNAG0J022103.285ON5811203054e-32
Skud_11.2751.244ON6021323037e-32
NCAS0I015303.284ON5951273037e-32
Kwal_33.14276na 4ON5961323037e-32
Ecym_26623.284ON5891253029e-32
YBR069C (TAT1)3.285ON6191063039e-32
Skud_2.1923.285ON6191083021e-31
KLTH0E15642g1.244ON5961323021e-31
Suva_11.2731.244ON6011323021e-31
KNAG0C02140singletonON5981313011e-31
NDAI0A075003.285ON6191252983e-31
YKR039W (GAP1)1.244ON6021322984e-31
Skud_7.6singletonON1501332765e-31
NDAI0B052201.244ON6111312976e-31
Kwal_27.105383.284ON6021322958e-31
Suva_4.3083.285ON6181412932e-30
TPHA0B010901.244ON6061702932e-30
CAGL0H08393g3.284ON6121262922e-30
KLTH0C05170g3.284ON5981262862e-29
Ecym_60211.244ON6001342862e-29
TPHA0A039603.284ON6151232826e-29
TBLA0I020003.284ON6641302826e-29
SAKL0G14014g5.158ON6051332827e-29
Kpol_1052.143.285ON6021182809e-29
Suva_2.716singletonON6031312801e-28
Skud_7.5255.158ON6031232782e-28
Suva_7.4855.158ON6031152764e-28
Kpol_1010.325.158ON5991302754e-28
Smik_16.1155.158ON6031232755e-28
KAFR0E018505.158ON5601162755e-28
NCAS0B079001.244ON6191312755e-28
KLTH0B02046g5.158ON5891332756e-28
KLLA0A06930g1.244ON5871322747e-28
Kpol_1052.163.284ON6131222721e-27
TBLA0G031203.284ON6731332712e-27
TBLA0B077605.158ON6581152693e-27
TPHA0A002405.158ON6031312693e-27
CAGL0L03267g1.244ON5971312684e-27
NCAS0I015203.285ON6141112685e-27
Ecym_8297na 5ON5691282651e-26
Ecym_2663na 3ON5891092642e-26
Kpol_543.791.244ON6051322624e-26
Kpol_534.221.368ON5921382598e-26
Kpol_543.78singletonON6051472572e-25
YGR191W (HIP1)5.158ON6031082572e-25
KLLA0F01012gna 5ON5561322553e-25
Kwal_33.154075.158ON5871262526e-25
KLLA0A11770g5.158ON5811342492e-24
NDAI0C029505.158ON6091122474e-24
SAKL0H08184gna 5ON5981122464e-24
TPHA0A047005.158ON5691002456e-24
KAFR0F04410singletonON5801352448e-24
Suva_15.1481.368ON5921792403e-23
ADL272Wna 5ON5641322403e-23
AFR230C1.244ON6041512403e-23
NCAS0A071105.158ON5921112393e-23
AGR319W5.158ON6261332394e-23
Smik_15.1461.368ON5931382385e-23
YOL020W (TAT2)1.368ON5921382378e-23
NCAS0A089201.368ON5991382369e-23
NDAI0D021605.158ON5871312342e-22
CAGL0B03773g5.158ON6051312333e-22
TDEL0B00130singletonON5841422323e-22
Ecym_27161.368ON5921382324e-22
TPHA0A025001.368ON5901392314e-22
NCAS0D018705.158ON5951152306e-22
KNAG0G009005.158ON6131172281e-21
KLLA0A10813g1.368ON5841382281e-21
YLL061W (MMP1)na 6ON5831422271e-21
KLTH0C08052gna 7ON5991712272e-21
AEL030W1.368ON5821632272e-21
SAKL0D04048gna 7ON5861422262e-21
KLTH0H13398g1.368ON5871392262e-21
Smik_11.3021.244ON553882236e-21
Ecym_47895.158ON5881102236e-21
TDEL0C00930singletonON5951312236e-21
Smik_12.2na 6ON5831422227e-21
Skud_15.1381.368ON5921382228e-21
CAGL0D02178g1.368ON5771342219e-21
TBLA0C012101.368ON6001392211e-20
TPHA0G03770singletonON6041422201e-20
Suva_16.18na 7ON5831422202e-20
KAFR0B00220singletonON5851422165e-20
NDAI0G060301.368ON5991382165e-20
AER405Cna 7ON4971342148e-20
ZYRO0D17952gna 7ON5851422131e-19
Ecym_4758na 7ON5871422122e-19
TBLA0I020103.285ON6281042122e-19
Suva_13.516singletonON2251422024e-19
Skud_47.1singletonON3281422031e-18
KLLA0B06776gna 7ON5881352032e-18
Suva_16.31singletonON5861331944e-17
YPL274W (SAM3)na 7ON5871421944e-17
TDEL0H04510singletonON5841421901e-16
TDEL0E00250singletonON5871421901e-16
Smik_6.483na 7ON5901441864e-16
TDEL0E05700singletonON5841421831e-15
Kwal_56.22951na 7ON5961451761e-14
SAKL0C02640gsingletonON5481191548e-12
SAKL0C02662g1.83ON5481171531e-11
Sklu_YGOB_Anc_1.3681.368ON541561512e-11
NCAS0E01810singletonON171781401e-10
ZYRO0F16632g1.84ON6071351432e-10
KNAG0L00110na 8ON5711311406e-10
Kpol_2000.641.84ON6101331327e-09
TPHA0B044701.84ON5991331327e-09
TBLA0A07060na 9ON6251541292e-08
KAFR0F02250singletonON5541321274e-08
CAGL0M00154gsingletonON5501321265e-08
TBLA0A054601.84ON6081331256e-08
CAGL0J08162g1.84ON5971331256e-08
NCAS0A006101.84ON6071331222e-07
TPHA0A04703singletonON106641142e-07
Kwal_33.15545na 9ON5761381203e-07
KNAG0F004801.84ON5971331203e-07
NDAI0F041901.84ON5991331203e-07
Ecym_10881.84ON5671441194e-07
TDEL0F02830na 10ON5611321185e-07
TDEL0C061701.84ON5731191186e-07
NCAS0A006001.83ON5441321186e-07
AFR667C1.84ON5631471177e-07
KAFR0D039401.83ON5971161177e-07
Skud_2.2603.397ON5981501178e-07
Kpol_358.3na 9ON5751301161e-06
SAKL0G14916gna 9ON5811511161e-06
CAGL0A01199gna 9ON6131321151e-06
KNAG0L02460singletonON5881341151e-06
KLLA0E16281gna 9ON6051211152e-06
Kwal_33.134011.83ON5591441142e-06
KAFR0B06430singletonON5931581142e-06
YNL268W (LYP1)1.84ON6111331132e-06
Kwal_33.134111.84ON5601421132e-06
KNAG0L02470singletonON6381201133e-06
Smik_6.473na 9ON6061581123e-06
KLTH0F02398g1.83ON5551311124e-06
KNAG0C05920singletonON5991191114e-06
Kwal_26.8097na 11ON5441361114e-06
Skud_14.711.84ON6121331115e-06
YBR132C (AGP2)3.397ON5961501115e-06
KLTH0F02420g1.84ON6211421106e-06
Suva_14.751.84ON6111331098e-06
NCAS0J00140na 8ON5581171099e-06
SAKL0B10956g7.44ON5721331081e-05
TPHA0M00130singletonON6111281072e-05
SAKL0C02684gsingletonON5881111062e-05
KLLA0C02365g1.84ON5791331062e-05
Ecym_10871.83ON5701391053e-05
Skud_16.12na 9ON6071321053e-05
ACL135Wna 9ON5881351053e-05
Suva_78.1singletonON231621033e-05
YPL265W (DIP5)na 9ON6081581043e-05
SAKL0C13992gsingletonON5521271044e-05
KLTH0D07128gna 11ON5431341027e-05
NDAI0I02660na 9ON5941331019e-05
Smik_14.681.84ON6111331019e-05
KLTH0E00550gsingletonON5231131011e-04
YOR348C (PUT4)7.44ON6271671001e-04
SAKL0C02728g1.84ON562871001e-04
Suva_14.731.83ON4971121001e-04
Smik_2.2723.397ON597150992e-04
Smik_15.5327.44ON631171992e-04
Skud_6.2na 8ON558119992e-04
YNL270C (ALP1)1.83ON573133992e-04
ZYRO0G07172gna 10ON567126982e-04
KAFR0C051607.44ON584101982e-04
Smik_5.241.83ON590119982e-04
Skud_15.5157.44ON626145983e-04
NCAS0D02260na 9ON597125983e-04
NDAI0A01340singletonON554123973e-04
Suva_16.40na 9ON606129974e-04
NCAS0E022607.44ON593166964e-04
KLTH0F11286g3.397ON582135955e-04
Ecym_80357.44ON563111948e-04
TPHA0H028507.44ON601159948e-04
Suva_8.4027.44ON683139930.001
Suva_4.3813.397ON590146930.001
NDAI0E038007.44ON621106920.001
Suva_5.41.83ON590118920.001
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F04210
         (170 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}             350   e-125
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   229   2e-71
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              206   4e-63
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   206   5e-63
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   206   7e-63
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   205   8e-63
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   205   9e-63
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   202   1e-61
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   201   5e-61
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   199   3e-60
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   196   1e-59
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   196   3e-59
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   192   1e-57
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   191   2e-57
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   190   3e-57
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   189   7e-57
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   190   7e-57
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   187   4e-56
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   187   5e-56
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   187   6e-56
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   186   1e-55
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   186   2e-55
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   185   5e-55
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      184   6e-55
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   184   8e-55
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              183   2e-54
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   183   3e-54
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   180   2e-53
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   173   1e-50
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   172   2e-50
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   170   7e-50
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   169   3e-49
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      168   5e-49
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   166   2e-48
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   166   3e-48
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   165   5e-48
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   165   9e-48
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   164   2e-47
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   157   3e-45
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   157   8e-45
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   154   4e-44
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   154   7e-44
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   153   1e-43
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   152   3e-43
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   146   7e-41
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   142   2e-39
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   141   3e-39
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   137   2e-37
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   134   1e-36
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   134   2e-36
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            133   2e-36
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   133   3e-36
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   132   8e-36
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   131   2e-35
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              130   4e-35
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   129   1e-34
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   127   6e-34
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   126   8e-34
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                126   1e-33
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   126   1e-33
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   125   2e-33
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   125   2e-33
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   125   2e-33
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   125   2e-33
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   125   3e-33
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   124   5e-33
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   124   6e-33
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   124   7e-33
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   123   1e-32
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   124   1e-32
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   123   2e-32
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   122   3e-32
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   122   4e-32
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   121   7e-32
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              121   7e-32
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   121   7e-32
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   120   9e-32
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   121   9e-32
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   120   1e-31
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   120   1e-31
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   120   1e-31
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   120   1e-31
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   119   3e-31
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   119   4e-31
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)     110   5e-31
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   119   6e-31
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   118   8e-31
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   117   2e-30
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   117   2e-30
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   117   2e-30
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   114   2e-29
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   114   2e-29
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              113   6e-29
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   113   6e-29
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   113   7e-29
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   112   9e-29
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   112   1e-28
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   111   2e-28
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   110   4e-28
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   110   4e-28
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   110   5e-28
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   110   5e-28
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   110   5e-28
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   110   6e-28
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   110   7e-28
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   109   1e-27
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              108   2e-27
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   108   3e-27
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   108   3e-27
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   107   4e-27
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              107   5e-27
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   106   1e-26
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   106   2e-26
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   105   4e-26
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   104   8e-26
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   103   2e-25
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   103   2e-25
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   102   3e-25
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   101   6e-25
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   100   2e-24
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    100   4e-24
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...    99   4e-24
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...    99   6e-24
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}               99   8e-24
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...    97   3e-23
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...    97   3e-23
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...    97   3e-23
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...    97   3e-23
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...    97   4e-23
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...    96   5e-23
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...    96   8e-23
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...    96   9e-23
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158     95   2e-22
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...    94   3e-22
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                 94   3e-22
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...    94   4e-22
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...    94   4e-22
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...    93   6e-22
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...    92   1e-21
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...    92   1e-21
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...    92   1e-21
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...    92   2e-21
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...    92   2e-21
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...    92   2e-21
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...    92   2e-21
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...    91   6e-21
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...    91   6e-21
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...    91   6e-21
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)     90   7e-21
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...    90   8e-21
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...    90   9e-21
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...    90   1e-20
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...    89   1e-20
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...    89   2e-20
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}       88   5e-20
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...    88   5e-20
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...    87   8e-20
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...    87   1e-19
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...    86   2e-19
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...    86   2e-19
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    82   4e-19
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)          83   1e-18
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...    83   2e-18
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...    79   4e-17
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...    79   4e-17
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...    78   1e-16
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                 78   1e-16
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...    76   4e-16
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...    75   1e-15
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...    72   1e-14
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...    64   8e-12
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...    64   1e-11
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...    63   2e-11
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    59   1e-10
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...    60   2e-10
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...    59   6e-10
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...    55   7e-09
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...    55   7e-09
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...    54   2e-08
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}               54   4e-08
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...    53   5e-08
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...    53   6e-08
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...    53   6e-08
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}               52   2e-07
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              49   2e-07
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...    51   3e-07
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                 51   3e-07
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...    51   3e-07
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...    50   4e-07
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...    50   5e-07
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...    50   6e-07
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...    50   6e-07
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...    50   7e-07
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...    50   7e-07
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...    50   8e-07
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...    49   1e-06
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...    49   1e-06
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...    49   1e-06
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}              49   1e-06
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...    49   2e-06
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...    49   2e-06
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...    49   2e-06
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...    48   2e-06
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...    48   2e-06
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}              48   3e-06
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...    48   3e-06
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...    48   4e-06
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}             47   4e-06
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...    47   4e-06
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...    47   5e-06
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...    47   5e-06
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...    47   6e-06
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...    47   8e-06
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}       47   9e-06
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...    46   1e-05
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}      46   2e-05
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...    45   2e-05
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...    45   2e-05
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...    45   3e-05
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...    45   3e-05
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...    45   3e-05
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...    44   3e-05
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...    45   3e-05
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...    45   4e-05
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...    44   7e-05
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...    44   9e-05
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...    44   9e-05
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...    44   1e-04
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...    43   1e-04
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...    43   1e-04
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...    43   1e-04
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...    43   2e-04
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...    43   2e-04
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)       43   2e-04
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...    43   2e-04
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...    42   2e-04
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...    42   2e-04
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...    42   2e-04
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...    42   3e-04
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}               42   3e-04
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}               42   3e-04
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...    42   4e-04
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44      42   4e-04
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...    41   5e-04
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...    41   8e-04
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...    41   8e-04
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...    40   0.001
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...    40   0.001
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44      40   0.001
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...    40   0.001
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...    40   0.001
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...    40   0.001
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...    40   0.002
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...    40   0.002
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...    39   0.003
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...    39   0.003
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    39   0.004
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...    39   0.005
Kpol_1051.17 s1051 (33628..35280) [1653 bp, 550 aa] {ON} (33628....    38   0.006
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}             38   0.006
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...    38   0.006
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...    38   0.006
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...    38   0.006
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...    38   0.007
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...    38   0.007
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...    38   0.008
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...    38   0.008
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...    38   0.008
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...    38   0.008
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...    38   0.008
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...    37   0.017
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...    37   0.021
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...    36   0.025
Ecym_6002 Chr6 complement(6585..7403) [819 bp, 272 aa] {ON} simi...    36   0.029
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...    36   0.031
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...    36   0.031
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...    36   0.031
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...    36   0.040
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...    36   0.042
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...    35   0.045
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)     35   0.054
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...    35   0.054
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...    35   0.060
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...    35   0.094
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}               35   0.10 
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...    34   0.11 
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...    34   0.12 
CAGL0J00407g Chr10 (31269..32894) [1626 bp, 541 aa] {ON} similar...    34   0.12 
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...    34   0.13 
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...    34   0.14 
NDAI0D01660 Chr4 complement(392421..394082) [1662 bp, 553 aa] {O...    34   0.16 
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...    34   0.18 
KAFR0J00500 Chr10 (87031..88581) [1551 bp, 516 aa] {ON} Anc_5.28...    33   0.21 
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...    33   0.23 
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...    33   0.25 
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}             33   0.27 
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...    33   0.27 
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...    33   0.27 
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...    33   0.32 
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...    33   0.34 
KNAG0H00820 Chr8 (127894..131364) [3471 bp, 1156 aa] {ON} Anc_3....    33   0.36 
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...    32   0.67 
KNAG0G02840 Chr7 (628866..630110) [1245 bp, 414 aa] {ON}               32   0.75 
Kwal_23.5609 s23 complement(1235848..1237380) [1533 bp, 510 aa] ...    32   0.78 
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...    32   1.0  
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    31   1.2  
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...    31   1.2  
AFR278W Chr6 (935183..936091) [909 bp, 302 aa] {ON} Syntenic hom...    31   1.6  
SAKL0F15224g Chr6 (1224823..1226328) [1506 bp, 501 aa] {ON} simi...    31   1.7  
KLTH0G06798g Chr7 (544397..545965) [1569 bp, 522 aa] {ON} simila...    31   1.9  
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...    31   2.0  
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...    30   2.3  
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...    30   2.3  
KLLA0D06919g Chr4 complement(595450..598068) [2619 bp, 872 aa] {...    30   3.5  
ZYRO0G16236g Chr7 complement(1332425..1333948) [1524 bp, 507 aa]...    29   4.9  
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...    29   5.6  
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...    29   5.7  
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...    29   5.8  
SAKL0H26048g Chr8 complement(2292824..2294482) [1659 bp, 552 aa]...    29   5.9  
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...    29   6.6  
CAGL0J00583g Chr10 (50462..52915) [2454 bp, 817 aa] {ON} similar...    29   6.6  
TDEL0B00460 Chr2 (81439..83121) [1683 bp, 560 aa] {ON} Anc_8.877...    29   7.2  
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...    29   8.5  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...    28   9.6  

>NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON} 
          Length = 170

 Score =  350 bits (899), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 170/170 (100%), Positives = 170/170 (100%)

Query: 1   MSYLYKSDARGDLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGEL 60
           MSYLYKSDARGDLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGEL
Sbjct: 1   MSYLYKSDARGDLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGEL 60

Query: 61  GFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGY 120
           GFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGY
Sbjct: 61  GFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGY 120

Query: 121 KIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYRGKLRNGPIWRRV 170
           KIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYRGKLRNGPIWRRV
Sbjct: 121 KIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYRGKLRNGPIWRRV 170

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  229 bits (583), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 123/132 (93%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           ICVSHVRFRRA+HVQ K  GELGF+SQVG WGSSYAAIM +CILIAQFWV IAPIG+GKL
Sbjct: 531 ICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKL 590

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
           + KN FENYLAMPILLALYFGYKIYTKNWTIFI+AKDIDL+SHRNIFDEEIIKQEE+EYR
Sbjct: 591 DAKNFFENYLAMPILLALYFGYKIYTKNWTIFIRAKDIDLVSHRNIFDEEIIKQEEEEYR 650

Query: 159 GKLRNGPIWRRV 170
            KLRNGP+WRRV
Sbjct: 651 EKLRNGPMWRRV 662

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  206 bits (524), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 111/133 (83%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFRRA+ VQ +   E+GFKSQVGVWGS YAAIM I  LIA+FWV IAPIG+  
Sbjct: 500 AICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMMILALIAEFWVSIAPIGEDH 559

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ +N FENYLAMPIL+ LYFGYKIY K+W +FI+AKDIDLISHR IFD E+++QEE+EY
Sbjct: 560 LDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIRAKDIDLISHRTIFDGELVRQEEEEY 619

Query: 158 RGKLRNGPIWRRV 170
           + KLRNGP W+RV
Sbjct: 620 KEKLRNGPKWKRV 632

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  206 bits (523), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 111/133 (83%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFRRA+ VQ +  GELGFKSQ GVWGS+YA IM I ILIAQFWV IAPIG+GK
Sbjct: 496 AICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILIAQFWVAIAPIGEGK 555

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ +  FENYLAMPIL+ALY GYK++ K+W +FI+A  IDL SHR IFDEE+IKQE++EY
Sbjct: 556 LDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHRQIFDEELIKQEDEEY 615

Query: 158 RGKLRNGPIWRRV 170
           R +LRNGP W+RV
Sbjct: 616 RERLRNGPYWKRV 628

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  206 bits (524), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 96/136 (70%), Positives = 112/136 (82%), Gaps = 3/136 (2%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG- 96
            IC+SH+RFRRA+HVQ +  GELGF+SQVG +GS+YAAIM   ILIAQFWV + PI    
Sbjct: 539 AICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINADL 598

Query: 97  --KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEE 154
             KL+ KN FENYLAMPILLA YFGYKI+ K+W +FI+AK+IDLISHRNIFDEE+IKQEE
Sbjct: 599 TIKLDAKNFFENYLAMPILLAFYFGYKIWKKDWKLFIRAKNIDLISHRNIFDEELIKQEE 658

Query: 155 DEYRGKLRNGPIWRRV 170
           DEYR +LR GP WRRV
Sbjct: 659 DEYRERLRTGPKWRRV 674

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  205 bits (522), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 90/133 (67%), Positives = 111/133 (83%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFRRA+ VQ +  GELGF+SQ GVWGS+YA IM I ILI QFWV IAPIG+GK
Sbjct: 496 AICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIMMILILIGQFWVAIAPIGEGK 555

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ +  FENYLAMPIL+ALY GYKI+ K+W +FI+A  IDLISHR IFDEE+IKQE++E+
Sbjct: 556 LDAQAFFENYLAMPILIALYVGYKIWKKDWKLFIRADKIDLISHRQIFDEELIKQEDEEF 615

Query: 158 RGKLRNGPIWRRV 170
           R +L+NGP W+RV
Sbjct: 616 RERLKNGPCWKRV 628

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  205 bits (521), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 109/133 (81%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC SH+RFRRA+ VQ +  GELGFKSQ GVWGS YA IM + ILI QFWV IAPIG+GK
Sbjct: 496 AICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMYACIMMLLILIGQFWVAIAPIGEGK 555

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ +  FENYLAMPIL+ALY GYKI+TK+W +FI+A  IDL SHR IFDEE+IKQE++EY
Sbjct: 556 LDAQAFFENYLAMPILIALYVGYKIWTKDWKLFIRADKIDLESHRQIFDEELIKQEDEEY 615

Query: 158 RGKLRNGPIWRRV 170
           R +LRNGP W+RV
Sbjct: 616 RERLRNGPYWKRV 628

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  202 bits (513), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 90/133 (67%), Positives = 107/133 (80%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFRRA+ VQ +  GELGFKSQ GVWGS Y+ IM I ILI QFWV IAPIG+GK
Sbjct: 496 AICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILILIGQFWVAIAPIGEGK 555

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ +  FENYLAMPIL+ LY GYK++ K+W +FI+A  IDL SHR IFDEE+IKQE+DEY
Sbjct: 556 LDAQAFFENYLAMPILIVLYVGYKMWNKDWKLFIRADKIDLTSHRQIFDEELIKQEDDEY 615

Query: 158 RGKLRNGPIWRRV 170
           R +LR GP WRRV
Sbjct: 616 RERLRTGPYWRRV 628

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  201 bits (510), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 110/133 (82%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            ICVSH+RFRRA+ VQ +   E+GFKSQVGVWGSSYAAIM    LIA+FWV IAPIG+  
Sbjct: 511 AICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDH 570

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ +N FENYLAMPIL+ LYFGYKI  ++W +FI+AKDIDL+SHR I+D E+IKQEE+E+
Sbjct: 571 LDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGELIKQEEEEF 630

