Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F042001.83ON56656627530.0
NCAS0A006001.83ON54454318980.0
Suva_5.41.83ON59056518770.0
YEL063C (CAN1)1.83ON59056518660.0
Smik_5.241.83ON59056518650.0
NDAI0A006101.83ON56557018590.0
CAGL0J08184g1.83ON57256518470.0
Skud_5.261.83ON59056518390.0
Kpol_2000.651.83ON59555818050.0
KNAG0C007901.83ON57950818000.0
NCAS0B085701.83ON53252217850.0
TPHA0B044801.83ON60350817870.0
SAKL0C02684gsingletonON58856217820.0
SAKL0C02662g1.83ON54854617750.0
KAFR0D007001.83ON57457317650.0
KNAG0C05920singletonON59956217600.0
TDEL0C061801.83ON58356317580.0
Skud_14.701.83ON57357017500.0
YNL270C (ALP1)1.83ON57356917450.0
Smik_14.671.83ON57356917410.0
SAKL0C02640gsingletonON54854717150.0
Suva_14.731.83ON49747916910.0
TBLA0A054501.83ON60652116970.0
Kwal_33.134011.83ON55955516910.0
KLLA0C02343g1.83ON58151016830.0
Ecym_10881.84ON56757116700.0
Kpol_2000.641.84ON61056916690.0
Ecym_10871.83ON57056016650.0
KLTH0F02398g1.83ON55554016530.0
SAKL0C02728g1.84ON56253916540.0
ZYRO0F16654g1.83ON58057716530.0
TBLA0A054601.84ON60856216550.0
KLTH0F02420g1.84ON62153216460.0
CAGL0J08162g1.84ON59750816430.0
NDAI0F041901.84ON59957516380.0
Smik_14.681.84ON61157916320.0
KAFR0D039401.83ON59753016250.0
NCAS0A006101.84ON60757516240.0
TDEL0C061701.84ON57354516190.0
Kwal_33.134111.84ON56055916120.0
YNL268W (LYP1)1.84ON61155916120.0
Skud_14.711.84