Query: 158 RGKLRNGPIWRRV 170
           + +LRNGP W++V
Sbjct: 631 KERLRNGPFWKKV 643

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  199 bits (505), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 111/132 (84%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            ICVSH+RFRRA+ VQ +  GE+G+ SQ GV+GS+YAAIM    LIAQFWV IAPIG+GK
Sbjct: 500 TICVSHIRFRRAMQVQGRSLGEVGYLSQSGVYGSAYAAIMLFLALIAQFWVAIAPIGEGK 559

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ +N F+NYLAMPIL+A YFGY+++ ++W +FI+AKDIDL +HR IFDE I++QE++EY
Sbjct: 560 LDAENFFQNYLAMPILIAFYFGYRVWKRDWKLFIRAKDIDLDTHRQIFDENILRQEDEEY 619

Query: 158 RGKLRNGPIWRR 169
           + KLRNGP+WRR
Sbjct: 620 KEKLRNGPMWRR 631

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  196 bits (499), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 83/134 (61%), Positives = 112/134 (83%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F IC+SH+RFRRA+ VQ +  GE+GFKSQVG++GS Y+ +M + ILIAQFW  + P+G+G
Sbjct: 489 FSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEG 548

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           K + +  FENYLAMPI + LYFG+KI+ K+W +FI+A+DIDL+SHR IFDEE++KQE++E
Sbjct: 549 KPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFDEELLKQEDEE 608

Query: 157 YRGKLRNGPIWRRV 170
           YR KLR+GP+WRRV
Sbjct: 609 YRRKLRDGPMWRRV 622

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  196 bits (497), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 109/134 (81%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F IC+SHVRFR A+ VQ +  GE+GF SQ GV+GS YAA M I  L+AQFWV IAP+ +G
Sbjct: 501 FAICMSHVRFRYAMKVQGRSIGEVGFHSQTGVYGSLYAATMMILALMAQFWVAIAPLNEG 560

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           KL+ +N F++YLAMPIL+ALYFGYK+Y ++W ++IKA  IDLISHR IFDE I+KQE++E
Sbjct: 561 KLDAQNFFQSYLAMPILIALYFGYKLYYRDWKLYIKADKIDLISHRQIFDENILKQEDEE 620

Query: 157 YRGKLRNGPIWRRV 170
           Y+ KLRNGP WRR+
Sbjct: 621 YKEKLRNGPAWRRI 634

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  192 bits (487), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 84/134 (62%), Positives = 112/134 (83%), Gaps = 1/134 (0%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-G 96
            ICVSH+RFRRA+ VQ +  GE+GFK+Q+GV+GS YA IM +  LIAQFWV IAPIG+ G
Sbjct: 522 AICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVLALIAQFWVAIAPIGNNG 581

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
            L+ +  FENYLAMPIL+A YFGYK++ ++W +FI+AKDIDL S+R +FDEE++KQE++E
Sbjct: 582 DLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFDEELLKQEDEE 641

Query: 157 YRGKLRNGPIWRRV 170
           Y+ KL+NGP+W+RV
Sbjct: 642 YKEKLKNGPMWKRV 655

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  191 bits (485), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 84/134 (62%), Positives = 110/134 (82%), Gaps = 1/134 (0%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG- 96
            IC+SH+RFRRA+ VQ +  GE+G+KSQVGVWGS+YA +M +  LIAQFWV IAPIG G 
Sbjct: 525 TICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGG 584

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           KL  ++ FENYLAMPI +ALY  YK++ K+W++FI A  +DL+SHRNIFDEE++KQE++E
Sbjct: 585 KLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVDLVSHRNIFDEELLKQEDEE 644

Query: 157 YRGKLRNGPIWRRV 170
           Y+ +LRNGP W+RV
Sbjct: 645 YKERLRNGPYWKRV 658

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  190 bits (483), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 105/132 (79%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+SH+RFR A+  Q +  GE+GFK+Q G+WGS Y+  + I  LI QFWV IAPIG  +L
Sbjct: 491 ICLSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVAIAPIGTAEL 550

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             +N FENYLAMPIL+  YFGYKI+ K+WT++IKA+DIDLISHR IFDEE++KQE+ E +
Sbjct: 551 SARNFFENYLAMPILIGFYFGYKIWKKDWTLYIKAEDIDLISHRQIFDEELLKQEDYELK 610

Query: 159 GKLRNGPIWRRV 170
            KL+NGP+WRR+
Sbjct: 611 EKLKNGPVWRRI 622

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  189 bits (481), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 104/133 (78%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFR A+ VQ +  GE+G+ +Q GVWGS YA  M   I IAQFWV IAPIG G+
Sbjct: 510 AICLSHIRFRTAMKVQGRSLGEVGYLAQTGVWGSWYALFMMFLIYIAQFWVAIAPIGSGE 569

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L  +N FENYLAMPIL+ LY GYKIY K+WT+ IKA+DIDL SHR IFDE+++K+E+ EY
Sbjct: 570 LSAQNFFENYLAMPILIVLYLGYKIYYKDWTLLIKAEDIDLQSHRQIFDEDLLKEEDFEY 629

Query: 158 RGKLRNGPIWRRV 170
           R +L+NGP WRRV
Sbjct: 630 RQRLKNGPFWRRV 642

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  190 bits (482), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 110/134 (82%), Gaps = 1/134 (0%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG- 96
            IC+SH+RFRRA+ VQ +  GE+G+KSQVGVWGS+YA +M +  LIAQFWV IAPIG G 
Sbjct: 525 TICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMMLALIAQFWVAIAPIGGGG 584

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           KL  ++ FENYLAMPIL+ALY  +K++  +W++FI A  +DL+SHRNIFDEE++KQE++E
Sbjct: 585 KLSAQSFFENYLAMPILIALYIFFKVWKNDWSLFIPANKVDLVSHRNIFDEELLKQEDEE 644

Query: 157 YRGKLRNGPIWRRV 170
           Y+ +LRNGP W+R+
Sbjct: 645 YKERLRNGPYWKRI 658

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  187 bits (475), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 85/133 (63%), Positives = 105/133 (78%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFRRA+ VQ +  GELGFKSQVGVWGS YA  M + ILI QFW  IAPIG+GK
Sbjct: 476 AICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGK 535

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ +  FENYLAMPIL+ALYFGYK++ ++WT++I A  IDLIS+R IFDE+++KQE+ EY
Sbjct: 536 LDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDAEY 595

Query: 158 RGKLRNGPIWRRV 170
           R KLRN    RR 
Sbjct: 596 REKLRNSGWLRRA 608

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  187 bits (476), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 80/134 (59%), Positives = 109/134 (81%), Gaps = 1/134 (0%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG-DG 96
            IC+SH+RFR+ + VQ +  GE+G+KSQVGVWGS+YA ++ +  LI QFWV I+PIG D 
Sbjct: 525 TICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLALIGQFWVAISPIGGDK 584

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           KL  ++ FENYLAMPIL+ALY  YK++ ++W++FI A  IDL+SHRNIFDEE++KQE++E
Sbjct: 585 KLSAQSFFENYLAMPILIALYIFYKVWKRDWSLFIPADKIDLVSHRNIFDEELLKQEDEE 644

Query: 157 YRGKLRNGPIWRRV 170
           Y+ +LRNGP W+RV
Sbjct: 645 YKDRLRNGPFWKRV 658

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  187 bits (474), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 106/134 (79%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F IC+SH+RFR+A+ VQ +  GE+GFK+Q GVWGS Y   M + ILIAQFWV IAPIG+G
Sbjct: 485 FAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEG 544

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           KL+ +  FENYLAMPIL+  Y GYKI+ K+W++FI+A +IDL  HR IFDEE++KQE++E
Sbjct: 545 KLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFDEELLKQEDEE 604

Query: 157 YRGKLRNGPIWRRV 170
           YR KL+NG   +R+
Sbjct: 605 YREKLKNGGYLKRI 618

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  186 bits (472), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 105/133 (78%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFRRA+ VQ +  GELGFKSQVGVWGS YA  M + ILI QFW  IAPIG+GK
Sbjct: 476 AICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGK 535

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ +  FENYLAMPIL+ALYFGYK++ ++WT++I A  IDLIS+R IFDE+++KQE+ E+
Sbjct: 536 LDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDAEF 595

Query: 158 RGKLRNGPIWRRV 170
           R KLRN    RR 
Sbjct: 596 REKLRNSGWLRRA 608

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  186 bits (472), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 83/134 (61%), Positives = 108/134 (80%), Gaps = 1/134 (0%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG- 96
            IC+SH+RFRRA+ VQ +  GE+G+KSQVG+WGS YA +M +  LIAQFWV I+PIG G 
Sbjct: 523 TICLSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGG 582

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           KL  ++ FENYLAMPIL+ALY  YK++ K+WT+FI A  IDL++ R IFDEE++KQE++E
Sbjct: 583 KLSAQSFFENYLAMPILIALYVFYKVWKKDWTLFIPADKIDLVTDRQIFDEELLKQEDEE 642

Query: 157 YRGKLRNGPIWRRV 170
           Y+ KLRNGP W+RV
Sbjct: 643 YQEKLRNGPYWKRV 656

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  185 bits (469), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 105/134 (78%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F IC+SH+RFRRA+ VQ +  GE+G+ SQ G+ GS YAAIM I  LIAQFWV + P+G  
Sbjct: 538 FAICLSHLRFRRAMKVQGRSLGEMGYLSQTGILGSLYAAIMMILALIAQFWVALVPMGTH 597

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
             +  + F NYLAMPIL+  YFGYKI+ ++W +FI+AKDIDLISHR I+DEE+++QE++E
Sbjct: 598 TPDANSFFSNYLAMPILIVFYFGYKIWKRDWRLFIRAKDIDLISHRTIYDEELLRQEDEE 657

Query: 157 YRGKLRNGPIWRRV 170
           YR KLRNGP W+RV
Sbjct: 658 YREKLRNGPKWKRV 671

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  184 bits (467), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 78/133 (58%), Positives = 107/133 (80%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
           +IC+SH+RFRRA+ VQ +   E+G+KSQVGVWGS+YA +M I I+I Q WV I P+G+G 
Sbjct: 480 LICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGS 539

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            + +  F++YLAMP+ + LY GYKI+ ++W +FI+AKDIDLISHR+I D EI++QE +EY
Sbjct: 540 ADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEY 599

Query: 158 RGKLRNGPIWRRV 170
           + KLRNGP+WRRV
Sbjct: 600 QEKLRNGPVWRRV 612

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  184 bits (467), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 108/133 (81%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFRRA+HVQ +  GE+GFKS++GVWGS YAA M   +LIAQFWV +APIG  K
Sbjct: 505 AICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNK 564

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ ++ FE+YLAM +L+A Y GY  + K+WT+FI+AKDIDL  HR IFDE++++QE++E 
Sbjct: 565 LDAQSFFESYLAMLMLIAFYVGYMFWKKDWTLFIRAKDIDLDHHRQIFDEDVLRQEDEET 624

Query: 158 RGKLRNGPIWRRV 170
           + KLRNGP+W+R+
Sbjct: 625 KEKLRNGPLWKRI 637

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  183 bits (464), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 110/133 (82%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFRRA+HVQ +   ELGF+SQ+GVWGS YAA M    LIA+FWV IAPIG+  
Sbjct: 507 AICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDH 566

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ K+ FENYLAMPIL+  YFGYKIY ++W +FI+AK+IDLI+HRNIFD EII+QEE+EY
Sbjct: 567 LDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRNIFDAEIIRQEEEEY 626

Query: 158 RGKLRNGPIWRRV 170
           R +L+NGP W+R+
Sbjct: 627 REQLKNGPTWKRL 639

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  183 bits (464), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 80/134 (59%), Positives = 107/134 (79%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F ICVSH+RFRR + VQ +  GELGF++Q GV GS YAAIM    L+AQFWV + P+   
Sbjct: 529 FAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTH 588

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
            L+ +N F+NYLAMPILLALY G+K++ +++ +FI+AK+IDLISHR IFDEE+++QE++E
Sbjct: 589 TLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEE 648

Query: 157 YRGKLRNGPIWRRV 170
           Y+ KLRNGP W+RV
Sbjct: 649 YKEKLRNGPKWKRV 662

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  180 bits (457), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 113/133 (84%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFRRA+ VQ +  GE+GFKSQ GVWGS YA IM + ILIAQFWV IAPIG+G+
Sbjct: 504 AICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWGSWYAFIMMMLILIAQFWVAIAPIGEGR 563

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ +  FENYLA PIL+ALYFGYKIYTK+W +FI+AKDIDL  +R++FDEE+I+QEE+EY
Sbjct: 564 LDVQAFFENYLAAPILIALYFGYKIYTKDWRLFIRAKDIDLDINRDVFDEELIRQEEEEY 623

Query: 158 RGKLRNGPIWRRV 170
           + K+RN PIW+++
Sbjct: 624 KEKMRNAPIWQKI 636

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  173 bits (438), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 104/134 (77%), Gaps = 3/134 (2%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG--DG 96
           IC+SHVRFR+A+ VQ++  GELGF+SQVGVWGS Y   M I + I QFWV + P+G  DG
Sbjct: 483 ICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMILVFIGQFWVALFPVGGTDG 542

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
             + +N F NYLAMP+ LALYFG+KI+ K+W ++I A +IDLISHR IFDEEI+KQE++E
Sbjct: 543 A-DAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPASEIDLISHRKIFDEEILKQEDEE 601

Query: 157 YRGKLRNGPIWRRV 170
           Y+ K+++  IW ++
Sbjct: 602 YKIKMKHASIWVKL 615

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  172 bits (435), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 73/133 (54%), Positives = 100/133 (75%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFRRA+ +Q +   ELG+KSQVGVWGS YAA +   ILI QFWV + P+    
Sbjct: 461 TICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNG 520

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
               N F+ YLAMPILL  YFGYK + K+W +FI+AKDIDLISHR+I+DE+++KQE+++Y
Sbjct: 521 ANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQY 580

Query: 158 RGKLRNGPIWRRV 170
           +  L+NG +W ++
Sbjct: 581 KENLKNGSLWLKI 593

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  170 bits (431), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 99/132 (75%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           ICVSH+RFR+A+ VQ K  GELG+KSQ GV GS YA ++  C+L  QFWV IAP+G  KL
Sbjct: 460 ICVSHIRFRKALVVQGKSLGELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKL 519

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
           +  N FENYLAMPIL+ALYFGY+++ ++W ++I  + IDL+SHR +FDE+++KQE+ EY 
Sbjct: 520 DANNFFENYLAMPILIALYFGYRVWKRDWKLYIPLEQIDLVSHRKVFDEDLLKQEDAEYE 579

Query: 159 GKLRNGPIWRRV 170
             +RN     RV
Sbjct: 580 ESIRNSGWLSRV 591

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  169 bits (428), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 103/134 (76%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F ICVSH+R R A+ VQ +  GELGF+SQVG +GS YA ++ +  L+A+FWV +APIG+G
Sbjct: 495 FSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGSFYACLLLVLSLMAEFWVALAPIGEG 554

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           KL+ ++ FENYLA PI +  YFGY I+ K++ IFI++KDIDL   R +FDE++IKQE++E
Sbjct: 555 KLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFIRSKDIDLDFKRQVFDEDLIKQEDEE 614

Query: 157 YRGKLRNGPIWRRV 170
           Y  ++RN P WR+V
Sbjct: 615 YAEQMRNAPRWRKV 628

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  168 bits (426), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 70/133 (52%), Positives = 101/133 (75%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
           +I +SH+RFRRA+ VQ +   E+GFKSQ GVWGS YA +M I +LI QFWV I P+G+  
Sbjct: 480 IISLSHIRFRRAMKVQGRSLDEIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDS 539

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            +  + F+ YLAMP+ + LYFGYKI+ ++W +FI+AK+IDLI+HR+I+D E+++QE  E 
Sbjct: 540 ADAVSFFQAYLAMPVFIVLYFGYKIWNRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEM 599

Query: 158 RGKLRNGPIWRRV 170
           R + RN P+WR++
Sbjct: 600 RERARNAPLWRKI 612

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  166 bits (420), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 117/171 (68%), Gaps = 8/171 (4%)

Query: 1   MSYLYKSDARGDLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGEL 60
           ++++  SDA  D+     A L+ +  +S I  + S   IC+SHVRFR A+H Q    G++
Sbjct: 415 IAFVAASDAEEDI----FAWLLAISGLSQIFIWTS---ICLSHVRFRDAMHAQGLSLGQI 467

Query: 61  GFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GKLETKNLFENYLAMPILLALYFG 119
           G+KSQ G WGS +A ++++ +LIAQFWV IAPIG+ G+L  +  F+NYLA PILL  YFG
Sbjct: 468 GYKSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFG 527

Query: 120 YKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYRGKLRNGPIWRRV 170
           YK+Y K+W + I A ++DL SHRNI DEEI++QE+ E+  K+ N  IW R+
Sbjct: 528 YKVYHKDWRLCIPASEVDLSSHRNISDEEILRQEDYEWNEKMSNSSIWVRL 578

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  166 bits (420), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           ICVSH+RFR+A+ VQ KP GELG+KSQ GV GS YA  +  CILI QFWV IAP+G  KL
Sbjct: 471 ICVSHIRFRKALIVQGKPIGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKL 530

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
           +  + FENYLA+P+ + LYFG+KI+ ++W ++I  + IDL SHR  FDEE++KQE+ EY 
Sbjct: 531 DANSFFENYLALPLFVVLYFGFKIWKRDWRLYIPLEQIDLDSHRKTFDEELLKQEDAEYE 590

Query: 159 GKLRNGPIWRRV 170
             +RN    RR+
Sbjct: 591 ENIRNKGWLRRI 602

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  165 bits (418), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 72/132 (54%), Positives = 95/132 (71%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+SH+RFR+A+ VQ +    LGFK+Q GVWGS Y+A++ I   IAQFW  + P+G  K 
Sbjct: 470 ICISHIRFRKALLVQGRGWDGLGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKP 529

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             ++ FE YLA PI +ALYFGYKIY KNW +FI A+ IDL  HR IFD +++KQE+ EYR
Sbjct: 530 NAESFFEGYLAFPIFVALYFGYKIYNKNWQLFIPAEKIDLDLHRKIFDADVLKQEDAEYR 589

Query: 159 GKLRNGPIWRRV 170
            KLR+  +W R+
Sbjct: 590 AKLRDSSMWHRI 601

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  165 bits (417), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 97/133 (72%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFRRA+ VQ    GE+GFKSQVG++GS YAA M I  LIAQFWV +APIG   
Sbjct: 497 AICISHLRFRRALKVQGHSLGEIGFKSQVGIYGSLYAATMLILALIAQFWVALAPIGGNG 556

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ +N F+NYLAMPILL LYFGYKI  ++W  +I A  IDL+SHR +FDE+I+KQE  E 
Sbjct: 557 LDARNFFQNYLAMPILLVLYFGYKIRKRDWKFWIPAHRIDLVSHRKVFDEDILKQEVAEI 616

Query: 158 RGKLRNGPIWRRV 170
             + +N    R++
Sbjct: 617 EQEKKNLSTGRKI 629

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  164 bits (415), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+SH+RFRRA+ VQ   T ELGFK+Q G+ GS  +AIM +  LI QFWV + P+G  +
Sbjct: 472 TICLSHIRFRRALAVQGYSTDELGFKAQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATE 531

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            + ++ F  YLAMP+ L  YFGYKI+ K+W +FI+A  IDL+SHR IFD +++KQE+ EY
Sbjct: 532 PDAESFFTGYLAMPMFLLFYFGYKIWNKDWRLFIRADQIDLVSHRRIFDADVLKQEDIEY 591

Query: 158 RGKLRNGPIWRRV 170
           R KLRN  IW R+
Sbjct: 592 RAKLRNSSIWHRI 604

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  157 bits (398), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 70/133 (52%), Positives = 101/133 (75%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG-K 97
           IC+SHVRFR A+  Q +  GE+G+KSQ G WGS +A I+++ +L+AQFWV IAPIG+G K
Sbjct: 438 ICLSHVRFRDAMKAQGRSLGEVGYKSQTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGK 497

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L  K+ F++YLA P+L+ +YFGYKIY K+W + I A ++DL SHR IFDE+ +KQE+ ++
Sbjct: 498 LSAKDFFQSYLAAPVLIFIYFGYKIYYKDWRLCIPATEVDLNSHRKIFDEDELKQEDLDW 557

Query: 158 RGKLRNGPIWRRV 170
           + K+R   IW ++
Sbjct: 558 KEKMRTASIWVKI 570

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  157 bits (397), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 101/132 (76%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+SH+RFRRA+ VQ +  GE GF SQVG++GS+Y+  +   IL+ QFWV + P+G  K+
Sbjct: 498 ICLSHLRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALILVGQFWVALKPVGSKKV 557

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
           +  + FENYLA PI +ALY GYK YTK+W ++IK++DIDL++HR I+DE+I++QE +E  
Sbjct: 558 DANSFFENYLAAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAHRQIYDEDILRQEREEET 617

Query: 159 GKLRNGPIWRRV 170
            +L+NGP W+R 
Sbjct: 618 ERLKNGPYWKRA 629

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  154 bits (389), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 67/132 (50%), Positives = 96/132 (72%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+SH+RFR A+  Q +  GE+G+K++ G WGS  A +    ILIAQFWV I+P+    +
Sbjct: 437 ICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSWIAVVTAFLILIAQFWVAISPVETKGV 496

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
           + ++ F++YLA PILL  YFGYKIY K+W I I A ++DLISHR +FDE+ +KQE+ E++
Sbjct: 497 DARSFFQSYLAFPILLLAYFGYKIYHKDWRICIPASEVDLISHRQVFDEDELKQEDLEWK 556

Query: 159 GKLRNGPIWRRV 170
            KL++ PIW R+
Sbjct: 557 LKLKSSPIWVRI 568

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  154 bits (389), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 69/133 (51%), Positives = 96/133 (72%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F I +SHVRFRR++ VQ +   ELG++S  GVWG+ YA IM + ILI QFWV I+P+G  
Sbjct: 466 FSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSN 525

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           KL+  N FENYLAMPIL+ LY GYK++ ++W + I A ++DL+SHR IFD EI++ E+ E
Sbjct: 526 KLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLE 585

Query: 157 YRGKLRNGPIWRR 169
            + +LR+    +R
Sbjct: 586 EKEQLRHASWTKR 598

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  153 bits (387), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 93/129 (72%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F I +SHVR RRA+ VQ +   ELG+ +  GVWG+ YA  M + IL+ QFWV I+P+G  
Sbjct: 460 FSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN 519

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           KL+  N FENYLAMPIL+ LY GYKI+T++W + I + ++DL++HR IFD E+++ E+ E
Sbjct: 520 KLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLE 579

Query: 157 YRGKLRNGP 165
            + +LR+ P
Sbjct: 580 EKEQLRHAP 588

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  152 bits (384), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 68/132 (51%), Positives = 93/132 (70%), Gaps = 1/132 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG-K 97
           I +SH+RFR A+  Q +  GELG+K+  G WGS YA    I +L AQFWV IAPIG+G K
Sbjct: 457 ISLSHIRFRDAMKTQGRSLGELGYKANTGYWGSWYAIAFNIIVLAAQFWVAIAPIGNGGK 516

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+  N F+NYLA P+L+  YFGYK++ ++W +FI A  +DL SHR IFD ++IKQE+ E+
Sbjct: 517 LDVNNFFQNYLAFPVLVFFYFGYKLWYRDWKLFIPADKVDLESHRKIFDADLIKQEDFEH 576

Query: 158 RGKLRNGPIWRR 169
           + ++RN   W R
Sbjct: 577 KERIRNSSFWVR 588

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  146 bits (368), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 65/134 (48%), Positives = 93/134 (69%), Gaps = 1/134 (0%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG- 96
            IC+SHVRFR A+  Q     ELG+KS+ G WGS YA    I + +AQFWV +APIG+G 
Sbjct: 463 AICLSHVRFRDAMKYQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGG 522

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           K + +  F++YLA PI ++ Y GYKIY+K W + +   +IDL SHR+IFD+ I++QE+DE
Sbjct: 523 KADAEAFFQSYLAFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQEDDE 582

Query: 157 YRGKLRNGPIWRRV 170
           ++ KL+N   W ++
Sbjct: 583 HKEKLKNSGWWVKM 596

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  142 bits (358), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 95/133 (71%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPI-GDGK 97
           I VSHVRFRRA+ VQ +  GELG+++  G  GS YA    + +LIAQFW+ IAPI   G+
Sbjct: 449 IAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGE 508

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+ +  F+NYLA P+L+  Y GYK++ +++ + I + ++DL+SHR IFDEE++ QEE E 
Sbjct: 509 LDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAER 568

Query: 158 RGKLRNGPIWRRV 170
           + +LRN  +++R+
Sbjct: 569 KERLRNSTLFKRL 581

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  141 bits (356), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 66/133 (49%), Positives = 93/133 (69%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GK 97
           I  SHVRFR A+ VQ K   ELG+K+  GVWGS+Y A   + +LIAQFWV +APIG+ GK
Sbjct: 459 IMFSHVRFRAAMKVQGKDINELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGK 518

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            + +  FE+YLA PI +A YFGY IY K++T+      IDL S+R I+D E+IKQE++E 
Sbjct: 519 CDAEAFFESYLAFPIWVACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEEN 578

Query: 158 RGKLRNGPIWRRV 170
           +  L++ P++ ++
Sbjct: 579 KENLKSRPLYYKI 591

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  137 bits (344), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 91/133 (68%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG-K 97
           I +SH+RFR+A+ VQ +   ELG+K+  G+WGS Y     I + +AQFWV +AP+G+G K
Sbjct: 472 IMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGK 531

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            + ++ F+NYLA PI LA YFGY +Y +++T+      IDL  HR I+D E+++QE++E 
Sbjct: 532 CDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQEDEEN 591

Query: 158 RGKLRNGPIWRRV 170
           + KLRN  + R+ 
Sbjct: 592 KEKLRNMSLMRKA 604

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  134 bits (338), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 62/133 (46%), Positives = 88/133 (66%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG-K 97
           I  SHVRFR A+ VQ+K   E+G+K+  G++GS + +I  + +LIAQFWV ++P G G  
Sbjct: 470 IMFSHVRFRLAMKVQNKDIDEVGYKATAGIYGSWFGSIFGVLVLIAQFWVALSPPGSGGA 529

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           +  ++ FENYLAMPI +  Y  Y +Y K WTI      IDL +HR I+D ++I+QE+ E 
Sbjct: 530 VSAESFFENYLAMPIWVFFYIVYSVYNKEWTILTDLSKIDLDAHRRIYDPDLIRQEDAEN 589

Query: 158 RGKLRNGPIWRRV 170
           + KL+N P W RV
Sbjct: 590 KEKLKNSPFWVRV 602

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  134 bits (337), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 90/133 (67%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GK 97
           I +SH+RFR+A+ VQ +  GELG+K+  G+WGS Y     I + +AQFWV ++PIG+ GK
Sbjct: 467 IMLSHIRFRKAMKVQGRSLGELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGK 526

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            + +  FE YLA P+ + +Y GY +Y K++T+      IDL  HR ++D EI++QE++E 
Sbjct: 527 CDVQAFFEGYLAAPLWIFMYLGYMLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586

Query: 158 RGKLRNGPIWRRV 170
           + KLRN  I+ R+
Sbjct: 587 KEKLRNSSIFFRM 599

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  133 bits (335), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 61/133 (45%), Positives = 87/133 (65%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG-K 97
           I +SH+RFR+A+    K T E+GFK+  G+WGS Y     I + IAQFWV ++P G G K
Sbjct: 434 IMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNILVFIAQFWVALSPPGSGGK 493

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            + +  F++YLA PI L  YFGY IY +++TI    + IDL  HR I+D + IKQE++E 
Sbjct: 494 CDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNPLEKIDLDFHRRIYDPDFIKQEDEEN 553

Query: 158 RGKLRNGPIWRRV 170
           + +L+N  IW R+
Sbjct: 554 KERLKNSSIWARI 566

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  133 bits (334), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 55/132 (41%), Positives = 89/132 (67%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SH+RFR+A+ +Q+K   E+G+KS  GV+GS +     + + +AQFWV +AP    ++
Sbjct: 456 IMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYTEM 515

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
                FE+YLA PI  A YFGY I+ +++T+F   + +DL  HR I+D E++KQE++E +
Sbjct: 516 SADTFFESYLAFPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYDPELVKQEDEEKK 575

Query: 159 GKLRNGPIWRRV 170
             L+N P+W+R+
Sbjct: 576 EMLKNSPMWKRM 587

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  132 bits (331), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 88/132 (66%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+SH RFR+A+ +Q +    LG+++  G WGS YA    + + IAQFWV + PI   K+
Sbjct: 444 ICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKV 503

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
           +  + F+NY+A P+ L ++ GY +Y++NWT+      +DL +HR ++D E++KQEE E++
Sbjct: 504 DVLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFK 563

Query: 159 GKLRNGPIWRRV 170
            ++RN P + +V
Sbjct: 564 ERMRNSPWYVKV 575

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  131 bits (329), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 57/133 (42%), Positives = 91/133 (68%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG-DGK 97
           I +SH+RFR+A+ VQ +   E+G+KS  G+WGS Y  I  I + +AQFWV ++P G DGK
Sbjct: 467 IMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDGK 526

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            + ++ F++YLA P+ + +Y GY IY K++T+      IDL  HR ++D EI++QE++E 
Sbjct: 527 CDVESFFQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586

Query: 158 RGKLRNGPIWRRV 170
           + +LRN  ++ R+
Sbjct: 587 KERLRNSSVFFRM 599

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  130 bits (327), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 83/132 (62%), Gaps = 1/132 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SHVRFR+A+ VQ +   ELG+K+  GVWGS Y     I +  AQFWV +AP G  K 
Sbjct: 482 IMLSHVRFRQAMKVQGRDLNELGYKAVSGVWGSVYGVFFNILVFFAQFWVALAPPGS-KP 540

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
              + FE+YLA PI    YFGY ++ K++T  I  + IDL  HR ++D E I+QE +E +
Sbjct: 541 TALSFFESYLAFPIFFTFYFGYMLWNKDFTFLIPLESIDLDFHRRVYDPEFIRQEREEKK 600

Query: 159 GKLRNGPIWRRV 170
            KL+N  IW R+
Sbjct: 601 IKLKNSSIWTRM 612

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  129 bits (324), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 86/133 (64%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG-DGK 97
           I +SH+RFR+A+ VQ +   ELG+K+  G+WGS Y     I + IAQFWV +AP+G DG+
Sbjct: 472 IMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGR 531

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
              ++ FE+YLA PI L  +FGY IY +++T+      IDL  HR I+D E+I+QE+ E 
Sbjct: 532 CSVESFFESYLAAPIWLTFFFGYMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQEN 591

Query: 158 RGKLRNGPIWRRV 170
             K +N  + R+ 
Sbjct: 592 EEKTKNMSLMRKA 604

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  127 bits (318), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 105/170 (61%), Gaps = 8/170 (4%)

Query: 1   MSYLYKSDARGDLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGEL 60
           ++++ +SD  G++    +AL       S ++   +   IC+ H+RFRRA+  Q + T EL
Sbjct: 434 IAFVAQSDKEGEVFDWLMAL-------SGLSSLFTWATICLCHIRFRRALAAQGRSTNEL 486

Query: 61  GFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGY 120
            F S  GVWG+++   + I +L AQF+V + P+G       + F+ YL++PI+LA++ G+
Sbjct: 487 AFASPAGVWGAAWGLFLCIIMLAAQFYVALFPLG-APPSANDFFQGYLSLPIVLAMWLGH 545

Query: 121 KIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYRGKLRNGPIWRRV 170
           KI+ KNW +FIKA+D+D+ + R   D ++++Q+ +E R  L   P+W R+
Sbjct: 546 KIWKKNWKLFIKAEDMDIDTGRRELDLDLLRQQVEEERAALAAKPMWYRI 595

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  126 bits (317), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 86/133 (64%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GK 97
           I +SH+RFR+A+ VQ +   E+G+K+  G+WGS Y     I + +AQFWV ++PIG+ GK
Sbjct: 467 IMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGK 526

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
              +  FE+YLA P+ L +Y GY +Y +++T       IDL  HR ++D EII+QE +E 
Sbjct: 527 CNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHRRVYDPEIIRQENEEN 586

Query: 158 RGKLRNGPIWRRV 170
           + +L+N   + R+
Sbjct: 587 KERLKNSSFFFRI 599

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  126 bits (316), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 86/133 (64%), Gaps = 1/133 (0%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            I +SH+RFR A+ VQ K   ELG+K+  GVWGS +     + + IAQFWV ++P G G 
Sbjct: 446 TILLSHIRFRMAMKVQGKDLNELGYKALTGVWGSMWGFGFCVLVFIAQFWVALSPPG-GT 504

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           +  +  FE+YLA P+ L  YF Y ++ +++T   K +DIDL +HR I+D E ++QE++E 
Sbjct: 505 ISAEGFFESYLAFPLWLFFYFAYMLWKRDFTFLTKLEDIDLDAHRRIYDPEFLRQEDEER 564

Query: 158 RGKLRNGPIWRRV 170
           + K+RN   W ++
Sbjct: 565 KEKIRNSSFWIKM 577

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  126 bits (316), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 85/126 (67%), Gaps = 1/126 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GK 97
           I +SH+RFR+A+ VQ +   ELG+K+  G+WGS Y +   I + IAQFWV +AP+G+ GK
Sbjct: 472 IMLSHLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNILVFIAQFWVALAPLGNGGK 531

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
              +  FE+YLA PI L  Y GY IY +++T+      IDL  HR ++D E+++QE++E 
Sbjct: 532 CNAEAFFESYLAAPIWLIFYIGYMIYNRDFTLLNPLDKIDLDFHRRVYDPELMRQEDEEN 591

Query: 158 RGKLRN 163
           + K++N
Sbjct: 592 KEKIKN 597

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  125 bits (315), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 54/133 (40%), Positives = 89/133 (66%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GK 97
           I +SH+RFR+A+ VQ +   E+G+K+  G+WGS Y     + + +AQFWV ++PIG+ GK
Sbjct: 467 IMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGK 526

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            + +  FE+YLA P+ + +Y GY +Y +++T       IDL  HR ++D EI++QE++E 
Sbjct: 527 CDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEEN 586

Query: 158 RGKLRNGPIWRRV 170
           + +L+N  I+ RV
Sbjct: 587 KERLKNSSIFVRV 599

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  125 bits (315), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 85/130 (65%), Gaps = 1/130 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVI-APIGDGK 97
           I +SHVRFR A+ VQ K   ELG+KS  GVWGS+Y    ++ +  AQFWV + AP   GK
Sbjct: 483 IMLSHVRFRAAIKVQGKDINELGYKSNTGVWGSAYGVFFSLLVFAAQFWVALSAPNSGGK 542

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
               + F++YLA+PI L  Y G+ ++T+++T  I    +DL S+R  +D E+++QE++E+
Sbjct: 543 CSASDFFQSYLALPIWLTFYVGFMLWTRDFTFLIPLNKVDLDSYRRYYDPELLRQEDEEH 602

Query: 158 RGKLRNGPIW 167
           +  +++  IW
Sbjct: 603 KQAMKSASIW 612

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  125 bits (314), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 85/132 (64%), Gaps = 1/132 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SHVRFR+A+ +Q +   E+G+ +  G WGS Y  +  I + IAQFWV +AP     +
Sbjct: 472 IMLSHVRFRQAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAP-PKSPI 530

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             ++ FE+YLA PI +A YFGY I+ K++T       IDL  HR I+D E++KQE+ E +
Sbjct: 531 TAQSFFESYLAFPIWIAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQEDMENK 590

Query: 159 GKLRNGPIWRRV 170
            ++RNG IW ++
Sbjct: 591 ERVRNGNIWTKL 602

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  125 bits (314), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 85/132 (64%), Gaps = 1/132 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           ICV H+RFRRA+ VQ + T EL +K+Q G+WGS Y   +   +L  QFWV + PIG G  
Sbjct: 466 ICVCHLRFRRALSVQGRSTDELSYKAQTGIWGSLYGIGLIFIVLCFQFWVALFPIG-GSP 524

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
              + F  YL++P+++  Y  +K+YT++WT  IK+ DID+ + R   D E++KQE  E +
Sbjct: 525 NANHFFSAYLSLPVVIFFYTCHKLYTRSWTFLIKSSDIDIDTGRREMDLELLKQEIQEEQ 584

Query: 159 GKLRNGPIWRRV 170
             +R+ PIW R+
Sbjct: 585 QYIRSKPIWYRI 596

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  125 bits (313), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 66/170 (38%), Positives = 99/170 (58%), Gaps = 8/170 (4%)

Query: 1   MSYLYKSDARGDLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGEL 60
           +S++ +S+  GD+    LAL       S ++   S   IC+ H+RFRRA+  Q + T EL
Sbjct: 427 LSFIAQSEKEGDVFNWLLAL-------SGLSTLFSWGAICICHIRFRRALSAQGRSTDEL 479

Query: 61  GFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGY 120
            F S  G+ GS +  I+ + +LIAQFWV + PIG G    ++ F  YL+ P+LLA Y  +
Sbjct: 480 AFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIG-GSPNAEDFFSAYLSFPVLLAFYIFH 538

Query: 121 KIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYRGKLRNGPIWRRV 170
           KI+ +NW +F +AKDID+ + R   D E ++QE  E +  L   P W R+
Sbjct: 539 KIWKRNWKLFTRAKDIDIDTGRREMDTEALRQEIAEEKMLLSTRPWWYRL 588

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  124 bits (311), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 83/126 (65%), Gaps = 1/126 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPI-GDGK 97
           I +SH+RFR A+ VQ K   ELG+++  G+WGS Y+    + + IAQFWV ++P   +GK
Sbjct: 459 IFISHIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGK 518

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            + +  FE+YLA P+ L  YFGY IY++++T       IDL  HR I+D E+++QE+ E 
Sbjct: 519 YDAEGFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDKIDLDFHRRIYDPELLRQEDAET 578

Query: 158 RGKLRN 163
           + +LRN
Sbjct: 579 KERLRN 584

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  124 bits (311), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 54/133 (40%), Positives = 87/133 (65%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG-DGK 97
           I +SHVRFR+ + +  +   E+GF++  G+WGS Y     + + IAQFWV +AP    GK
Sbjct: 456 IMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGK 515

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           ++ ++ F++YLA PI L  YFGY +Y +++T  +    IDL  HR I+D E+I+QE++E 
Sbjct: 516 VDAESFFQSYLAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEEN 575

Query: 158 RGKLRNGPIWRRV 170
           + K++N  +W R+
Sbjct: 576 KEKIKNSSVWVRM 588

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  124 bits (311), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 85/137 (62%), Gaps = 12/137 (8%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GK 97
           + +SH+RFR A+  Q +   E+G+K+Q G WGS  A ++ +  L+ QFWV IAP+ D GK
Sbjct: 466 MSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAVFFLVCQFWVAIAPVNDHGK 525

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIF-----------D 146
           L  K  F+NYLAMPI+L  YFG+KIY K+W+ +I A  IDL SHRNIF           D
Sbjct: 526 LNVKVFFQNYLAMPIVLVAYFGHKIYFKSWSFWIPADKIDLNSHRNIFVHSTLTEFDKAD 585

Query: 147 EEIIKQEEDEYRGKLRN 163
           +++ + E  E    L N
Sbjct: 586 DDVKEYENQESLENLNN 602

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  123 bits (309), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 85/131 (64%), Gaps = 1/131 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+ H+RFRRA+  Q + T EL F S  GVWGS Y  ++ + IL AQFW+ + PIG    
Sbjct: 458 ICICHLRFRRALSAQGRSTDELSFVSPAGVWGSIYGTVLIMLILAAQFWIALFPIGSPP- 516

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
           + K+ FE+YL++P++L +Y G+K Y +NW +FI+A++ID+ + R   D E +K E  E +
Sbjct: 517 DAKDFFESYLSLPVVLVMYIGHKCYKRNWKLFIRAENIDIDTGRREVDIEALKVELAEEK 576

Query: 159 GKLRNGPIWRR 169
             L +  +W R
Sbjct: 577 AVLASKSLWIR 587

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  124 bits (310), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 84/133 (63%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG-DGK 97
           I +SHVRFR A+ +Q++   ELG+K+  G++GS Y     + +  AQFW  + P G DGK
Sbjct: 497 IMLSHVRFRMAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGK 556

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
               + F NYLAMPI L  YFGY ++T+++ +      IDL  HR I+D E+++QE++E 
Sbjct: 557 ANANSFFANYLAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEES 616

Query: 158 RGKLRNGPIWRRV 170
           + +LRNG    R+
Sbjct: 617 KERLRNGSFMMRM 629

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  123 bits (308), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 85/132 (64%), Gaps = 1/132 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I + H+R RRA+  Q++ T EL F +  GVWGS Y  ++ I IL+AQFW+ + PIGD K 
Sbjct: 452 IMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIGD-KP 510

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
                FE YL+ PIL+A Y G+KI+ KNW +FI+AK+ID+ + R   D E +KQE  E +
Sbjct: 511 SASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEIAEEK 570

Query: 159 GKLRNGPIWRRV 170
             + + P + R+
Sbjct: 571 AFIASKPFYYRM 582

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  122 bits (306), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 86/133 (64%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GK 97
           I +SH+RFR+A+ VQ +   ELG+K+  G+WGS+Y     I + IAQFWV +AP+ + GK
Sbjct: 472 IMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGK 531

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
              ++ F++YLA PI +A Y GY IY +++T       IDL  HR+I+D E+++QE+ E 
Sbjct: 532 CSAESFFQSYLAFPIWIAFYLGYMIYNRDFTFLNPLDKIDLDFHRHIYDPELMRQEDLEN 591

Query: 158 RGKLRNGPIWRRV 170
             + R+  + R+ 
Sbjct: 592 EERKRDMSLMRKT 604

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  122 bits (305), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 55/120 (45%), Positives = 80/120 (66%), Gaps = 2/120 (1%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG-DGK 97
           ICVSH+RFR A+ VQ  P  E+ +K+Q G WGS  A  + + +L+ QFWV IAP+G  GK
Sbjct: 462 ICVSHIRFRDAMRVQGHPLTEIAYKAQTGYWGSYVAIALALFVLVCQFWVAIAPVGAHGK 521

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIF-DEEIIKQEEDE 156
           L+  N F+NYLA P++L  Y G+K+Y K W + I A  I+L ++RN++  EE ++ +  E
Sbjct: 522 LDATNFFQNYLAFPVVLCAYLGFKVYYKQWQLLIPADKIELDNNRNVYVPEEALEDKPLE 581

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  121 bits (303), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 54/132 (40%), Positives = 83/132 (62%), Gaps = 1/132 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+ H+RFR+A+  Q +   EL FKS  GVWGS +   M + + IAQF+V + P+G    
Sbjct: 467 ICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGASP- 525

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             +  FE YL+ P+++A+Y G+KIY +NW +FI A+D+D+ + R   D E++KQE  E +
Sbjct: 526 SAEGFFEAYLSFPLVVAMYLGHKIYKRNWKLFIPAEDMDIDTGRREVDLELLKQEIAEEK 585

Query: 159 GKLRNGPIWRRV 170
             +   P W R+
Sbjct: 586 AIMATKPKWYRI 597

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  121 bits (303), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 81/127 (63%), Gaps = 1/127 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GK 97
           I +SHVRFR A+  Q K   ELG+ S  G+WGS Y     + + IAQFWV ++P G  G 
Sbjct: 458 ILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGV 517

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
              +  FE+YLA P+ L  Y GY +Y++++T     K IDL +HR ++D E+++QE++E 
Sbjct: 518 YSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEET 577

Query: 158 RGKLRNG 164
           + ++RNG
Sbjct: 578 KERIRNG 584

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  121 bits (303), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 82/132 (62%), Gaps = 1/132 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           ICV H+RFR+ +  Q + T EL FK+Q G+WGS Y   +   +L  QFWV + P+     
Sbjct: 461 ICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPLSKSP- 519

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
              + FE YL++P+++  Y G+K+Y++NW + I AK++DL + R   D E++KQE  E  
Sbjct: 520 SAYHFFEQYLSLPVVIVFYMGHKVYSRNWRLVIPAKELDLDTGRREVDLELLKQEIKEEN 579

Query: 159 GKLRNGPIWRRV 170
             +R+ PIW R+
Sbjct: 580 ESIRSRPIWYRI 591

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  120 bits (302), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 83/125 (66%), Gaps = 1/125 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG-K 97
           IC+SH RFRRA+ +Q +    LG++S  G WGS YA +  + +LIAQ WV + P+ +G K
Sbjct: 452 ICLSHFRFRRAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGK 511

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
              K+LF++ LA+P+ L++  GY I TKNWTI      I + SHR  +D E++KQE+ EY
Sbjct: 512 FSVKSLFKSCLALPLWLSMAVGYMIVTKNWTILNPLSSISVDSHRRSYDVEVMKQEDLEY 571

Query: 158 RGKLR 162
           + K++
Sbjct: 572 KQKMK 576

>YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}
           TAT1Amino acid transport protein for valine, leucine,
           isoleucine, and tyrosine, low-affinity tryptophan and
           histidine transporter; overexpression confers FK506 and
           FTY720 resistance
          Length = 619

 Score =  121 bits (303), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 57/106 (53%), Positives = 76/106 (71%), Gaps = 1/106 (0%)

Query: 41  VSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GKLE 99
           +SH+RFR A+  Q +   E+G+K+Q G WGS  A ++ I  L+ QFWV IAP+ + GKL 
Sbjct: 468 LSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAIFFLVCQFWVAIAPVNEHGKLN 527

Query: 100 TKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIF 145
            K  F+NYLAMPI+L  YFG+KIY K+W+ +I A+ IDL SHRNIF
Sbjct: 528 VKVFFQNYLAMPIVLFAYFGHKIYFKSWSFWIPAEKIDLDSHRNIF 573

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  120 bits (302), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 78/108 (72%), Gaps = 1/108 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GK 97
           +C+SH+RFR A+  Q +   E+G+K+Q G WGS  A ++ +  L+ QFWV IAP+ + GK
Sbjct: 466 MCLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGK 525

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIF 145
           L+ K  F+NYLAMPI+L  YFG+K+Y K+W  +I A+ IDL SHRN++
Sbjct: 526 LDVKVFFQNYLAMPIVLLAYFGHKMYFKSWRFWIPAEKIDLDSHRNVY 573

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  120 bits (302), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 82/132 (62%), Gaps = 1/132 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+ H+RFRRA+  Q + T EL F S VGVWGS +  I+   + IAQFW+ + P+G G  
Sbjct: 461 ICICHLRFRRALAAQGRSTDELAFTSYVGVWGSYFGVILICLVFIAQFWIAVWPMG-GTP 519

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
              + F+ YL++ ++L  Y  +K+YT+NWT   +AKDID+ + R   D + +KQE  E +
Sbjct: 520 NASDFFQAYLSVVVVLFFYLAHKLYTRNWTFAKRAKDIDIDTGRRELDLDALKQEIAEEK 579

Query: 159 GKLRNGPIWRRV 170
            +L   P W RV
Sbjct: 580 LRLSTKPWWYRV 591

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  120 bits (302), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 82/132 (62%), Gaps = 1/132 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+ H+RFR+A+  Q +   EL FKS  GVWGS +   M + + IAQF+V + P+ +G  
Sbjct: 466 ICICHIRFRKALTSQGRSVDELSFKSPTGVWGSYWGLFMIVIMFIAQFYVALFPV-NGSP 524

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             +  FE YL+ P++LA+Y G+KIY +NW + I A ++D+ S R   D E++KQE  E +
Sbjct: 525 SAEGFFEAYLSFPLVLAMYIGHKIYKRNWKLLIPAGEMDIDSGRREVDLELLKQEIAEEK 584

Query: 159 GKLRNGPIWRRV 170
             L   P W RV
Sbjct: 585 AILATKPAWFRV 596

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  120 bits (301), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 60/131 (45%), Positives = 82/131 (62%), Gaps = 1/131 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+ H+RFR+A+  Q + T EL F S  GV+GS +   M I + IAQF+V + P G  K 
Sbjct: 463 ICLCHIRFRKALSAQGRGTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPG-AKP 521

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             K  FE YL+ PI++A Y G+KIY KNW IFIKA+D+D+ + R   D ++++QE  E R
Sbjct: 522 NAKAFFEAYLSFPIVIACYLGHKIYKKNWKIFIKAEDMDIDTGRKDDDLDLLRQEVAEER 581

Query: 159 GKLRNGPIWRR 169
             L   P W R
Sbjct: 582 AVLATKPWWYR 592

>NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa]
           {ON} 
          Length = 619

 Score =  119 bits (298), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 57/125 (45%), Positives = 79/125 (63%), Gaps = 1/125 (0%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG-D 95
             IC+SH+RFR A+  Q K   E+G+K+Q G WGS  A ++ +  L+ QFWV IAP+  +
Sbjct: 467 LAICLSHIRFRDAMKTQKKSMDEVGYKAQTGYWGSWVAVLIGLFSLVTQFWVAIAPVDKN 526

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEED 155
           GKL+  + F+NYLA PI+L  YFG+K+Y  NW   I    IDL SHR I+  E I + E 
Sbjct: 527 GKLDVMSFFQNYLAFPIVLVAYFGHKLYYGNWCPLIPLSKIDLDSHRKIYSPEEITEIEL 586

Query: 156 EYRGK 160
           +  G+
Sbjct: 587 QTSGE 591

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  119 bits (298), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 82/132 (62%), Gaps = 1/132 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+ H+RFR+A+  Q +   EL FKS  GVWGS +   M I + IAQF+V + P+GD   
Sbjct: 467 ICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSP- 525

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             +  FE YL+ P+++ +Y G+KIY +NW +FI A+ +D+ + R   D +++KQE  E +
Sbjct: 526 SAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEK 585

Query: 159 GKLRNGPIWRRV 170
             +   P W R+
Sbjct: 586 AIMATKPRWYRI 597

>Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)
          Length = 150

 Score =  110 bits (276), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 80/133 (60%), Gaps = 1/133 (0%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
            IC+ H+RFR+A+  Q + T EL F S VGVWGS +   + I + IAQF+V + P G   
Sbjct: 14  AICLCHIRFRKALTAQGRTTDELPFVSTVGVWGSYWGIFICILMFIAQFYVGLFPTGTAP 73

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
              K+ F  YL+ PI++A Y  +K++ +NW ++IKA+D+D+ + R   D +++KQE    
Sbjct: 74  -NAKDFFMAYLSFPIVIAFYVAHKLWKRNWKLYIKAEDMDIDTGRREVDRDLLKQEVAAE 132

Query: 158 RGKLRNGPIWRRV 170
           R  L    IW R 
Sbjct: 133 RTHLAARSIWYRT 145

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  119 bits (297), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 83/131 (63%), Gaps = 1/131 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+ H+RFR A+  Q + T EL F S  G+ GSS+   M + + IAQF+V + P G  K 
Sbjct: 476 ICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWGLFMLLLMFIAQFYVALFPPGS-KP 534

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             +  FE+YL+ PI+LA YFG+KIY KNW +FIKA+D+D+ + R   D E++KQE +E +
Sbjct: 535 SAEVFFESYLSFPIVLAFYFGHKIYKKNWKLFIKAEDMDIDTGRRETDLELLKQEIEEEK 594

Query: 159 GKLRNGPIWRR 169
             L     W R
Sbjct: 595 AILATKGWWYR 605

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  118 bits (295), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 86/132 (65%), Gaps = 2/132 (1%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG-DGK 97
           I +SHVRFR+A+   ++P  ELG+K+  GV GS       I + IAQFWV IAP G DGK
Sbjct: 465 IMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKDGK 524

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           L+  + F++YLA P+ + L+FGY I  +NW I    KDIDL  +R+I+D++ + QE+ E+
Sbjct: 525 LDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDLEH 584

Query: 158 RGKLRNGPIWRR 169
           +  ++N   W R
Sbjct: 585 KILIQNSS-WAR 595

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  117 bits (293), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 60/141 (42%), Positives = 86/141 (60%), Gaps = 12/141 (8%)

Query: 41  VSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GKLE 99
           +SH+RFR A+  Q +   E+G+K+Q G WGS  A ++ +  L+ QFWV IAP+   GKL+
Sbjct: 468 LSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLD 527

Query: 100 TKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIF-----------DEE 148
               F+NYLAMPI+L  YFG+KIYTK+W  +I A+ IDL SHR I+           D++
Sbjct: 528 ANVFFQNYLAMPIVLFAYFGHKIYTKSWKFWIPAEKIDLDSHRTIYVPPILMGTNKIDDD 587

Query: 149 IIKQEEDEYRGKLRNGPIWRR 169
            +K+ E     +  NG   R+
Sbjct: 588 DLKEYETSESSENPNGSGSRK 608

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  117 bits (293), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 100/170 (58%), Gaps = 8/170 (4%)

Query: 1   MSYLYKSDARGDLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGEL 60
           ++++ +SD  GD+    LA       +S ++ + +   IC+ H+RFR A+  Q++ T EL
Sbjct: 439 VAFVAQSDKEGDVFNWLLA-------ISGLSSFFTWGAICLCHIRFRAALKAQNRSTDEL 491

Query: 61  GFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGY 120
            F S +GV+GS +   + + +L AQF+V I P+GD    T N F  YL++P++L +Y  +
Sbjct: 492 PFVSPLGVFGSYWGLFLIVLMLAAQFYVAIFPVGDTPSAT-NFFSAYLSLPVVLVMYIAH 550

Query: 121 KIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYRGKLRNGPIWRRV 170
           K++TKNW IFI    +DL + R   D ++++QE  E R  L   P W R+
Sbjct: 551 KLWTKNWKIFIPLGQLDLDTGRKQLDLDLLRQEVAEERATLAARPRWFRI 600

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  117 bits (292), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 79/126 (62%), Gaps = 1/126 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG-K 97
           I  SH+RFRRA+ +Q+K    LG+K+  G+WGS +     I +  AQFWV ++P   G K
Sbjct: 475 IMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGK 534

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            +  + F +YLAMPI L  YFGY  + K++T+      +DL +HR ++D E ++QE+ E 
Sbjct: 535 CDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLEN 594

Query: 158 RGKLRN 163
           + +LRN
Sbjct: 595 KERLRN 600

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  114 bits (286), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 79/126 (62%), Gaps = 1/126 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG-DGK 97
           I +SH+RFR+A+        +LG+KS  G+WGS Y     I + +AQFWV +APIG +GK
Sbjct: 461 ILLSHIRFRQAMKYHGYSLSQLGYKSITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGK 520

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            +  + F++YLA P+    + GY +Y+  W I    KDID+   R ++DEE I+QE+ E+
Sbjct: 521 TDVLSFFQSYLAFPLWFVFFLGYMVYSGEWMILRPLKDIDINHFRCVYDEERIEQEKLEH 580

Query: 158 RGKLRN 163
           +  L+N
Sbjct: 581 KTMLQN 586

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  114 bits (286), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 79/134 (58%), Gaps = 1/134 (0%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
             I + H+RFR+A+  Q++   EL F S +G+WGS Y+  + I +LI QFW+ + P G  
Sbjct: 463 LTISLCHIRFRKALSAQNRSIDELAFASPIGIWGSYYSVFLIIVVLILQFWIALFP-GHQ 521

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           K    N F+ YL+MPI +A+Y G+KIYTKNW + I  K +D+ + R   D E+ KQE  E
Sbjct: 522 KPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKLLIDPKYMDIDTGRRELDIELFKQELLE 581

Query: 157 YRGKLRNGPIWRRV 170
               +   P   RV
Sbjct: 582 QNAIMAKKPFIYRV 595

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  113 bits (282), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 78/123 (63%), Gaps = 1/123 (0%)

Query: 41  VSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG-DGKLE 99
           +SH+RFR+A+ VQ K   E G+ S  G+WGS       I + IAQFWV ++PIG DGK +
Sbjct: 480 LSHIRFRQAMKVQGKNIKECGYLSVTGIWGSIIGLCFNILVFIAQFWVALSPIGNDGKCD 539

Query: 100 TKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYRG 159
            +  F++YLA PI LA YFG   Y K++T+    + IDL  HR I+D E +K+E+   + 
Sbjct: 540 AQAFFQSYLAFPIWLAFYFGCMFYYKDYTLLNPLESIDLDDHRRIYDPEELKKEDLATKA 599

Query: 160 KLR 162
           +L+
Sbjct: 600 ELK 602

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  113 bits (282), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 78/130 (60%), Gaps = 1/130 (0%)

Query: 41  VSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG-KLE 99
           +SH+RFR A+ VQ K   E+G+K+  G+WGS   A   + +LIA FWV + P G G  + 
Sbjct: 529 LSHIRFRWAMKVQGKDINEVGYKAACGIWGSIIGACFNVLVLIANFWVSLTPPGQGSNVS 588

Query: 100 TKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYRG 159
            KN FE  LA+PI +    GY +  K+W I+   + IDL   R I+D E +K+E++E R 
Sbjct: 589 AKNFFEQMLALPIWIFFAVGYMVIKKDWVIWNPIESIDLDYCRKIYDPEQLKREDEENRE 648

Query: 160 KLRNGPIWRR 169
           ++RN   W R
Sbjct: 649 RIRNAGFWAR 658

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  113 bits (282), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 81/133 (60%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F I +SH+RFR+A+  Q +   EL F S  GV+GS Y  I+   +LIA FW  + P+G  
Sbjct: 467 FSINLSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSD 526

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
             + ++ FE YL++PI +  Y G+K+Y K+W +++K KD+DL + R   D +I+KQE   
Sbjct: 527 GADAESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRL 586

Query: 157 YRGKLRNGPIWRR 169
            R ++   P + R
Sbjct: 587 EREQMAQKPFYIR 599

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  112 bits (280), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 78/118 (66%), Gaps = 3/118 (2%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG-DGK 97
           IC+SH+RFRRA+  Q K   E+G+K+  G WGS  A  + +  LI+QFWV IAPIG DGK
Sbjct: 468 ICLSHIRFRRAMIKQGKSLDEIGYKAPTGCWGSWIALSIALFSLISQFWVAIAPIGKDGK 527

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIF--DEEIIKQE 153
           L+    F+NYLA PI+L  Y GYK Y K+W ++I +  IDL   R I+  +E++I + 
Sbjct: 528 LDVLVFFQNYLAAPIVLIAYLGYKTYYKDWRLYIPSDKIDLSYGREIYVPEEQVIVES 585

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  112 bits (280), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 81/131 (61%), Gaps = 1/131 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+ H+RFRRA+  Q + T EL F S VG+ GS +   + + +LIAQF+V + P G    
Sbjct: 468 ICICHIRFRRALVAQGRSTDELPFVSTVGIAGSYWGIFICVLMLIAQFYVGLFPAGASP- 526

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             K+ F  YL+ PI+LA Y  +KI+ KNW ++IKA+D+D+ + R   D +++KQE    R
Sbjct: 527 NAKDFFMAYLSFPIVLAFYIFHKIWKKNWKLYIKAEDMDIDTGRREVDRDLLKQEVAAER 586

Query: 159 GKLRNGPIWRR 169
             L   PIW R
Sbjct: 587 ADLAARPIWYR 597

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  111 bits (278), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 76/123 (61%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SH+RFR+A+ VQ +   EL F SQ GV GS Y  ++   +LIA FW  + PIG    
Sbjct: 467 INLSHIRFRKAMKVQERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGA 526

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             ++ FE YL+ PIL+  YFG+KIYT+NWT+ +K +DIDL + R   D  + ++E    R
Sbjct: 527 SAESFFEGYLSFPILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIER 586

Query: 159 GKL 161
             L
Sbjct: 587 ENL 589

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  110 bits (276), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 73/115 (63%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SH+RFR+A+  Q +   EL F SQ GVWGS Y  ++   +LIA FW  + PIG    
Sbjct: 467 INLSHIRFRQAMKFQERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGA 526

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQE 153
             ++ FE YL+ PIL+  YFG+KIYT++W + +K +D+DL + R   D  + +QE
Sbjct: 527 NAESFFEGYLSFPILIVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVDLNLRRQE 581

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  110 bits (275), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 78/130 (60%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SH+RFRRA+ +Q +   E+ + SQVGV+GS Y  I+   +LIA FW  + P+G  + 
Sbjct: 470 INISHIRFRRAMDIQGRSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQA 529

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
                FE YL++PILLA Y G+K Y KNW +F    +IDL S +   D E++++E+    
Sbjct: 530 NATTFFEGYLSLPILLACYVGHKFYFKNWRLFTPYNEIDLDSGKRDIDLELLREEKKMEE 589

Query: 159 GKLRNGPIWR 168
             L+   I R
Sbjct: 590 LALKKQLILR 599

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  110 bits (275), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 76/123 (61%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SH+RFR+A+ VQ +   EL F SQ GV GS Y  I+   +LIA FW  + P+G    
Sbjct: 467 INLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSSGA 526

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             ++ FE YL+ PIL+  YFG+KIYT+NWT+ +K +DIDL + R   D  + ++E    R
Sbjct: 527 NAESFFEGYLSFPILIVCYFGHKIYTRNWTLMVKLEDIDLDTGRKQVDLALRREEMKVER 586

Query: 159 GKL 161
             L
Sbjct: 587 ETL 589

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  110 bits (275), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 79/116 (68%), Gaps = 1/116 (0%)

Query: 42  SHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKLETK 101
           S +RFRRA+ VQ++   EL + SQ G+WG+ Y  ++   +++A FW  + P+G    + +
Sbjct: 427 SLIRFRRAMQVQNRSLDELPYLSQTGIWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAE 486

Query: 102 NLFENYLAMPILLALYFGYKIY-TKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           + FE++L++PILL  YFG+K+Y  +NW + I A+++D+ S R I DEE +KQE +E
Sbjct: 487 SFFESFLSLPILLVCYFGHKLYFARNWRLQIGAEEMDIDSGRKIIDEEGLKQEREE 542

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  110 bits (275), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 83/131 (63%), Gaps = 1/131 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+ H+RFR A+  Q + T EL F S  GV GS +   M + + IAQF+V + P G GK 
Sbjct: 484 ICLCHIRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPG-GKP 542

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
           + +  F++YL+ PI++A YFG+KIY +NW +FI  +D+D+ + R   D E++KQE  E +
Sbjct: 543 DAEVFFQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIMEEK 602

Query: 159 GKLRNGPIWRR 169
             L + P + R
Sbjct: 603 AILASKPWYIR 613

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  110 bits (275), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 76/133 (57%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F I VSH+RFRR +  + +   EL F S  GVWGS Y  I+   +L+  FW  + P G  
Sbjct: 451 FAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSYYGCIVIFIVLVVCFWTSLFPGGGE 510

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
               ++ FE YL+ PILLA YFG+K+YT++W +    K+IDL S R   D E++K E+  
Sbjct: 511 GANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVDLELMKDEKRI 570

Query: 157 YRGKLRNGPIWRR 169
               +R   ++ R
Sbjct: 571 EEQAMRQKSLFAR 583

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  110 bits (274), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 82/132 (62%), Gaps = 1/132 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I + H+R RRA+  Q++ T EL F +   VWGS Y+ I+ I ILIAQFW+ + PIG GK 
Sbjct: 452 ILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFPIG-GKP 510

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
                FE YL+ PI +  Y G+KI+ KNW +FIKA DID+ S R   D E +KQE  E +
Sbjct: 511 SAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETDIEALKQEIAEEK 570

Query: 159 GKLRNGPIWRRV 170
             + + P + R+
Sbjct: 571 AFIASKPFYYRM 582

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  109 bits (272), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 77/122 (63%), Gaps = 4/122 (3%)

Query: 41  VSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKLET 100
           +SH+RFR A+ +Q K   E+GF +  G++GS Y     I +  AQFWV ++PIG  K+  
Sbjct: 479 ISHIRFRWAMKLQGKDIKEVGFLASTGLYGSFYGLFFNILVFAAQFWVALSPIGSKKVGA 538

Query: 101 KNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFD----EEIIKQEEDE 156
           ++ FE+YLA PI L  YFGY ++ K++T     + IDL  HR I+D     EI +QE++E
Sbjct: 539 ESFFESYLAFPIWLFFYFGYMVWAKDFTFLNPLESIDLDFHRRIYDPEEMAEINRQEKEE 598

Query: 157 YR 158
           Y+
Sbjct: 599 YK 600

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  108 bits (271), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 80/133 (60%), Gaps = 1/133 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVI-APIGDGK 97
           I +SH+RFR A+    K   E+G+K+  G+WGS Y     + +LIAQFWV + AP   G+
Sbjct: 534 ILLSHIRFRWAMKYHGKSMDEVGYKAITGIWGSYYGLFFNLLVLIAQFWVALSAPGSGGQ 593

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
           +   + FE+YLA  I +  Y  Y IY K+WTI I  KDID+   R I+D + ++QE++E 
Sbjct: 594 VTAISFFESYLAFVIWVFFYLCYMIYNKDWTILIPLKDIDVDYQRRIYDADFLRQEKEES 653

Query: 158 RGKLRNGPIWRRV 170
             K +   I +++
Sbjct: 654 YEKYKQSNIGKKI 666

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  108 bits (269), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 69/115 (60%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I + H+RFR+ +HVQ     EL F SQ G+WGS Y  ++   +L+A FW  + P+G  K 
Sbjct: 522 INLCHIRFRQGMHVQQISLDELPFLSQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKA 581

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQE 153
              + FE YL+ PILL  Y  +K+Y KNW  +I A  +DL S R   D E++++E
Sbjct: 582 NATSFFEGYLSFPILLGCYIAHKVYFKNWRWYIPASKMDLHSGRKQVDLEVVREE 636

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  108 bits (269), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 79/131 (60%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I ++H+RFR+A+ VQ++   E+ + SQ G++GS Y   +   +LIA FW  + P+G    
Sbjct: 467 INIAHIRFRQAMTVQNRSLDEMPYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGA 526

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
           + +  FE YL+ PIL+A Y G+K+Y KNW I    ++IDL++ R   D +I+K+E    R
Sbjct: 527 DAEAFFEGYLSFPILIACYIGHKLYFKNWRIMTPLEEIDLLTGRKEVDIDILKEELKIER 586

Query: 159 GKLRNGPIWRR 169
             LR     +R
Sbjct: 587 EALRQSSFMKR 597

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  107 bits (268), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 79/131 (60%), Gaps = 1/131 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC  H+RFR A+  Q + T EL FK+  G++GS +   M + + +AQF+V + P G GK 
Sbjct: 462 ICFCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPG-GKP 520

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             +  F++YL+ P++LA YFG+K+Y +NW + I    +D+ + R   D ++++QE  E +
Sbjct: 521 SAEVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEK 580

Query: 159 GKLRNGPIWRR 169
             +   P W R
Sbjct: 581 QMMSTRPWWYR 591

>NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  107 bits (268), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 52/111 (46%), Positives = 70/111 (63%), Gaps = 1/111 (0%)

Query: 41  VSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPI-GDGKLE 99
           +SH+R R A+  Q K   E+G+K+Q G WGS  A  +    L+ QFWV IAP+   G+L+
Sbjct: 478 LSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELD 537

Query: 100 TKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEII 150
             N F+NYLA PI+L  Y G+KIY KNW ++I A  IDL SHR I+    +
Sbjct: 538 VVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIYSATAV 588

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  106 bits (265), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 48/128 (37%), Positives = 82/128 (64%), Gaps = 4/128 (3%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPI-GDGK 97
           IC++H+RFR A+  + +    LG+KS  GV GS  A ++ + IL+ QFWV + P+  +GK
Sbjct: 422 ICIAHIRFRDAIKSRGQSLETLGYKSITGVAGSYIATVINLVILVVQFWVSLFPLESNGK 481

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
                 F+NY+A+P+ L  Y G+K+YTKNW++ I+A ++D+ + R+I+   I   E+ + 
Sbjct: 482 PNIVQFFQNYMAVPVALLFYIGHKVYTKNWSLLIRASNVDITTDRDIYCPTI---EDPKI 538

Query: 158 RGKLRNGP 165
           +  ++N P
Sbjct: 539 KVLMQNSP 546

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  106 bits (264), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 51/109 (46%), Positives = 70/109 (64%), Gaps = 1/109 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGD-GK 97
           I +SH+RFR A+ VQ +  GELG+ S  G  GS YA    I +L+AQFW+ IAPI   G+
Sbjct: 452 IALSHIRFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAPIDKHGE 511

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFD 146
           L+ ++ F+NYLA  +L+  Y GYKI+ +   + I    IDL +HR IFD
Sbjct: 512 LDAESFFKNYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQIFD 560

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  105 bits (262), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 75/132 (56%), Gaps = 1/132 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+ H+RFR A+  Q + T EL F S  GV GS +   + I +LIAQF++ + PIG G  
Sbjct: 469 ICICHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLFLNILMLIAQFYIALFPIG-GSP 527

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
                F  YLA P++LA Y  +K++ KNW   I  +D+D+ + R   D  ++KQE  E +
Sbjct: 528 SAYEFFSAYLAAPVILAFYIAHKLWKKNWKFLIPLEDVDIDTGRRDTDVNLLKQEIAEEK 587

Query: 159 GKLRNGPIWRRV 170
             L   P W RV
Sbjct: 588 AALAMRPWWYRV 599

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  104 bits (259), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 81/138 (58%), Gaps = 7/138 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG---D 95
           I + HVRFR A+  Q++   EL F S VG+WGS Y+ I+   IL+AQF++ + PIG   D
Sbjct: 449 INICHVRFRLAMKAQNRTLDELEFVSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTD 508

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIY----TKNWTIFIKAKDIDLISHRNIFDEEIIK 151
                K  F+NYL   IL+ L+ G+KIY    T +W  +I  KDIDL + R   D EIIK
Sbjct: 509 SGTRAKKFFQNYLCALILIVLFIGHKIYYRVTTGHWWEYIALKDIDLDTDRKNVDIEIIK 568

Query: 152 QEEDEYRGKLRNGPIWRR 169
           QE  E +  L + P + R
Sbjct: 569 QEIHEKKMYLASKPWYVR 586

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  103 bits (257), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 83/147 (56%), Gaps = 1/147 (0%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           ++ +S I+ + +   IC  H+RFR A+ V  +   EL FKS VG+ GS +   + + +L+
Sbjct: 454 LLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGIIGSYWGMCLAVLMLV 513

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
           AQF+  + PIG       + F  YLA PI+LA Y  +K++ +NW + I  KDID+ + R 
Sbjct: 514 AQFYNALFPIGSSP-NAYDFFSAYLAAPIVLAFYIAHKLWKRNWKLLIPLKDIDIDTGRR 572

Query: 144 IFDEEIIKQEEDEYRGKLRNGPIWRRV 170
             D  ++KQE  E +  L   P W RV
Sbjct: 573 ETDINLLKQEIAEEKAALAMRPWWYRV 599

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  103 bits (257), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 69/108 (63%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SH+RFR+A+ VQ +   EL F SQ GV GS Y  I+   +LIA FW  + P+G    
Sbjct: 467 INLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGA 526

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFD 146
             ++ FE YL+ PIL+  Y G+K+YT+NWT+ +K +D+DL + R   D
Sbjct: 527 SAESFFEGYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVD 574

>KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn
          Length = 556

 Score =  102 bits (255), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 83/132 (62%), Gaps = 1/132 (0%)

Query: 40  CVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPI-GDGKL 98
           CVSH+RFR+A+  Q +   +LG++S  GV+GS  +  +   ILI QFWV + P+  +G+L
Sbjct: 419 CVSHLRFRKAMKDQDQALDQLGYQSPCGVYGSYISLFICAIILIVQFWVSLFPLESNGRL 478

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
              +  +NY+A+PI + LY G+K YT NW  FI+A +ID+ + R+I+  + +  ++  + 
Sbjct: 479 NVVSFLQNYMAVPITIVLYLGHKAYTGNWKPFIRAPEIDIQTDRDIYCVDEVTGKKSVFV 538

Query: 159 GKLRNGPIWRRV 170
             L +G +  ++
Sbjct: 539 ELLDSGDMCSKL 550

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  101 bits (252), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 70/126 (55%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F I VSH+RFR  +  + +   EL F S  GVWGS Y  ++   +L+  FW  + P  +G
Sbjct: 449 FAINVSHIRFRYTMKQRGRSLDELPFVSMTGVWGSYYGCVIIFVVLVVCFWTALFPSTEG 508

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
               ++ FE YL+ PILL  Y G+K+YTK+W +     +ID+ S R   D E++K E+  
Sbjct: 509 VASAESFFETYLSFPILLVCYIGHKLYTKSWRLLTPTTEIDIDSGRRAVDIEVLKDEKRM 568

Query: 157 YRGKLR 162
               +R
Sbjct: 569 EEQAMR 574

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  100 bits (249), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 78/134 (58%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F I ++H+RFR A+  Q++   EL + S  G WGS Y  I+   +LIA FW  + P G  
Sbjct: 443 FAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGN 502

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
             +  + FE+YL++PI +A Y G+KI+ +N  ++IK  ++D+ S R   D   +KQE++ 
Sbjct: 503 GADATSFFESYLSLPIFIACYLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEA 562

Query: 157 YRGKLRNGPIWRRV 170
               ++  P + R+
Sbjct: 563 EAELMKTKPFYIRL 576

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score = 99.8 bits (247), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 69/112 (61%)

Query: 42  SHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKLETK 101
           SH+RFR A+ VQ+K   EL + SQ GV GS Y  I+   +L+A FW  + P+G G  +  
Sbjct: 476 SHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVT 535

Query: 102 NLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQE 153
           + FE YL++PIL+A Y G+K+Y +N  + +K +D+DL + R   D    + E
Sbjct: 536 SFFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDAHEHRAE 587

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score = 99.4 bits (246), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 47/112 (41%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPI-GDG 96
           +ICV+H+RFR A+  Q+    ELG ++  G++GS Y   +    L+ QFWV + P+ GDG
Sbjct: 449 MICVAHLRFRAAMKDQNHSLEELGHRAWSGIYGSYYVIAINSLTLVVQFWVSLFPLDGDG 508

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEE 148
           + +  N F+NY+A+P  L LY G+KIYT++W   I A  ID+ + R+I+  E
Sbjct: 509 RPDFVNFFQNYMAVPFALCLYVGHKIYTRSWQFIIPADKIDVDTSRDIYGVE 560

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score = 99.0 bits (245), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 66/100 (66%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I ++H+RFR A+  Q++   EL + SQ G+WGS Y  I+ + +LIA FWV + P+G+   
Sbjct: 459 INLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVIILVLVLIASFWVSLFPVGESSA 518

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDL 138
           + +  FE YL+ PIL+A Y G+K+Y KNW   I  ++ID+
Sbjct: 519 DAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLEEIDI 558

>KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 98.6 bits (244), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 82/135 (60%), Gaps = 2/135 (1%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F IC   VRFR A+  Q +   E+ +KS +G++G    AI+ I ++I + ++ I P+ + 
Sbjct: 442 FSICWCQVRFRMALKRQGRSNDEIAYKSMLGIYGGYVGAILNIVLIIGEVYISIFPLNES 501

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTI-FIKAKDIDLISHRNIFDEEIIKQEED 155
                  F+N L++PI+L  +FG+KIY K W   F++AKDIDL +  +I D EI K E +
Sbjct: 502 P-SANIFFQNCLSIPIMLVSFFGHKIYCKGWKDWFVRAKDIDLDTGNSITDFEIFKAEIE 560

Query: 156 EYRGKLRNGPIWRRV 170
           E + ++ + P++ R+
Sbjct: 561 EEKERIASSPLYYRI 575

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score = 97.1 bits (240), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 97/179 (54%), Gaps = 20/179 (11%)

Query: 1   MSYLYKSDARGDLNRSSLA---LLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPT 57
           +++L KS + GD+    +A   L   ++++SI           VSH+RFR A+  Q K  
Sbjct: 418 LAFLVKSGSMGDVFNWLMAIAGLATCIVWLSI----------NVSHIRFRMAMKAQGKKL 467

Query: 58  GELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKLET---KNLFENYLAMPILL 114
            EL F S VG+WGS+Y+A++   IL+AQF+  + PIG  K  +   K  F+NYL   I+L
Sbjct: 468 DELEFVSAVGIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVL 527

Query: 115 ALYFGYKIY----TKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYRGKLRNGPIWRR 169
            ++  +KIY    T  W      KDIDL + R   D EI+KQE  E +  L + P + R
Sbjct: 528 FIFIAHKIYYKCQTGQWWGIKALKDIDLETDRKNIDIEIVKQEIAEKKMYLDSCPWYVR 586

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score = 97.1 bits (240), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 83/132 (62%), Gaps = 1/132 (0%)

Query: 15  RSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYA 74
           R   A+ V ++ +S ++   +   IC++H+RFR A+ +Q +    LG++S  GV GS  A
Sbjct: 382 RDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNTGVIGSYIA 441

Query: 75  AIMTICILIAQFWVVIAPI-GDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKA 133
             + + ++I QFWV + P+  +GK +    F+NY+A+P+ + LY G+K+YT +WT +I+ 
Sbjct: 442 TAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTNDWTPWIRT 501

Query: 134 KDIDLISHRNIF 145
             +D+ + R+++
Sbjct: 502 HCVDINTDRDVY 513

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score = 97.1 bits (240), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 82/151 (54%), Gaps = 4/151 (2%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           ++ +S ++ + +   I ++H+RFR A+  Q + T EL F S  G  GS YA  +   +L+
Sbjct: 449 LLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLV 508

Query: 84  AQFWVVIAPIGDGKLETKN----LFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLI 139
           AQFWV + P        K      F+ YL+  + + +Y  +KI+++NW  FIKAK++D+ 
Sbjct: 509 AQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDID 568

Query: 140 SHRNIFDEEIIKQEEDEYRGKLRNGPIWRRV 170
           + R   D E+ K+E  + R  L   P   RV
Sbjct: 569 TGRRELDLELFKEELAQERALLAQKPFIIRV 599

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score = 96.7 bits (239), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 68/111 (61%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SH+RFR+++  Q++   EL F SQ GVWGS Y  I+   +L+A FW  + P+G    
Sbjct: 456 INLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVLVASFWTSLFPLGGTSA 515

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEI 149
           + ++ FE YL+ PILLA YFG+K+Y +     +   D+DL + R   D ++
Sbjct: 516 DAESFFEGYLSFPILLACYFGHKLYVRKREFMVGLADMDLDTGRRQVDLDV 566

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score = 96.7 bits (239), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 73/133 (54%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F I +SH+RFRRA+  Q +   EL + S  GV GS Y A + + +L+  FW  + P G  
Sbjct: 488 FAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSS 547

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
               ++ FE YL+ PI L  Y  +K+Y ++W +FI A  ID+ S R   D E +K+++  
Sbjct: 548 GPSAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDIEELKEQKLR 607

Query: 157 YRGKLRNGPIWRR 169
            + +    P + R
Sbjct: 608 EQAETAKKPFYVR 620

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score = 96.3 bits (238), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 79/138 (57%), Gaps = 7/138 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG---D 95
           I +SH+RFR A+  Q K   EL F S VG+WGS+Y+A++   ILIAQF+  + PIG    
Sbjct: 450 INLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWSS 509

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIY----TKNWTIFIKAKDIDLISHRNIFDEEIIK 151
           GK   K  F+NYL   I+L ++  +KIY    T  W      KDIDL + R   D EIIK
Sbjct: 510 GKERAKLFFQNYLCALIMLFIFVVHKIYYKCQTGKWWGVKSLKDIDLETDRKDIDIEIIK 569

Query: 152 QEEDEYRGKLRNGPIWRR 169
           QE  E +  L + P + R
Sbjct: 570 QEIMERKMHLDSRPWYVR 587

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score = 95.9 bits (237), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 79/138 (57%), Gaps = 7/138 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG---D 95
           I +SH+RFR A+  Q K   EL F S VG+WGS+Y+A++   ILIAQF+  + PIG    
Sbjct: 449 INLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTS 508

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIY----TKNWTIFIKAKDIDLISHRNIFDEEIIK 151
           GK   K  F+NYL   I+L ++  +KIY    T  W      KDIDL + R   D EI+K
Sbjct: 509 GKERAKIFFQNYLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIVK 568

Query: 152 QEEDEYRGKLRNGPIWRR 169
           QE  E +  L + P + R
Sbjct: 569 QEIAEKKMYLDSRPWYVR 586

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score = 95.5 bits (236), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 78/138 (56%), Gaps = 7/138 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG---D 95
           I +SH+RFR A+  Q +   EL F S VG+WGS+Y+A++   IL+AQF+  + PIG   +
Sbjct: 456 INISHIRFRLAMKAQGRSLDELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWEN 515

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIY----TKNWTIFIKAKDIDLISHRNIFDEEIIK 151
             +  K  F++YL   I++ L+ G+KI+    T  W   +    IDL + R   D EI+K
Sbjct: 516 SSIRAKKFFQSYLCALIMIVLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNIDIEILK 575

Query: 152 QEEDEYRGKLRNGPIWRR 169
           QE  E    LR  P + R
Sbjct: 576 QEIAERNRHLRASPWYVR 593

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score = 94.7 bits (234), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 73/131 (55%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SH+RFR+A+  Q K   EL + SQ GVWGS Y  I+   +LI  FW  + P+G    
Sbjct: 451 INISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGA 510

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
           + ++ F+ YL+ PIL+A Y G+K+  +   I +  +D+D+ + R   D  I +QE  E +
Sbjct: 511 DAESFFQGYLSFPILIACYVGHKLVYRKKQIVVALEDMDIDTGRRQVDLTIRRQEMKEEQ 570

Query: 159 GKLRNGPIWRR 169
             L     + R
Sbjct: 571 EHLAKSSFFAR 581

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score = 94.4 bits (233), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 74/131 (56%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +S +RFR A+  Q +   E+ F SQ G WG+ Y  I+   +L+A FW  + P+G    
Sbjct: 469 INLSLIRFRDAMKAQGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTA 528

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
             K+ FE YL++PIL+A Y G+K++ ++W + +   ++DL S R + D E  ++E    R
Sbjct: 529 SAKSFFEGYLSLPILIACYVGHKLWKRDWRLLVPLMEMDLDSGRRVLDAETREEELRVER 588

Query: 159 GKLRNGPIWRR 169
             L N   + R
Sbjct: 589 EYLANASFFTR 599

>TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score = 94.0 bits (232), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 87/142 (61%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC+S VRFR A+  Q +P  ++ +KS +GV+G     ++   ++  + +V 
Sbjct: 439 ISSFFTWFCICLSQVRFRMALRAQGRPKSDIAYKSMLGVYGGIVGCVLNFLLIAGEIYVA 498

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNW-TIFIKAKDIDLISHRNIFDEE 148
            +P+G G+   +  FE  L++PI++ +YFG++ Y  +W   +IK ++IDL +  +I + E
Sbjct: 499 SSPVG-GESSARGFFEYCLSIPIMIVVYFGHRFYRNDWGNWYIKRRNIDLDTGCSIENVE 557

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
           + +Q+ ++ + K+ + P + R+
Sbjct: 558 LFRQQREQEQEKISSRPFYYRI 579

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score = 94.0 bits (232), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 77/138 (55%), Gaps = 7/138 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPI---GD 95
           I VSHVRFR A+  Q+K   EL F S VGVWGS YA ++    L+AQF++ + P+    D
Sbjct: 449 INVSHVRFRLAMKAQNKSLDELQFVSSVGVWGSVYAGVLNFLTLVAQFYIALWPVEGWKD 508

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIY----TKNWTIFIKAKDIDLISHRNIFDEEIIK 151
            K   +  F+NYL   IL+A++  +K Y    T  W    K  ++DL + R   D EIIK
Sbjct: 509 SKSRAEAFFKNYLCALILIAMFAAHKCYFRITTGKWWGIKKLSEVDLDTGRVNIDIEIIK 568

Query: 152 QEEDEYRGKLRNGPIWRR 169
           +E  E +  LRN   + R
Sbjct: 569 EEVAERKKFLRNKAWYTR 586

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score = 93.6 bits (231), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 77/139 (55%), Gaps = 7/139 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG---D 95
           I + H+RFR A+  Q+K   EL F S VGVWGS Y+AI+   ILI QF+V + PIG   D
Sbjct: 447 INICHIRFRLAMKAQNKTIDELEFVSAVGVWGSVYSAIINSLILIVQFYVSLWPIGGWTD 506

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIY----TKNWTIFIKAKDIDLISHRNIFDEEIIK 151
            K      F+NYL   + L  +  +K+Y    TK W   I  KDIDL + R   D +I+K
Sbjct: 507 SKDRAGKFFQNYLCAIVSLIFFICHKLYFRYKTKKWWEIIPLKDIDLDTGRKNIDIDIVK 566

Query: 152 QEEDEYRGKLRNGPIWRRV 170
           +E  E +  L   P + R+
Sbjct: 567 EEIKERKQYLATKPWYIRL 585

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score = 93.2 bits (230), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 72/115 (62%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SH+RFR+A+  Q++   E+ + SQ GVWGS Y  ++   +L+A FW  + P+G    
Sbjct: 459 INISHIRFRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSA 518

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQE 153
           + ++ FE YL++PIL+  Y G+K+Y KNW+  +  +++DL + R   D  + + E
Sbjct: 519 DVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALDPHLHRAE 573

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score = 92.4 bits (228), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 67/117 (57%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
             I +SH+RFR+A+  Q     EL + S  GV GS Y  I+   +L+A FW  + P+G  
Sbjct: 475 MAINLSHIRFRQAMAHQGISLDELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGK 534

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQE 153
             +  + FE YL+ PIL+  Y G+K+Y +   + I   D+DL+S R + D E+ ++E
Sbjct: 535 GADATSFFEGYLSFPILIVCYVGHKLYIRKKRLLIDVADMDLVSDRKVVDVEVCREE 591

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score = 92.4 bits (228), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/138 (39%), Positives = 81/138 (58%), Gaps = 7/138 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG---D 95
           I +SH+RFR A+  Q++   EL FKS VGV+GS Y+A + I ILIAQF++ + P+G    
Sbjct: 441 INISHIRFRLAMKAQNRSLDELEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWTS 500

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIY----TKNWTIFIKAKDIDLISHRNIFDEEIIK 151
            +  T++ F+NYL   +L+ ++  +KIY    T  W  F    +IDL + R   D EI+K
Sbjct: 501 SQQRTESFFKNYLCALVLVFVFVTHKIYFKCSTGKWFDFKPLAEIDLETDRKNIDIEIVK 560

Query: 152 QEEDEYRGKLRNGPIWRR 169
           QE  E    L + P + R
Sbjct: 561 QEVREREMYLASKPWYIR 578

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score = 92.0 bits (227), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 84/142 (59%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC   VRFR A+  Q +   ++ ++S +G++G  +  I+ + ++I + +V 
Sbjct: 438 ISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIYGGIFGCILNVLLVIGEIYVS 497

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTI-FIKAKDIDLISHRNIFDEE 148
            AP+G       N FE  +++PI++A+Y G++IY ++W   +IK  DIDL S  ++ D E
Sbjct: 498 AAPVGSPS-SAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKRMDIDLDSGHSLEDFE 556

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
             K E DE +  + + P++ R+
Sbjct: 557 ATKLERDEDKKYVSSKPLYYRI 578

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 93/171 (54%), Gaps = 9/171 (5%)

Query: 1   MSYLYKSDARGDLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGEL 60
           + +L  SD  GD+     AL         I+ + + F IC S VRFR A+  Q + + E+
Sbjct: 432 LGFLVASDNEGDVFTWLFALCS-------ISSFFTWFCICASQVRFRFALRAQGRSSDEI 484

Query: 61  GFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGY 120
             KS +G++G     ++   ++  + +V I P+G G    K  F+  L++PI++A+Y G+
Sbjct: 485 AHKSMLGIYGGFLGCLLNALLIAGEIYVSIFPLG-GDPSAKQFFQYCLSIPIMIAVYIGH 543

Query: 121 KIYT-KNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYRGKLRNGPIWRRV 170
           K++  K+  + I A++IDL + R I D E  K E  E + KL + P++ R+
Sbjct: 544 KLFANKSKRVLIPAQEIDLETGRKIKDLEQFKHEVLEDKEKLASKPLYYRI 594

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 88/163 (53%), Gaps = 20/163 (12%)

Query: 1   MSYLYKSDARGDLNRSSLA---LLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPT 57
           +++L KS + G +    +A   L   V+++SI           VSH+RFR A+  Q K  
Sbjct: 408 LAFLVKSSSTGTVFTWLMAVAGLATAVVWLSI----------NVSHIRFRLAMKAQGKSL 457

Query: 58  GELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPI---GDGKLETKNLFENYLAMPILL 114
            EL F S VG+WGS Y+ +M + +L+AQF+V + PI    D +  T+  F+NYL   ILL
Sbjct: 458 DELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILL 517

Query: 115 ALYFGYKIY----TKNWTIFIKAKDIDLISHRNIFDEEIIKQE 153
            ++  +KIY    T  W   +   +IDL S R   D E++K E
Sbjct: 518 FMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHE 560

>SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 586

 Score = 91.7 bits (226), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 82/142 (57%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC S VRFR A+  Q + + E+ +KS +G WG     ++ I ++  + +V 
Sbjct: 441 ISSFFTWFCICFSQVRFRLALRAQGRSSDEIAYKSMLGFWGGVLGCVLNILLIAGEIYVS 500

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIF-IKAKDIDLISHRNIFDEE 148
           + P+G G    +  F+  L++PI++ +YF ++IY  NWT + I  K IDL + R   D E
Sbjct: 501 LFPLG-GSPNAEGFFQYCLSIPIMIFVYFCHRIYRNNWTDWIISTKKIDLDTGRKAEDLE 559

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
           ++K E    + ++ + P++ R+
Sbjct: 560 LMKHEILTEKARIASKPLYYRI 581

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score = 91.7 bits (226), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 80/139 (57%), Gaps = 7/139 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG---D 95
           I VSH+RFR A+  Q     EL F S VGV+GS Y+A + + IL+AQF+V + P+G    
Sbjct: 444 INVSHIRFRMAMKAQGVSLDELEFVSAVGVYGSVYSATINVLILVAQFYVSLWPVGGWSS 503

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIY----TKNWTIFIKAKDIDLISHRNIFDEEIIK 151
               T+N F+NYL   ILL L+ G+KIY    T  W  F   +DIDL++   + D E+ K
Sbjct: 504 PSTRTENFFQNYLCSLILLLLFAGHKIYYRISTGKWWGFKALRDIDLLTDMRVTDTELSK 563

Query: 152 QEEDEYRGKLRNGPIWRRV 170
            E  E R KL   P+  R+
Sbjct: 564 HELHEKRVKLAQKPLIVRL 582

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score = 90.5 bits (223), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 58/88 (65%), Gaps = 1/88 (1%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+ H+RFR+A+  Q +   EL FKS  GVWGS +   M + + IAQF+V + P+G G  
Sbjct: 467 ICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVG-GSP 525

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKN 126
             +  FE YL+ P+++A+Y G+KIY +N
Sbjct: 526 SAEGFFEAYLSFPLVMAMYIGHKIYKRN 553

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score = 90.5 bits (223), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 66/110 (60%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
             I +SH+RFRRA++ Q     EL + S  GV GS Y  ++ I +LIA FW  + P G  
Sbjct: 450 LAINISHIRFRRALNTQGYSLDELPYLSMTGVIGSWYGCVVIILVLIASFWTSLFPAGSS 509

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFD 146
             + ++ F+ YL++PI L  + G+K+Y +NW+  I++  ID+ + R + D
Sbjct: 510 GADWESFFKGYLSLPIFLFCFVGHKLYKRNWSWMIRSNKIDVNTGRRMID 559

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score = 90.5 bits (223), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 51/131 (38%), Positives = 77/131 (58%), Gaps = 1/131 (0%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           IC+ H+R+R A+  Q + T EL F++  GVWGS +   M I + IAQF+V + P G  K 
Sbjct: 460 ICLCHIRYRGALAAQGRSTDELPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGT-KP 518

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
              + F  YL+  I +ALY  +KI+ +NW +FI  KD+D+ + R   D +++++E  E R
Sbjct: 519 NAYDFFLAYLSFCIFIALYAFHKIWKRNWKLFIPLKDLDIDTGRREVDLDVLREELAEER 578

Query: 159 GKLRNGPIWRR 169
             L   P W R
Sbjct: 579 AALAARPFWYR 589

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score = 90.1 bits (222), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 83/142 (58%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC   VRFR A+  Q +   ++ ++S +G++G     I+ + ++I + +V 
Sbjct: 438 ISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSSLGIYGGIVGCILNVLLVIGEIYVS 497

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTI-FIKAKDIDLISHRNIFDEE 148
            AP+G       N FE  +++PI++A+Y G++IY K+W   +IK +DIDL S  ++ D E
Sbjct: 498 AAPVGSPS-SAANFFEYCMSIPIMIAVYIGHRIYRKDWRHWYIKRRDIDLDSGHSLEDFE 556

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
             K E D  +  + + P++ R+
Sbjct: 557 ATKLERDHDKRYVASRPLYYRI 578

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score = 90.1 bits (222), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 78/138 (56%), Gaps = 7/138 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG---D 95
           I +SHVRFR A+  Q K   EL F S VG+WGS Y+A++   ILIAQF+  + PIG    
Sbjct: 449 INLSHVRFRLAMKAQGKSLDELEFVSAVGIWGSVYSALINCLILIAQFYCSLWPIGGWTS 508

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIYTK----NWTIFIKAKDIDLISHRNIFDEEIIK 151
            K   K  F+NYL   I++ ++  +KIY +     W    + KDIDL + R   D EI+K
Sbjct: 509 SKERAKIFFQNYLCALIMVFIFVIHKIYYRCQMGKWWGVKELKDIDLETDRKDIDIEIVK 568

Query: 152 QEEDEYRGKLRNGPIWRR 169
           QE  E +  L + P + R
Sbjct: 569 QEIAEKKKYLDSRPWYVR 586

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score = 89.7 bits (221), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 78/134 (58%), Gaps = 7/134 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG---D 95
           I +SH+RFR A+  Q+K   EL F S VG+WGS+Y+A++ + ILIAQF++ + PIG   D
Sbjct: 434 INLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSAYSALINVLILIAQFYISLWPIGGWTD 493

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIYTK----NWTIFIKAKDIDLISHRNIFDEEIIK 151
                K  F++YL   I+L ++  +K+Y +     W      KDIDL + R   D ++IK
Sbjct: 494 SSQRAKKFFQSYLCALIMLLIFCIHKVYYRVSFGKWWDVKPLKDIDLETGRKNVDIDVIK 553

Query: 152 QEEDEYRGKLRNGP 165
            E  E +  L+  P
Sbjct: 554 AEIAERKMYLKKKP 567

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score = 89.7 bits (221), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 80/139 (57%), Gaps = 9/139 (6%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG---D 95
           I VSH+RFR A+  Q +   EL F S VG+WGS Y+AI+   IL+AQF++ + PIG   +
Sbjct: 457 INVSHIRFRLAMKAQGRSLNELEFVSAVGIWGSVYSAIINCLILVAQFYISLWPIGGWKN 516

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIY-----TKNWTIFIKAKDIDLISHRNIFDEEII 150
            +   K  F++YL   I++ ++ G+KIY      K W  F    +IDL   R   D +++
Sbjct: 517 SEDRAKKFFQSYLCALIMVCIWIGHKIYYWRQTGKIWA-FTPLAEIDLDEGRKNIDLDVL 575

Query: 151 KQEEDEYRGKLRNGPIWRR 169
           KQE  E +  L++ P + R
Sbjct: 576 KQEIHERKMYLKSRPWYIR 594

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 89.4 bits (220), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 88/142 (61%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC S VRFR A+  Q++ T ++ FKS +G++G    +I+ I +++ + +V 
Sbjct: 459 ISSFFTWFCICFSQVRFRLALKKQNRSTDDIAFKSMLGIYGGILGSILNILLIMGEIYVS 518

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKD-IDLISHRNIFDEE 148
            +P+G+     +  FEN L++P++L ++  ++ Y KNW  + K+ D IDL +  +  D E
Sbjct: 519 ASPLGEPS-SAEAFFENCLSIPLMLLVFIAHRFYRKNWRDWYKSLDEIDLDTGCSYDDIE 577

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
           + K + ++ + K+++ P++ ++
Sbjct: 578 LFKHQREQIKHKIQSKPLYYKI 599

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score = 89.4 bits (220), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 83/142 (58%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC   +RFR A+  Q KP  ++ +KS +G++G      + + ++I + +V 
Sbjct: 438 ISFFTTWFCICFCQIRFRMAMKAQGKPDDDIIYKSPLGIYGGVVGCTLNVLLVIGEIYVS 497

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTI-FIKAKDIDLISHRNIFDEE 148
            AP+G       N FE  +++PI++A+Y G++IY ++W   +IK +DIDL S  ++ D E
Sbjct: 498 AAPVGMPS-SAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKREDIDLDSGHSLEDLE 556

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
             K   D+ +  + + P++ R+
Sbjct: 557 ATKLRRDQEKEYVASRPLYYRL 578

>KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score = 87.8 bits (216), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 84/142 (59%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC S VR+R A+  Q++   E+ +KS +G++G    +++ I +++ + +V 
Sbjct: 440 ISSFFTWFCICFSQVRYRIALKKQNRSNDEIAYKSMLGIYGGILGSLLNILLIMGELYVS 499

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNW-TIFIKAKDIDLISHRNIFDEE 148
           I+P+ D        FEN L++PI++ +Y  +K Y K W ++FI  K IDL + R + +  
Sbjct: 500 ISPL-DESPSASAFFENCLSIPIMIVVYIFHKTYKKGWRSLFIPLKHIDLDTGRAVENLA 558

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
           + KQ+ +E +  + + P + RV
Sbjct: 559 LFKQQREEQKIIIASKPFYYRV 580

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score = 87.8 bits (216), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 75/138 (54%), Gaps = 7/138 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG---D 95
           I +SH+RFR A+  Q K   EL F S VG+WGS+Y+A++   ILIAQF+  + PIG   D
Sbjct: 456 INISHIRFRLAMKAQGKSLDELEFVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKD 515

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIY----TKNWTIFIKAKDIDLISHRNIFDEEIIK 151
                K  F++YL   I+  L+  +K++    T  W   +    IDL + R   D +++K
Sbjct: 516 SSERAKTFFQSYLCALIMAFLFVCHKVFYRYKTGKWWAIMDLDKIDLETDRKNIDIDVLK 575

Query: 152 QEEDEYRGKLRNGPIWRR 169
           QE  E    L+  P + R
Sbjct: 576 QEIAERNRHLQASPWYVR 593

>AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL274W
           (SAM3)
          Length = 497

 Score = 87.0 bits (214), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 79/134 (58%), Gaps = 6/134 (4%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F ICVS +R+RRA+ VQ  PT E+ ++S +G W      ++   ++  + +V +    DG
Sbjct: 363 FCICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICGEIYVSVK---DG 419

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNW-TIFIKAKDIDLISHRNIFDEEIIKQEED 155
            +ET   F+N +++P+L+  YF +++Y ++W T  I A+D+DL + R   D E++K E  
Sbjct: 420 DVET--FFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRKPEDLEMMKHELI 477

Query: 156 EYRGKLRNGPIWRR 169
             R ++ + P + R
Sbjct: 478 VSRARIASSPWYYR 491

>ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]
           {ON} similar to uniprot|Q7LGU1 Saccharomyces cerevisiae
           YPL274W SAM3 High-affinity S-adenosylmethionine
           permease, required for utilization of
           S-adenosylmethionine as a sulfur source; has similarity
           to S-methylmethionine permease Mmp1p
          Length = 585

 Score = 86.7 bits (213), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 85/142 (59%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC S +RFR A+  Q + T ++ +KS +GV+G     I+ I ++  + +V 
Sbjct: 440 ISSFFTWFCICYSQIRFRMALKYQGRSTDQIAYKSMLGVYGGILGCILNILLIAGEIYVS 499

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTI-FIKAKDIDLISHRNIFDEE 148
            +P+G+ K   +  FE  L++PI++++Y  ++IY K+WT  +IK  DIDL +  ++ + E
Sbjct: 500 ASPVGE-KSTAEGFFEYCLSIPIMISVYVLHRIYRKDWTHWYIKRSDIDLDTGCSVENIE 558

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
           + K++ +E +      P + ++
Sbjct: 559 LFKEQREEEKIYAATKPFYYKI 580

>Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar to
           Ashbya gossypii AER405C
          Length = 587

 Score = 86.3 bits (212), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 81/142 (57%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I  + + + IC+S +RFRRA+ VQ     E+ ++S +G+W      ++   ++  + +V 
Sbjct: 442 IAAFVTWWSICLSQLRFRRALKVQGLGKEEIAYESMMGIWSGVVGIVLNTMLICGEIYVA 501

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNW-TIFIKAKDIDLISHRNIFDEE 148
           I    D +   K  F+  +++P+++ +Y  ++IY KNW T F++AKDIDL + +   D E
Sbjct: 502 IHASID-EHSAKTFFQYCMSIPVMITVYAAHRIYNKNWHTWFVRAKDIDLSTGKKAEDIE 560

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
           ++K E    R K+   P++ R+
Sbjct: 561 LMKHEIMVSRAKIAASPLYYRI 582

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score = 86.3 bits (212), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 66/104 (63%), Gaps = 4/104 (3%)

Query: 39  ICVSHVRFRRAVHVQS---KPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG- 94
           I +SH+RFR A+  Q    +    + + +Q G  GS  A  ++I IL+ QFWV IAP+G 
Sbjct: 484 ITISHLRFRDAIRSQLGGLRARDVVEYTAQTGYVGSLVALAISIFILVCQFWVAIAPLGH 543

Query: 95  DGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDL 138
           +G+L+ +  FENYLA P+LL  Y  YKI+ ++W + I A +IDL
Sbjct: 544 NGQLDVQIFFENYLAAPVLLGGYLAYKIWHRDWRLCIPANEIDL 587

>Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678
           bp, 225 aa] {ON} YPL274W (REAL)
          Length = 225

 Score = 82.4 bits (202), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 80/142 (56%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC+S VRFR A+  Q +   E+ +KS +GV+G     ++   ++  + +V 
Sbjct: 80  ISSFFTWFCICMSQVRFRMALKAQGRSKNEIAYKSMLGVYGGVLGCVLNALLIAGEIYVS 139

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNW-TIFIKAKDIDLISHRNIFDEE 148
            AP+G G    K  FE  L++PI++ +Y  ++IY  +W   +IK  +IDL +  ++ + E
Sbjct: 140 AAPVG-GTSTAKGFFEYCLSIPIMIVVYISHRIYRGDWKNWYIKKSEIDLDTGCSVENLE 198

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
           +  +++   +  L + P + ++
Sbjct: 199 LFNEQKQAEKELLASKPFYYKI 220

>Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)
          Length = 328

 Score = 82.8 bits (203), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 81/142 (57%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC+S +RFR A+  Q +   E+ +KS +GV+G     ++   ++  + +V 
Sbjct: 183 ISSFFTWFCICMSQIRFRMALKAQGRSKDEIAYKSMLGVYGGVLGCVLNALLIAGEIYVS 242

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNW-TIFIKAKDIDLISHRNIFDEE 148
            AP+G      K  FE  L++PI++ +Y  ++IY K+W   +IK  DIDL +  +I + +
Sbjct: 243 AAPVGSPS-SAKAFFEYCLSIPIMIVVYVAHRIYRKDWRNWYIKRSDIDLDTGCSIENLD 301

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
           + K +++  +  + + P + ++
Sbjct: 302 LFKAQKEAEKELIASKPFYYKI 323

>KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 588

 Score = 82.8 bits (203), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 82/135 (60%), Gaps = 2/135 (1%)

Query: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           F IC S++R+R A+  Q++   E+ +KS +G+WG+    +++  +++ + +V + P+G+ 
Sbjct: 450 FSICYSYLRYRWALKKQNRSADEIAYKSMLGIWGAYLGLLLSALLIVGEIYVSLFPLGES 509

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIF-IKAKDIDLISHRNIFDEEIIKQEED 155
               +  F+  L++PI++A+Y G+K YT NW  F I    IDL +  +  D EI+K E +
Sbjct: 510 P-SAEAFFKYCLSIPIMIAVYIGHKSYTGNWKSFVIPLSGIDLDTGLSHSDVEIMKHELE 568

Query: 156 EYRGKLRNGPIWRRV 170
             R KL + P++ R+
Sbjct: 569 IQRVKLASKPLYYRI 583

>Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W
           (REAL)
          Length = 586

 Score = 79.3 bits (194), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 74/133 (55%), Gaps = 9/133 (6%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC+S VRFR A+  Q +   E+ +KS +GV+G     ++   ++  + +V 
Sbjct: 442 ISSFFTWFCICMSQVRFRMALKAQGRSKNEIAYKSMLGVYGGVLGCVLNALLIAGEIYVS 501

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNW-TIFIKAKDIDL-----ISHRN 143
            AP+G G    K  FE  L++PI++ +Y  ++IY  +W   +IK   IDL     + +  
Sbjct: 502 AAPVG-GTSTAKGFFEYCLSIPIMIVVYISHRIYRGDWKNWYIKKSKIDLDTGCSVENLE 560

Query: 144 IFDEEIIKQEEDE 156
           +F+E+  KQ E E
Sbjct: 561 LFNEQ--KQAEKE 571

>YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}
           SAM3High-affinity S-adenosylmethionine permease,
           required for utilization of S-adenosylmethionine as a
           sulfur source; has similarity to S-methylmethionine
           permease Mmp1p
          Length = 587

 Score = 79.3 bits (194), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 80/142 (56%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC+S +RFR A+  Q +   E+ +KS +GV+G     ++   ++  + +V 
Sbjct: 442 ISSFFTWFCICMSQIRFRMALKAQGRSNDEIAYKSILGVYGGILGCVLNALLIAGEIYVS 501

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIF-IKAKDIDLISHRNIFDEE 148
            AP+G      +  FE  L++PI++ +YF ++ Y ++W  F IK  +IDL +  ++ + E
Sbjct: 502 AAPVGSPS-SAEAFFEYCLSIPIMIVVYFAHRFYRRDWKHFYIKRSEIDLDTGCSVENLE 560

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
           + K +++     + + P + ++
Sbjct: 561 LFKAQKEAEEQLIASKPFYYKI 582

>TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score = 77.8 bits (190), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 81/142 (57%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I  + + F IC++ VRFR A+  + +    + ++S +G++G     I+   ++  + +V 
Sbjct: 439 IASFVTWFCICLAQVRFRLAMKARKRSKEHIAYRSMLGIYGGIAGCIVNFLLIAGEIYVS 498

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNW-TIFIKAKDIDLISHRNIFDEE 148
             P+ DGK   +  FE  L++PI++ ++ G+KIY  +W   ++K +D+DL +  +I + E
Sbjct: 499 AWPV-DGKSSAEGFFEYDLSIPIMIIVFLGHKIYRNDWKNWYVKRRDMDLDTGCSIENLE 557

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
           + + +++  +  L   P++ R+
Sbjct: 558 LFQSQKESEKEDLACKPLYYRI 579

>TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON} 
          Length = 587

 Score = 77.8 bits (190), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 81/142 (57%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC   +RFR A+  Q +   ++ + S +G++G     ++ + ++  + +V 
Sbjct: 442 ISFFTTWFCICFCQIRFRMAMKAQKRSADDIVYISPLGIYGGVLGCVLNVLLVAGEIYVS 501

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTI-FIKAKDIDLISHRNIFDEE 148
             P+G      +N F+  +++PI++ +Y G++IY K+W+  +IKAKDID  S   + + +
Sbjct: 502 AFPVGQPS-SAENFFQYCMSIPIMIVVYLGHRIYRKDWSHWYIKAKDIDRDSGYTLAELD 560

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
            IK  +++ +  + + P + +V
Sbjct: 561 NIKMRKEKDKAHIASRPFYYKV 582

>Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W
           (REAL)
          Length = 590

 Score = 76.3 bits (186), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 81/144 (56%), Gaps = 6/144 (4%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC+S VRFR A+  Q +   E+ +KS +GV+G     ++   ++  + +V 
Sbjct: 445 ISSFFTWFCICLSQVRFRMALKTQGRSKDEIAYKSILGVYGGVLGCVLNALLIAGEVYVS 504

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKN---WTIFIKAKDIDLISHRNIFD 146
            AP+G      K  FE  L++PI++ +Y  ++IY K+   W  +IK  +IDL +  ++ +
Sbjct: 505 AAPVGSPS-SAKAFFEYCLSIPIMIVVYIAHRIYRKDRRRW--YIKRSEIDLDTGCSVEN 561

Query: 147 EEIIKQEEDEYRGKLRNGPIWRRV 170
            E+ K +++  +  + + P + ++
Sbjct: 562 LELFKAQKEAEKQLIASKPFYYKI 585

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score = 75.1 bits (183), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 80/142 (56%), Gaps = 2/142 (1%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           +  + + F IC++ VR+R A+  + +    + +KS +G+WG     I+   ++  + +V 
Sbjct: 439 VAAFVTWFSICLAQVRYRMAMRARKRSLDSIAYKSILGIWGGVVGCIVNFLLVAGEVYVS 498

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNW-TIFIKAKDIDLISHRNIFDEE 148
             P  + K   +  F+  L++PI++ ++ G+KI+  +W   ++K KD+DL +  +I D E
Sbjct: 499 AFP-ANAKSSAEGFFKYTLSIPIMIVVFLGHKIHRNDWGNWYVKRKDMDLDTGCSIEDFE 557

Query: 149 IIKQEEDEYRGKLRNGPIWRRV 170
           + + +++  +  L + P++ RV
Sbjct: 558 LFQAQKEAEKRALASRPLYYRV 579

>Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {ON}
           YPL274W (SAM3) - High affinity S-adenosylMethionine
           Permease [contig 184] FULL
          Length = 596

 Score = 72.4 bits (176), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 79/145 (54%), Gaps = 5/145 (3%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F ICVS VRFR A+  Q + T E+  KS +G++G     ++ I ++  + +V 
Sbjct: 448 ISSFFTWFCICVSQVRFRLALRAQGRSTDEIAHKSMLGIYGGILGGVLNILLIAGEIYVS 507

Query: 90  IAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNW----TIFIKAKDIDLISHRNIF 145
           I P+G G    +  F+  +++PI++ +Y  +K Y         I +   +IDL S R I 
Sbjct: 508 IFPLG-GSPSAEQFFQYCMSIPIMIVVYALHKTYKATRRDAKRILVPLSEIDLDSGRRIQ 566

Query: 146 DEEIIKQEEDEYRGKLRNGPIWRRV 170
           D E+ K E +E + ++   P++ R+
Sbjct: 567 DIELFKHELEEDKARIAAKPLYYRI 591

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score = 63.9 bits (154), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
           +I V+H+RF +A+  Q     +L FK++   WG+ YAA     I+I Q +   AP    K
Sbjct: 424 LISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAP----K 479

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
               + F  Y+++ +  A++ G++I+ +   +F K +DIDL + R   D ++   EEDE
Sbjct: 480 FNVSDFFTAYVSVILFFAVWIGFQIWFRG-PLFKKTEDIDLDTDRREIDNDV--WEEDE 535

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 65/117 (55%), Gaps = 5/117 (4%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
           +I +SH+RF +A+  Q     +L FK++   WG+ YAA     I+I Q +   AP    K
Sbjct: 424 LISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAP----K 479

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEE 154
            +  + F  Y+++ +    + G++I+ +   +FIK +DIDL + R   D+ + ++++
Sbjct: 480 FKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDRREIDDVVWEEQK 535

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 40/56 (71%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIG 94
           I VSH+RFR A+  Q K   EL F S VG+WGS Y+A++ + ILIAQF++ + P+G
Sbjct: 448 INVSHIRFRMAMKAQDKTLDELEFVSAVGIWGSVYSAVVNVLILIAQFYISLWPVG 503

>NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON}  
           truncated as compared to S. cerevisiae HIP1/YGR191W;
           possible pseudogene
          Length = 171

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SH+R R+A+  Q++   EL F SQ GVWGS Y  I+    L+A FW  + P+G    
Sbjct: 90  INLSHIRVRQAMAKQNRSLDELPFLSQTGVWGSWYGTIVLFSDLVASFWTSLFPLGGTSA 149

Query: 99  ETKNLFENYLAMPILLAL 116
           + +  FE +  +  L+++
Sbjct: 150 DAELFFEVFFTVSHLISM 167

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 68/135 (50%), Gaps = 8/135 (5%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    + F IC +H+RF +A+  +     +L FK++   WG+ YAA     I+ 
Sbjct: 470 LINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFMPWGAYYAAFFVGLIIF 529

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +    P      +TK+ F +Y+++ +   LY G  IY +   + IK +DID+ + R 
Sbjct: 530 IQGYDAFTP-----WDTKSFFTSYISLILFGVLYLGCLIYYRG-RLLIKIEDIDIDTDRK 583

Query: 144 IFDEEIIKQEEDEYR 158
             + E    EED  R
Sbjct: 584 --EVEAYVWEEDAPR 596

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score = 58.5 bits (140), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 65/131 (49%), Gaps = 10/131 (7%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I ++ +RFRR + +Q K T EL FK+    WG  +  +    +++ Q W    P      
Sbjct: 444 IAITSIRFRRGLELQGK-THELKFKNWTYPWGPYFLVVFVSFVILIQGWSAFDP-----W 497

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
            T N F  YL + +  A Y  + +Y ++   FIK +D+D ++ + I  +++   E +E  
Sbjct: 498 STSNFFSVYLELFVFPACYLIWWLYKRD--KFIKYEDMDFVTDKYIPSKKV--NELNERL 553

Query: 159 GKLRNGPIWRR 169
             L+  P WR+
Sbjct: 554 DNLKGWPKWRQ 564

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 69/133 (51%), Gaps = 7/133 (5%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    +   I +SH+RF +A+  +     +L FK+++  WG+ YA+     I+ 
Sbjct: 472 LINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIF 531

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +    P    K +    F +Y+++ +L  L+ G ++Y +   I+ K +DID+ S R 
Sbjct: 532 IQGFQAFTP----KFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIW-KVEDIDIDSDRR 586

Query: 144 IFDEEIIKQEEDE 156
             + E I  EEDE
Sbjct: 587 --EIEAIIWEEDE 597

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 70/133 (52%), Gaps = 8/133 (6%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    + F I +SH+RF +A+  +     +L FK+++  WG+ Y+A     I+ 
Sbjct: 462 LINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYSAFFVFVIIF 521

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +    P      +T   F +Y+++ +L+ ++ G ++Y +     +K +DID+ + R 
Sbjct: 522 IQGFEAFTP-----WDTTTFFTSYISLILLVVVFIGCQLYYRC-RFLLKVEDIDIDTDRR 575

Query: 144 IFDEEIIKQEEDE 156
             + E I  E+DE
Sbjct: 576 --EIEAIIWEDDE 586

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 79/154 (51%), Gaps = 9/154 (5%)

Query: 13  LNRSSLALLVEVIYVSIITPYPSRFVICV--SHVRFRRAVHVQSKPTGELGFKSQVGVWG 70
           +N SS +  V   +V++++ +     IC+  +++ F RAV VQ     +  + +    +G
Sbjct: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518

Query: 71  SSYAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIF 130
           + ++  +  C+ IA        +G    + KN    Y+ +P+ +  YFGYK   K  T  
Sbjct: 519 TYFS--LAWCVFIAFIKNFTVFLGH-SFDYKNFITGYIGLPVFVIFYFGYKFIKK--TKI 573

Query: 131 IKAKDIDLISHRNIFDEEIIKQE--EDEYRGKLR 162
           +K+ ++DL + + +FD++ I+ +  + E + +LR
Sbjct: 574 VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 65/132 (49%), Gaps = 13/132 (9%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I ++ +RFR+ +  Q+K T EL FK+    +G  +  +    I++ Q W   AP      
Sbjct: 427 IAITSIRFRQGLEAQNK-THELKFKNWTYPFGPYFLVVAVTFIILVQGWSSFAP-----W 480

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
              N F  Y+ + +    +  + +Y ++   F+K KD+D ++ + +  +EII+  E    
Sbjct: 481 NVSNFFSVYIELFVFPFCFIIWWLYKRD--PFVKCKDMDFVTDKYVPSQEIIELNE---- 534

Query: 159 GKLRNGPIWRRV 170
            KL N   W+RV
Sbjct: 535 -KLDNLKGWKRV 545

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score = 53.1 bits (126), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 67/132 (50%), Gaps = 13/132 (9%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I ++ +RFR+ + VQ K T  L FK+    +G  +  I T+ I++ Q W    P      
Sbjct: 423 IGITSIRFRKGLEVQGK-TDLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDP-----W 476

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
              + F  YL + +   +Y  + ++ ++W  F+K +D+D ++ R I  +EI++  E    
Sbjct: 477 SVTDFFSVYLELFVFPFVYIIWWLWKRDW--FVKYEDMDFVTDRYIPTKEIVELNE---- 530

Query: 159 GKLRNGPIWRRV 170
            +L N   W++V
Sbjct: 531 -RLDNLKGWKKV 541

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score = 52.8 bits (125), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 66/133 (49%), Gaps = 7/133 (5%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    +   I +SH+RF  A+  +     +L FK++   +GS YA      I+ 
Sbjct: 470 LINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGSYYACFFITVIIF 529

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +   +P    K +  + F  Y+++ +L  L+ G ++Y +    F K +DID+ + R 
Sbjct: 530 IQGFTAFSP----KFDVASFFTAYISLILLAVLFIGCQLYYRC-RFFWKVEDIDIDTDRR 584

Query: 144 IFDEEIIKQEEDE 156
             DE  I  E+DE
Sbjct: 585 EIDE--IVWEDDE 595

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score = 52.8 bits (125), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 68/133 (51%), Gaps = 7/133 (5%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    +   I ++H+RF +A+  +     +L FK++   WG+ YA+     I+ 
Sbjct: 459 LINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWGAYYASFFVTVIIF 518

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +   AP    K +    F  Y+++ +L+ L+ G ++Y +   ++ K +DID+ S R 
Sbjct: 519 IQGFQAFAP----KFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLW-KLEDIDIDSDRR 573

Query: 144 IFDEEIIKQEEDE 156
             D   I  E+DE
Sbjct: 574 EIDA--IVWEDDE 584

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 64/133 (48%), Gaps = 5/133 (3%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    +   I +SH+RF +A+  +     +L FK++   W + YA      I+ 
Sbjct: 469 LINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWAAYYATFFVTVIIF 528

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +   +P      +    F  Y+++ IL  L+ G +IY +    F K +DID+ + R 
Sbjct: 529 IQGFQAFSP----HFDVTAFFTAYISLIILAVLFIGCQIYYRC-RFFWKLEDIDIDTDRR 583

Query: 144 IFDEEIIKQEEDE 156
             +E I + +E +
Sbjct: 584 EIEEVIWEDDEPK 596

>TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}
          Length = 106

 Score = 48.5 bits (114), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 75  AIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAK 134
           A + + +LI   WV + P+G+   +T+  FE YL++ IL+A + G    +KNW + I  K
Sbjct: 32  ASIIMLVLIVSSWVSLFPVGEPSADTEAFFEGYLSVTILIACHIG----SKNWQLLIPLK 87

Query: 135 DIDL 138
           D DL
Sbjct: 88  DFDL 91

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 69/138 (50%), Gaps = 11/138 (7%)

Query: 13  LNRSSLALLVEVIYVSIITPYP--SRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWG 70
           +N SS +  V   +V++++ +   S   I ++++RF +A+ VQ      L + +    W 
Sbjct: 410 MNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW- 468

Query: 71  SSYAAIMTICI--LIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWT 128
           S+Y A+   C+  LI  + V +      K + K     Y+ +P+ L  Y GYK+  +  T
Sbjct: 469 STYVALFFCCLIGLIKNYTVFLGH----KFDYKTFISGYIGIPVYLICYVGYKVVYR--T 522

Query: 129 IFIKAKDIDLISHRNIFD 146
             IK +D+DL + ++  D
Sbjct: 523 KLIKPEDVDLYTFKDAID 540

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 66/133 (49%), Gaps = 8/133 (6%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    +   I ++H+RF +A+  +     +L FK+++  WG+ YAA     I+ 
Sbjct: 460 LINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIF 519

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +    P      +    F +Y+++ +L  L  G ++Y +     +K +DID+ + R 
Sbjct: 520 IQGYQAFCP-----WDVSTFFTSYISLILLAVLVVGCQLYYRG-RFLLKLEDIDIDTDRR 573

Query: 144 IFDEEIIKQEEDE 156
             + E I  E+DE
Sbjct: 574 --EIESIVWEDDE 584

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 68/133 (51%), Gaps = 7/133 (5%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    +   I +SH+RF +A+  +     +L FK+++  +G+ YA      I+ 
Sbjct: 461 LINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPFGAYYATFFVTVIIF 520

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +   +P      +T   F +Y+++ IL  L+ G +I+ +    F + +DID+ S R 
Sbjct: 521 IQGFQAFSP----HWDTTAFFTSYISLIILAVLFIGCQIFYRC-RFFWRVEDIDIDSDRR 575

Query: 144 IFDEEIIKQEEDE 156
             + E +  E+DE
Sbjct: 576 --EIEAVIWEDDE 586

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 71/144 (49%), Gaps = 7/144 (4%)

Query: 13  LNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSS 72
           +N ++ A    ++ +S +    +   I ++H+RF + +  +      L FK++   W + 
Sbjct: 418 VNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWAAY 477

Query: 73  YAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIK 132
           YAA     I+  Q +   +P    K +    F  Y+++ ++L ++ G +IY K   ++ K
Sbjct: 478 YAASFVFVIIFIQGYTAFSP----KFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLW-K 532

Query: 133 AKDIDLISHRNIFDEEIIKQEEDE 156
            +DID+ ++R   D   I  E+DE
Sbjct: 533 LEDIDIDTNRREIDA--IVWEDDE 554

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 50.1 bits (118), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 63/132 (47%), Gaps = 10/132 (7%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I V+ +RFR+ +  Q K T EL FK+    +G  +  I    I++ Q W    P      
Sbjct: 434 IAVTSIRFRKGLAQQGK-TQELQFKNWTYPYGPYFLVIFVTLIILVQGWSAFDP-----W 487

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
            T + F  YL + +    +  + I+ ++   F+K +D+D I+ R I   + I  EE+E  
Sbjct: 488 STSDFFSYYLELFVFPTCWLIWWIFKRD--RFVKPEDMDFITDRYIQSPQEI--EENERL 543

Query: 159 GKLRNGPIWRRV 170
             L   P +R++
Sbjct: 544 DNLEGYPKYRQI 555

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 62/119 (52%), Gaps = 5/119 (4%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    +   I +SH+RF +A+  +     +L FK+++  WG+ YAA     I+ 
Sbjct: 435 LINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIF 494

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHR 142
            Q +   +P    K +    F  Y+++ IL+ L  G ++Y +   ++ K +DID+ + R
Sbjct: 495 IQGFEAFSP----KFDVSGFFTAYISLIILVVLLIGCQLYYRCRFLW-KLEDIDIDTDR 548

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 66/132 (50%), Gaps = 10/132 (7%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
           +I  SH+RF +A+  +     +L +K+ +  W + YA    + I++ Q +   AP    K
Sbjct: 417 LISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP----K 472

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            +  N F  Y+++ + +  +  ++I+ K   ++ K +D+DL + R   +EE+   + ++ 
Sbjct: 473 FKVANFFAAYISVFLFIIFWVAFQIWFKCRLVW-KLQDVDLDTDRRDIEEEVWSDDVED- 530

Query: 158 RGKLRNGPIWRR 169
               +N   W R
Sbjct: 531 ----KNKNWWDR 538

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 68/147 (46%), Gaps = 13/147 (8%)

Query: 13  LNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSS 72
           LN ++      ++ +S +    +   I ++H+RF + +  +     +L FK++   W + 
Sbjct: 414 LNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAY 473

Query: 73  YAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKN---WTI 129
           YA      I+  Q +    P    K +    F +Y+++ ++L ++ G +IY K    W +
Sbjct: 474 YATFFVTVIIFIQGYTAFTP----KFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAV 529

Query: 130 FIKAKDIDLISHRNIFDEEIIKQEEDE 156
               +DID+ S R   D   I  EEDE
Sbjct: 530 ----EDIDIDSDRREIDA--IVWEEDE 550

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 60/116 (51%), Gaps = 5/116 (4%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I ++HVRF + +  +     +L FK++   WGS YAA     I+  Q +   +P      
Sbjct: 474 ISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSP----HF 529

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEE 154
           +    F +Y+++ +L  ++ G ++Y +   ++ K +D+D+ S R   ++ I + +E
Sbjct: 530 DVTTFFTDYISLILLAVVFIGAQLYYRCRFLW-KLEDVDIDSDRREIEDAIWEDDE 584

>Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON}
           YBR132C (REAL)
          Length = 598

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 74/150 (49%), Gaps = 19/150 (12%)

Query: 12  DLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGS 71
            LN +S  +L  +I +   +   +  V+C++++ FRRA HVQ     +L F+S    WG 
Sbjct: 449 QLNSNSAVVLNWLINLITASQLINFVVLCITYLFFRRAYHVQQDSLPKLPFRS----WGQ 504

Query: 72  SYAAIMTI----CILIAQFWVVIAPIGDGKL-ETKNLFENYLAMPILLALYFGYKIYTKN 126
            Y AI+ +     +++ Q + V  P    KL  T++   +YL + I + +Y GYK     
Sbjct: 505 PYTAIIGLVSCSAMILIQGYTVFFP----KLWSTQDFLFSYLMVFINIGIYVGYKF---- 556

Query: 127 WTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
             I+ + KD     H   F +E+++ E  E
Sbjct: 557 --IWKRGKDKFKNPHEIDFSKELVEIENHE 584

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 14/130 (10%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIA---QFWVVIAPIGD 95
           I ++++ F RA   Q+       +++    +G+     +  C+LIA    F V I     
Sbjct: 438 ILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYIT--LFFCVLIAFIKNFTVFI----- 490

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEII--KQE 153
           G+ + K+    Y+ +P+ +  YFGYKI  K  T  +KA++ DL S +   D E    K +
Sbjct: 491 GEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAIDREEAEGKIK 548

Query: 154 EDEYRGKLRN 163
           E E + +L+N
Sbjct: 549 EAEAKERLKN 558

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 76/151 (50%), Gaps = 14/151 (9%)

Query: 13  LNRSSLALLVEVIYVSIITPYP--SRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWG 70
           +N SS +  V   +V++++ +   S   I ++++ F RA+  Q      L + + +   G
Sbjct: 415 MNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKG 474

Query: 71  SSYAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIF 130
           + +A  +  C LIA        +G  K + KN    Y+ +P+ +  +FGYK Y +  T F
Sbjct: 475 AYFA--LFFCCLIALIKNFTVFLGH-KFDYKNFITGYIGIPVFIICFFGYK-YIRG-TKF 529

Query: 131 IKAKDIDLISHRNIFDEEIIKQEEDEYRGKL 161
           +K ++ DL + +     E+I  EE+E  GKL
Sbjct: 530 VKPEEADLYTFK-----ELIDLEEEE--GKL 553

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIA---QFWVVIAPIGD 95
           I ++++ F RAV  Q+       +++    +GS +   +  CILIA    F V +    +
Sbjct: 474 ILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFT--LAFCILIAFIKNFTVFL----N 527

Query: 96  GKLETKNLFENYLAMPILLALYFGYKIY--TKNWTIFIKAKDIDLISHRNIFD--EEIIK 151
              + KN    Y+ +P+ +  YFGYK    TK W    K +++DL + +   D  EE  K
Sbjct: 528 HHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW----KPEEVDLYTFKAAIDEEEEQGK 583

Query: 152 QEEDEYRGKLRN 163
             + E R +L+N
Sbjct: 584 IADAERRERLKN 595

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 64/134 (47%), Gaps = 16/134 (11%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICIL--IAQFWVVIAPIGDG 96
           I ++++ F RAV  Q        + + +  +G+ Y ++   C+L  I  F V +    + 
Sbjct: 450 ILITYICFDRAVRAQGIDKSTFAYVAPLQPYGA-YFSLFFCCLLALIKNFTVFL----NH 504

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
           K + +N    Y+ +P+    YFGYK   K  T   K +++DL S +   D+E    EED 
Sbjct: 505 KFDYRNFITGYIGLPLFFICYFGYKFVKK--TKIRKPEEVDLFSFKAAIDQE----EED- 557

Query: 157 YRGKLRNGPIWRRV 170
             G++++     R+
Sbjct: 558 --GRIKDAATAERI 569

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 63/121 (52%), Gaps = 6/121 (4%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I ++++RF +A  VQ      L ++S +  +G+ ++  +  CILI       A +GD   
Sbjct: 467 ILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFS--LFFCILIGLIKNFPAFLGD-TF 523

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFD-EEIIKQEEDEY 157
           + K+    Y+ +P  +  Y GYK++ K  T  I ++++DL+S +   D EE   +  DE 
Sbjct: 524 DYKSFITGYIGIPTYIISYIGYKLWYK--TKIIPSEEVDLVSFKEAVDLEEEEGKMLDEE 581

Query: 158 R 158
           R
Sbjct: 582 R 582

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 68/144 (47%), Gaps = 9/144 (6%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           ++ ++ I  + S   I + HVRF +A+ +Q     +L FK+++  WG+ Y+A     I+I
Sbjct: 421 LLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIII 480

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +  +AP         N F  Y+++ + L ++  ++ + +   I  + + +D+ S R 
Sbjct: 481 IQGFTSLAP----TFNVSNFFAAYISVFMFLVIWAVFQCWYRT-RIIHRIEHVDIDSDR- 534

Query: 144 IFDEEIIKQEEDEYRGKLRNGPIW 167
               E+  Q+ D        G  W
Sbjct: 535 ---REVDAQQWDNTEPTTLWGKFW 555

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 76/158 (48%), Gaps = 13/158 (8%)

Query: 13  LNRSSLALLVEVIYVSIITPYP--SRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWG 70
           +N SS A  V   +V+ ++ +   S   I V+++ F +A   Q        + +    +G
Sbjct: 427 MNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAPWQPYG 486

Query: 71  SSYAAIMTICIL--IAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWT 128
           + Y A+   C+L  +  F V +     G+ + KN    Y+ +P+    + GYKI  K  T
Sbjct: 487 A-YFALFFCCVLALVKNFTVFLG----GQFDYKNFITGYIGIPVFFICFVGYKIVYKTKT 541

Query: 129 IFIKAKDIDLISHRNIFD--EEIIKQEEDEYRGKLRNG 164
              + +++DL++ + + D  EE  K E+ E   +L+NG
Sbjct: 542 --HRPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNG 577

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 68/133 (51%), Gaps = 8/133 (6%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    +   I ++H+RF +A+  +     +L FK+++  +G+ YAA     I+ 
Sbjct: 474 LINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIF 533

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +    P      +    F +Y+++ +L  ++ G +IY K   I+ K +DID+ S R 
Sbjct: 534 IQGFQAFCP-----FKVSEFFTSYISLILLAVVFIGCQIYYKCRFIW-KLEDIDIDSDRR 587

Query: 144 IFDEEIIKQEEDE 156
             + E I  E+DE
Sbjct: 588 --EIEAIIWEDDE 598

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 66/142 (46%), Gaps = 17/142 (11%)

Query: 13  LNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSS 72
           +N S+LA L   +++SI            SH+RF + +  +     +L FKS++  +G+ 
Sbjct: 423 INISTLAGLCAWLFISI------------SHIRFMQCLKQRGISRDDLPFKSKLMPYGAY 470

Query: 73  YAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIK 132
           YAA     I+  Q +    P    K +    F  Y+++ ILLA+ F           F +
Sbjct: 471 YAAFWVAVIIFVQGFQAFCP----KFKVAEFFTGYISL-ILLAVVFCLAQLYYRCRFFNR 525

Query: 133 AKDIDLISHRNIFDEEIIKQEE 154
            +DID+ S R   D  I ++EE
Sbjct: 526 LEDIDIDSDRREIDALIWEEEE 547

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 58/120 (48%), Gaps = 10/120 (8%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICIL--IAQFWVVIAPIGDG 96
           I ++++ F RAV  Q        + +    +G+ Y ++   C++  I  F V +     G
Sbjct: 451 ILITYICFDRAVRAQHVDKSTFAYVAPFQPYGA-YVSLFFCCLIAIIKNFTVFL-----G 504

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
             + K     Y+ +PI +  YFGYKI  K+      A+ +DL+S +++ D E ++ E  E
Sbjct: 505 HFDYKTFITGYIGLPIFVLCYFGYKITCKSEI--RSARYVDLVSQKSLVDREQVEYELIE 562

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 78/158 (49%), Gaps = 12/158 (7%)

Query: 13  LNRSSLALLVEVIYVSIITPYP--SRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWG 70
           +N SS +  +   +V++++ +   S   I + ++ F +A   Q     +  + +    +G
Sbjct: 440 MNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYG 499

Query: 71  SSYAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIF 130
           + +A  ++ CILIA        +G  K + K     Y+ +P+ +  + GYK+  K  T  
Sbjct: 500 AYFA--LSFCILIALIKNFTVFLGH-KFDYKTFITGYIGLPVYILSWAGYKLIYK--TKV 554

Query: 131 IKAKDIDLISHRNIFDEEI----IKQEEDEYRGKLRNG 164
           IK+ D+DL + + I+D E     IK +E E R + RNG
Sbjct: 555 IKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQ-RNG 591

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 70/131 (53%), Gaps = 5/131 (3%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           ++ ++ I  + +   I + H+RF +A+  Q     +L FK+++  WG+ YAA   + I+I
Sbjct: 417 LLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLIII 476

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +   AP    K    N F  Y+++ + +A++  +++  K+  I  K +D+D+ S R 
Sbjct: 477 IQGFTAFAP----KFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIH-KVEDVDIDSDRR 531

Query: 144 IFDEEIIKQEE 154
             + E+ + +E
Sbjct: 532 EIEAEVWEDDE 542

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 58/119 (48%), Gaps = 7/119 (5%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
           +I +SH+RF +A+  +      L FK+    W + YA    I I++ Q +   AP    +
Sbjct: 475 LISLSHIRFMKALEYRGISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAFAP----R 530

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
               +   +Y+++ +L  + +G     K   IF K +DIDL S R   D E I+ E+D 
Sbjct: 531 FNVSDFVASYISL-LLFVIIWGVFQAMKKCRIFWKVEDIDLDSDRK--DIEDIRWEDDS 586

>Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C
           (ALP1) - Basic amino acid permease [contig 55] FULL
          Length = 544

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 68/136 (50%), Gaps = 19/136 (13%)

Query: 39  ICVS--HVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           +C+S   +RFRR +  Q K T EL F +    +G  +  +    I++ Q W   AP    
Sbjct: 415 LCISIVSIRFRRGLAKQGK-THELQFSNWTYPYGPYFLVLFVSFIILVQGWSSFAP---- 469

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNI--FDEEIIKQEE 154
                + F  Y+ + + +ALY  + ++ ++   F++++D+D ++ + I   +E ++ +E 
Sbjct: 470 -WNVTDFFSYYIELIVFVALYVFWWLWKRD--AFVRSEDMDFVTDKYISPHEEVLLNEEL 526

Query: 155 DEYRGKLRNGPIWRRV 170
           D  +G       W++V
Sbjct: 527 DNLKG-------WKKV 535

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 69/133 (51%), Gaps = 8/133 (6%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    +   I ++H+RF +A+  +     +L FK+++  +G+ YAA     I+ 
Sbjct: 475 LINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGAYYAAFFVTVIIF 534

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +    P      +  + F +Y+++ +L  ++ G ++Y K   I+ K +DID+ + R 
Sbjct: 535 IQGFQAFCP-----FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIW-KLEDIDIDTDRR 588

Query: 144 IFDEEIIKQEEDE 156
             + E I  E+DE
Sbjct: 589 --EIEAIIWEDDE 599

>YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}
           AGP2High affinity polyamine permease, preferentially
           uses spermidine over putrescine; expression is
           down-regulated by osmotic stress; plasma membrane
           carnitine transporter, also functions as a low-affinity
           amino acid permease
          Length = 596

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 72/150 (48%), Gaps = 19/150 (12%)

Query: 12  DLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGS 71
            LN +S  +L  +I +   +   +  V+C+ ++ FRRA HVQ     +L F+S    WG 
Sbjct: 447 QLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPFRS----WGQ 502

Query: 72  SYAAIMTI----CILIAQFWVVIAPIGDGKL-ETKNLFENYLAMPILLALYFGYKIYTKN 126
            Y AI+ +     +++ Q + V  P    KL  T++   +YL + I + +Y GYK     
Sbjct: 503 PYTAIIGLVSCSAMILIQGYTVFFP----KLWNTQDFLFSYLMVFINIGIYVGYKF---- 554

Query: 127 WTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
             I+ + KD     H   F +E+ + E  E
Sbjct: 555 --IWKRGKDHFKNPHEIDFSKELTEIENHE 582

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 70/142 (49%), Gaps = 17/142 (11%)

Query: 13  LNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSS 72
           +N S+LA L   +++SI            SH+RF + +  +     +L FKS++  +G+ 
Sbjct: 484 INISTLAGLCAWLFISI------------SHIRFMQCLKQRGISRDDLPFKSKLMPYGAY 531

Query: 73  YAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIK 132
           YAA     I+  Q +   +P      +    F +Y+++ +L+ ++ G +++ +    F +
Sbjct: 532 YAAFWVTVIIFVQGFQAFSP----HFKVTEFFTSYISLMLLVVVFCGAQLFYRC-RFFNR 586

Query: 133 AKDIDLISHRNIFDEEIIKQEE 154
            +DID+ S R   D  I + +E
Sbjct: 587 LEDIDIDSDRREADALIWEDDE 608

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 68/133 (51%), Gaps = 8/133 (6%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    +   I +SH+RF +A++ +     +L FK++   +G+ YA+     I+ 
Sbjct: 474 LINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGAYYASFFVTVIIF 533

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +    P         + F +Y+++ +L  ++ G ++Y K   I+ K +DID+ S R 
Sbjct: 534 IQGFQSFCP-----FRVADFFTSYISLILLAVVFTGCQLYYKCRFIW-KLEDIDIDSDRR 587

Query: 144 IFDEEIIKQEEDE 156
             + E I  E+DE
Sbjct: 588 --EIEAIIWEDDE 598

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 58/117 (49%), Gaps = 8/117 (6%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I ++ +RFR+ +  Q K T EL +K+    +G  +  I    I++ Q W    P      
Sbjct: 431 IGITSIRFRKGLEKQGK-THELRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDP-----W 484

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEED 155
           +  N F  YL + +    +  + +Y ++   F+K +D+D ++ R I  +EII+  E+
Sbjct: 485 DVTNFFSYYLDLFVFPFCFIIWWLYKRD--RFVKLEDMDFVTDRYIPTKEIIELNEN 539

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 64/133 (48%), Gaps = 7/133 (5%)

Query: 27  VSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQF 86
           +S I+ +     I ++++RFR+A+  Q+     + FK+    +G+ +  I    I +   
Sbjct: 431 ISTISGFIGWICIGIAYLRFRKAIFFQNLYE-RVPFKTPFQPYGTWFFIIAVSVICLTNG 489

Query: 87  WVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNW-TIFIKAKDIDLISHRNIF 145
           + +  P         +    Y+ +PI L L+ G+K++T+ W T  I   +ID+ +     
Sbjct: 490 YAIFIP---ANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWAIPVPEIDVTTGLKEI 546

Query: 146 DEEIIKQEEDEYR 158
           +EE   +E DE R
Sbjct: 547 EEE--SKECDEKR 557

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 62/128 (48%), Gaps = 7/128 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I ++ + F RAV  Q        + +    +GS +A  +  C+L+A        +G+ + 
Sbjct: 473 ILITFIYFDRAVRAQGIDRSTFAYVAPFQPYGSYFA--LFFCVLLALIKNFSVFLGN-EF 529

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFD--EEIIKQEEDE 156
           + K     Y+ +P+    + GYK+Y K  T  +K  + DL S++   D  EE  K +E E
Sbjct: 530 DYKTFITGYIGLPVYAFSFIGYKLYYKTKT--VKPHEADLNSYKAAVDREEEEGKIKEAE 587

Query: 157 YRGKLRNG 164
            + +L++G
Sbjct: 588 RKERLKHG 595

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 58/111 (52%), Gaps = 4/111 (3%)

Query: 12  DLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGS 71
           +L+ S+  +   ++ ++ I  + +   I ++H+RF + +  ++    +L FK++   WG+
Sbjct: 438 NLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGA 497

Query: 72  SYAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKI 122
            Y+A     I+I Q +   AP    K    N F  Y+++ + LA++  ++I
Sbjct: 498 YYSAFFISLIIIIQGFTAFAP----KFNVSNFFAAYISVFLFLAIWVVFQI 544

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 66/133 (49%), Gaps = 5/133 (3%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    + F I V+H+RF + + ++      L FK+++  WG+ YAA     I+ 
Sbjct: 441 LINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVF 500

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +   AP    + +    F  Y+++ +L+ L+   ++Y +      K +DID+ S R 
Sbjct: 501 IQGFTAFAP----RFDVSEFFTAYISLILLVVLFILCQLYYRC-RFLTKIEDIDIDSDRR 555

Query: 144 IFDEEIIKQEEDE 156
             D  I + +E +
Sbjct: 556 EIDAIIWEDDEPK 568

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/139 (19%), Positives = 71/139 (51%), Gaps = 6/139 (4%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           ++ ++ +  + +  +I +SH+RF + +  +     +L FK++   WG+ YAA     I++
Sbjct: 431 LLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIIL 490

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +   AP    +        +Y+++ + +  + G+++  K   + ++ +D+D+ + R 
Sbjct: 491 IQGFDSFAP----EFVFSEFIADYISVFLFIVCWLGFQVLFKT-RLILRKEDVDIDTDRR 545

Query: 144 IFDEEIIKQEEDEYRGKLR 162
             D  ++  ++DE +  L+
Sbjct: 546 EID-ALVWSDDDEPKTLLQ 563

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 63/132 (47%), Gaps = 12/132 (9%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICI-LIAQFWVVIAPIGDG 96
            I + ++ F +A   Q     +  + +    +G+ +A +  I I LI  F V +      
Sbjct: 468 TILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGH---- 523

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEE----IIKQ 152
           K + K     Y+ +P+ +  + GYK+  K  T  IK+ D+DL + + I+D E     I+ 
Sbjct: 524 KFDYKTFITGYIGLPVYVFSWVGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEQGKIED 581

Query: 153 EEDEYRGKLRNG 164
           +E E R K +NG
Sbjct: 582 QEKEERLK-KNG 592

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 61/135 (45%), Gaps = 8/135 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I ++++ F RA   Q  P   L + +    +    A I   CI +A      A IG  ++
Sbjct: 450 ILITYICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIF--CIFVALIKNFDAFIGK-EV 506

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFD---EEIIKQEED 155
           +       Y+ +PI +  + GYKI  K  T +I +K++DL + +   D   EE I++   
Sbjct: 507 DVPTFITGYIGLPIYIFCFIGYKIVHK--TKWIPSKEVDLFTFKEAIDLEEEECIRERAL 564

Query: 156 EYRGKLRNGPIWRRV 170
                 + G  W+++
Sbjct: 565 MKEQLAKGGLSWKKI 579

>Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W
           (REAL)
          Length = 231

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%)

Query: 30  ITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVV 89
           I+ + + F IC+S VRFR A+  Q +   E+ +KS +GV+G     ++   ++  + +V 
Sbjct: 170 ISSFFTWFCICMSQVRFRMALKAQGRSKNEIAYKSMLGVYGGVLGCVLNALLIAGEIYVS 229

Query: 90  IA 91
            A
Sbjct: 230 AA 231

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 76/158 (48%), Gaps = 12/158 (7%)

Query: 13  LNRSSLALLVEVIYVSIITPYP--SRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWG 70
           +N SS +  +   +V++++ +   S   I + ++ F +A   Q     +  + +    +G
Sbjct: 442 MNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYG 501

Query: 71  SSYAAIMTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIF 130
           + +A  +  CILIA        +G  K + K     Y+ +P+ +  + GYK+  K  T  
Sbjct: 502 AYFA--LFFCILIALIKNFTVFLGH-KFDYKTFITGYIGLPVYIISWAGYKLIYK--TKV 556

Query: 131 IKAKDIDLISHRNIFDEEI----IKQEEDEYRGKLRNG 164
           IK+ D+DL + + I+D E     +K +E E R K  NG
Sbjct: 557 IKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLK-SNG 593

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 9/127 (7%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
           +I ++H+RFR+A  +Q +   EL +KS +  WG  ++    I + + Q W    P     
Sbjct: 416 IISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPIFSLAANIFLGLIQGWTTFVP----- 470

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE- 156
              K+  + Y+ +P  + LY    +        +  + +DL   R    E++     DE 
Sbjct: 471 FSAKDFVDAYILLPAAVILYIVISLVKIGGFKLVDLRTVDLEEGRR---EDLDSDGTDED 527

Query: 157 YRGKLRN 163
             GK R+
Sbjct: 528 SEGKDRS 534

>KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {ON}
           similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W Lysine permease; one of three amino acid
           permeases (Alp1p, Can1p, Lyp1p) responsible for uptake
           of cationic amino acids
          Length = 543

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 64/134 (47%), Gaps = 15/134 (11%)

Query: 39  ICVS--HVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96
           +C+S   +RFRR +  Q K T EL F +    +G  +  +    I+  Q W   AP    
Sbjct: 414 LCISVISIRFRRGLARQGK-THELQFVNWTYPYGPYFLVVFVTFIIFVQGWSSFAP---- 468

Query: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
                + F  Y+ + + +ALY  + ++ ++   F+K+ ++D ++ + +  EE +   E  
Sbjct: 469 -WSVSDFFSYYIELIVFVALYAFWWLWKRD--SFVKSDEMDFVTDKYVSPEEEVLLNE-- 523

Query: 157 YRGKLRNGPIWRRV 170
              +L N   W++V
Sbjct: 524 ---RLDNLKGWKKV 534

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 58/133 (43%), Gaps = 14/133 (10%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICI-LIAQFWVVIAPIGDGK 97
           I ++++ F RAV  Q        + +    +G+ ++      I LI  F V +    + +
Sbjct: 456 ILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQ 511

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            + KN    Y+ +P+    YFGYK   K  T  I    +DL + +   D+E    EED  
Sbjct: 512 FDYKNFITGYIGLPVFFFCYFGYKFTYK--TKVIDPLKVDLYTFKAAIDQE----EED-- 563

Query: 158 RGKLRNGPIWRRV 170
            GK+ +     R+
Sbjct: 564 -GKMADAEKAERI 575

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 66/133 (49%), Gaps = 8/133 (6%)

Query: 24  VIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILI 83
           +I +S +    +   I ++H+RF +A+  +     +L FK+++  +G+ YA+     I+ 
Sbjct: 474 LISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYYASFFVTIIIF 533

Query: 84  AQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRN 143
            Q +    P           F +Y+++ +L  ++   ++Y K   I+ K +DID+ S R 
Sbjct: 534 IQGFQAFCP-----FSVSEFFTSYISLILLAVVFISCQLYYKCRFIW-KLEDIDIDSDRR 587

Query: 144 IFDEEIIKQEEDE 156
             + E I  E+DE
Sbjct: 588 --EIEAIIWEDDE 598

>KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar to
           uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 523

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 7/113 (6%)

Query: 43  HVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKLETKN 102
           H+RFRR    QSKP  +LGF + +  W +     +   +++ Q W    P      + K 
Sbjct: 411 HLRFRRGWVKQSKPLSDLGFVAPLFPWINIVGITLGTILVLVQGWSSFCP-----WDKKA 465

Query: 103 LFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEED 155
             + Y+ +P+   ++  Y +     T  IK+ ++D  S R + D + +K+E  
Sbjct: 466 FIDGYIMLPVFFLVWGLYDLVLLK-TKIIKSSEMDFESDRKL-DLDALKKETS 516

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 75/167 (44%), Gaps = 29/167 (17%)

Query: 1   MSYLYKSDARGDLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGEL 60
           +S+L    A  +++ S+  +      +S I+ +      C++++RFR+A+         L
Sbjct: 460 VSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRL 518

Query: 61  GFKSQVGVWGSSYA--------AIMTI----CILIAQFWVVIAPIGDGKLETKNLFENYL 108
            FK+    WG  Y          I+TI     I I ++W V            +    Y+
Sbjct: 519 PFKT----WGQPYTVWFSLIVIGIITITNGYAIFIPKYWRV-----------ADFIAAYI 563

Query: 109 AMPILLALYFGYKIYTKNW-TIFIKAKDIDLISHRNIFDEEIIKQEE 154
            +PI L L+FG+K+YT+ W   ++   +ID+ +     +E+  + EE
Sbjct: 564 TLPIFLVLWFGHKLYTRTWRQWWLPVSEIDVTTGLVEIEEKSREIEE 610

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 46/87 (52%), Gaps = 4/87 (4%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I +SHVRF + +  +     +L FK+++  WG+ YAA     I+I Q +    P    K 
Sbjct: 439 ISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAFTP----KF 494

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTK 125
              + F +Y+++ +L  L+ G +++ +
Sbjct: 495 RVSDFFTSYISLILLAVLFLGCQLFYR 521

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 61/112 (54%), Gaps = 5/112 (4%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
           +I  SH+RF +A+  +     +L +K+++  + + YA+     I++ Q +   AP     
Sbjct: 373 LISFSHIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAP----S 428

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEI 149
            +  +    Y+++ + +A++F ++++ K   I +K +D+D+ S R   +E++
Sbjct: 429 FQPVDFVAAYISVFLFVAIWFSFQLWFKC-PIILKLQDVDIDSDRREIEEQV 479

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 70/150 (46%), Gaps = 19/150 (12%)

Query: 12  DLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGS 71
            LN +S  +L  +I +   +   +  V+C+ ++ FRRA  VQ      L F+S    WG 
Sbjct: 448 QLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRAYRVQQDSLPRLPFRS----WGQ 503

Query: 72  SYAAIMTI----CILIAQFWVVIAPIGDGKL-ETKNLFENYLAMPILLALYFGYKIYTKN 126
            Y AI+ +     +++ Q + V  P    KL  T++   +YL + I + +Y GYK     
Sbjct: 504 PYTAIIGLVSCSAMILIQGYTVFFP----KLWSTQDFLFSYLMVFINIGIYVGYKF---- 555

Query: 127 WTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
             I+ + KD     H   F +E+ + E  E
Sbjct: 556 --IWKRGKDSLKNPHDIDFSKELTEIENHE 583

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 78/171 (45%), Gaps = 31/171 (18%)

Query: 1   MSYLYKSDARGDLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGEL 60
           +S+L    A  +++ S+  +      +S I+ +      C++++RFR+A+         L
Sbjct: 464 VSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-FDRL 522

Query: 61  GFKSQVGVWGSSYA--------AIMTI----CILIAQFWVVIAPIGDGKLETKNLFENYL 108
            FK+    WG  Y          I+T+     I I ++W           +  +    Y+
Sbjct: 523 PFKT----WGQPYTVWASLIVVGIITLTNGYAIFIPKYW-----------KIADFIAAYI 567

Query: 109 AMPILLALYFGYKIYTKNWTI-FIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
            +PI L L+FG+K+YT+ W+  ++   +ID+ +   + + E   +E +E R
Sbjct: 568 TLPIFLVLWFGHKLYTRTWSQWWLPVSEIDVTT--GLIEIEEKSREIEEMR 616

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 51/119 (42%), Gaps = 6/119 (5%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
           VI  +H+R R+A   Q +   EL +K+ +  W   ++ I  + + + Q W    P   G 
Sbjct: 421 VISYTHLRVRKAWVTQGRSLEELPYKALLYPWTPIFSLIANVFLALIQGWTSFVPFDAG- 479

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLI-SHRNIFDEEIIKQEED 155
               N  + Y+ +P+ + LY    ++  +    +  K +DL    R   D +   QE  
Sbjct: 480 ----NFVDAYILLPVAIVLYVAICVFKNHHFRIVDLKSVDLDEGRRKDIDADFSDQESS 534

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 66/133 (49%), Gaps = 13/133 (9%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
           +I  SH+RF +A+  +     +L +K+Q+  + + YA+     I++ Q +   AP     
Sbjct: 449 LISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP----T 504

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEY 157
            +  +    Y+++ + LA++  ++++ K   +  K +DID+ S R   +E +  + E + 
Sbjct: 505 FQPIDFVAAYISIFLFLAIWLSFQVWFKC-RLLWKLQDIDIDSDRRQIEELVWIEPECKT 563

Query: 158 RGKLRNGPIWRRV 170
           R        W+RV
Sbjct: 564 R--------WQRV 568

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 10/126 (7%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I V  +RFR+ +  Q K   EL F++    +G  +  I    I++ Q W    P      
Sbjct: 440 IAVISIRFRKGLEAQGK-VHELKFRNWTYPYGPWFCIIFISLIILVQGWSAFDP-----W 493

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEE--IIKQEEDE 156
            T + F  YL + +  A +  + +  ++   F KAKD+D I+ + +  EE  ++ +  D 
Sbjct: 494 STSSFFSFYLELIVFPACWIFWWVIKRD--RFKKAKDMDFITDKYVQSEEESLLNERLDN 551

Query: 157 YRGKLR 162
            +G  R
Sbjct: 552 LKGLPR 557

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 51/101 (50%), Gaps = 4/101 (3%)

Query: 27  VSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQF 86
           +S I+ +   F  C++++RFRR +         L FK++  V+ + Y+ +    +++   
Sbjct: 441 ISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRLPFKTKGQVYLTWYSFVFVGILILTNG 499

Query: 87  WVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNW 127
           ++ I P        ++    Y+ +P+ L LYFG+ IY+  W
Sbjct: 500 YMYIIP---KFWNYQDFIAAYITLPVFLVLYFGHIIYSGRW 537

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 63/119 (52%), Gaps = 7/119 (5%)

Query: 38  VICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGK 97
           +I +SH+RF +A+  +     EL FK+++    + +AA   I I++ Q +   AP    K
Sbjct: 466 LISISHIRFMQALKYRGISRDELPFKAKLMPGLAYFAATFMIIIILIQGFTAFAP----K 521

Query: 98  LETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
            +  +    Y+++ + LA++  ++I  +   I+ K +D+D+ S R   D E I  E+ E
Sbjct: 522 FDGIDFLAAYISIFLFLAIWILFEIIFRCRFIW-KIEDVDIDSDRR--DIEAIVWEDHE 577

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 31/145 (21%)

Query: 27  VSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYA--------AIMT 78
           +S I+ +      C++++RFR+A+         L FK+    WG  Y         +I+T
Sbjct: 485 ISTISGFLGWICGCIAYLRFRKAIFYNGL-YDRLPFKT----WGQPYTVWFSLIVVSIIT 539

Query: 79  I----CILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKNW-TIFIKA 133
           I     I I ++W V            +    Y+ +PI L L+ G+K+YT+ W   ++  
Sbjct: 540 ITNGYAIFIPKYWKV-----------ADFIAAYVTLPIFLVLWLGHKLYTRTWHQWWLPV 588

Query: 134 KDIDLISHRNIFDEEIIKQEEDEYR 158
            +ID+   R + + E   +E +E R
Sbjct: 589 SEIDVT--RGLVEIEEKSREIEELR 611

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 57/125 (45%), Gaps = 12/125 (9%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I V+++ F RAV  Q        + +    +G+ +A  +  C LIA        +G  + 
Sbjct: 459 ILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFA--LFFCSLIALIKNFTVFLGH-QF 515

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
           + K     Y+ +P+    YFGYK+  K  T  I   ++DL + +   D+E    EED   
Sbjct: 516 DYKTFITGYIGIPVFFISYFGYKLIYK--TKIIDPLEVDLYTFKAAIDQE----EED--- 566

Query: 159 GKLRN 163
           GKL +
Sbjct: 567 GKLED 571

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 10/123 (8%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I ++ +RFR+ +  Q K T EL +K+    +G  +  I    I++ Q W   AP      
Sbjct: 427 IGITSIRFRKGLEKQGK-THELIYKNWTYPYGPYFVIIFVSFIILIQGWSAFAP-----W 480

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEE--DE 156
              N F  YL + +    +  + +  ++   F+K +D+D  + R I  +EII+  E  D 
Sbjct: 481 NVSNFFSYYLELFVFPVCFIIWWLVKRD--RFVKYEDMDFTTDRYIPTKEIIELNETLDN 538

Query: 157 YRG 159
            +G
Sbjct: 539 LKG 541

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 60/129 (46%), Gaps = 8/129 (6%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I + ++ F RA   Q     +  + +    +G+ +A  +  CILIA        +G    
Sbjct: 468 ILIVYIYFDRACRAQGVDKSKFAYVAPGQRYGAYFA--LFFCILIALIKNFTVFLGH-TF 524

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFD--EEIIKQEEDE 156
           + K     Y+ +PI +  + GYK+  K  T  +K  D DL + + I+D  EE  K ++ E
Sbjct: 525 DYKTFITGYIGLPIYVFSWVGYKLIYK--TKVVKPADADLYTLKEIYDREEEQGKLQDQE 582

Query: 157 YRGKL-RNG 164
              +L RNG
Sbjct: 583 KEERLQRNG 591

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 76/166 (45%), Gaps = 21/166 (12%)

Query: 1   MSYLYKSDARGDLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQS--KPTG 58
            S+L+   A  +++ S+  +      +S I+ +      CV+++RFR+A+          
Sbjct: 426 FSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDLYDRLP 485

Query: 59  ELGFKSQVGVWGSSY-AAIMTIC----ILIAQFWVVIAPIGDGKLETKNLFENYLAMPIL 113
             GF  +  +W S +  +++T+     I I +FW           + K+    Y+ +P+ 
Sbjct: 486 YKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFW-----------DYKDFIAAYITLPVF 534

Query: 114 LALYFGYKIYTKNW-TIFIKAKDIDLISHRNIFDEEIIKQEEDEYR 158
           + L+ G+K+ T++W   +I    ID+ +     +E  +  E DE R
Sbjct: 535 IVLWIGHKLVTRSWRQWYIPVDKIDVFTGLEEIEE--LTNELDEKR 578

>KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} similar
           to uniprot|P38090 Saccharomyces cerevisiae YBR132C AGP2
           Plasma membrane carnitine transporter expression is
           down-regulated by osmotic stress also functions as a
           low-affinity amino acid permease
          Length = 582

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 66/135 (48%), Gaps = 14/135 (10%)

Query: 12  DLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGS 71
            LN++S  +L  +I +   +   +  V+CV+++ FRRA H Q     EL FKS    WG 
Sbjct: 427 QLNKNSAVVLNWLINMITASQLINFAVLCVTYLYFRRAYHAQCGALPELPFKS----WGQ 482

Query: 72  SYAAI-----MTICILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKIYTKN 126
            Y A+     + I +L+  + V  + + D     +     YL + I +A+Y  +K   + 
Sbjct: 483 PYTALVGLVAVLIMVLVQGYAVFCSSLWD----VQEFLFCYLMIFIDIAIYVVHKFVVQR 538

Query: 127 WTIFIKA-KDIDLIS 140
              + +A K +DL++
Sbjct: 539 GRCWPRAPKAVDLVT 553

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 60/111 (54%), Gaps = 5/111 (4%)

Query: 27  VSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQF 86
           +  I+ +   F+I V+++RFR+A+ + ++    + ++S +  + + +  I+   I +   
Sbjct: 426 ICTISGFIGWFLIGVAYIRFRKAI-LFNRLLDRIPYRSPLQPFSAYFFTIVVAIITLTNG 484

Query: 87  WVVIAPIGDGKLETKNLFENYLAMPILLALYFGYK-IYTKNWTIFIKAKDI 136
           +VV      G+ + K+   +Y+++PI LA Y G+K IY   + I +   D+
Sbjct: 485 YVVFI---KGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDV 532

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 74/159 (46%), Gaps = 28/159 (17%)

Query: 13  LNRSSLA--LLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQS----KPTGELGFKSQV 66
           LN SS A  +   +  +S I+ +      C++++RFR+A+   +     P    G +  +
Sbjct: 439 LNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNLYDRMPFKTWG-QPYL 497

Query: 67  GVWGSSYAAIMTIC----ILIAQFWVVIAPIGDGKLETKNLFENYLAMPILLALYFGYKI 122
            +W  +  +I+TI       I +FW V            +    Y+ +PI LALY G+K+
Sbjct: 498 ILWSLTVVSIITITNGYQTFIPKFWNV-----------SDFIAAYITLPIFLALYVGHKV 546

Query: 123 YT--KNWTIFIK----AKDIDLISHRNIFDEEIIKQEED 155
           Y   KN    +K     +DID+I+  +  + +  + +E+
Sbjct: 547 YNHFKNDYPLMKLAYSVEDIDVITGLDEIETKTCELDEN 585

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 62/139 (44%), Gaps = 28/139 (20%)

Query: 1   MSYLYKSDARGDLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGEL 60
           +S+L    A  +++ S+  +      +S I+ +      C++++RFR+A+         L
Sbjct: 516 VSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRL 574

Query: 61  GFKSQVGVWGSSYA--------AIMTI----CILIAQFWVVIAPIGDGKLETKNLFENYL 108
            FK+    WG  Y         +I+TI     I I ++W V            +    Y+
Sbjct: 575 PFKT----WGQPYTVWFSLTVVSIITITNGYAIFIPKYWNV-----------ADFIAAYI 619

Query: 109 AMPILLALYFGYKIYTKNW 127
            +PI L L+ G+K+YT+ W
Sbjct: 620 TLPIFLVLWLGHKLYTRTW 638

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 11/146 (7%)

Query: 12  DLNRSSLALLVEVIYVSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGS 71
            LN +S  +L  +I +   +   +  V+C+ ++ FRR   +Q     +L F+S    WG 
Sbjct: 441 QLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRTYSIQQDSLPKLPFRS----WGQ 496

Query: 72  SYAAIMTICILIAQFWVVIAPIGDGKL-ETKNLFENYLAMPILLALYFGYKIYTKNWTIF 130
            Y AI+ +   +A   +    +   KL  +++   +YL + I + +Y GYK       I+
Sbjct: 497 PYTAIIGLVSCLAMIMIQGYTVFFPKLWNSQDFLFSYLMVFIDIGIYVGYKF------IW 550

Query: 131 IKAKDIDLISHRNIFDEEIIKQEEDE 156
            + KD     ++  F +E+I+ E  E
Sbjct: 551 KRGKDKVKDPYKIDFSKELIEIENHE 576

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 52/106 (49%), Gaps = 18/106 (16%)

Query: 27  VSIITPYPSRFVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQF 86
           +S I+ +      CV+++RFR+A+   +K T  + F+++    G  Y       I  + F
Sbjct: 479 ISTISGFIGWICACVAYIRFRKAI-TYNKLTHRIPFRAK----GQQYT------IWYSLF 527

Query: 87  WVVIAPIGDG-------KLETKNLFENYLAMPILLALYFGYKIYTK 125
           WV +  + +G           K+    Y+ +PI + L+ G+K++T+
Sbjct: 528 WVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKVFTR 573

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 60/118 (50%), Gaps = 7/118 (5%)

Query: 39  ICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDGKL 98
           I VSH+RF +A+  +     EL FK+++    + YA    + I++ Q +    P  +G  
Sbjct: 467 ISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNG-- 524

Query: 99  ETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156
              N    Y+++ + LA++  +++  +   ++ K +D+D+ S R   D E I  EE E
Sbjct: 525 --VNFLAAYISVFLFLAIWILFELIFRCRFVW-KIEDVDIDSDRR--DIEAIVWEEPE 577

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.141    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,136,755
Number of extensions: 744798
Number of successful extensions: 2921
Number of sequences better than 10.0: 335
Number of HSP's gapped: 2772
Number of HSP's successfully gapped: 335
Length of query: 170
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 68
Effective length of database: 41,785,467
Effective search space: 2841411756
Effective search space used: 2841411756
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)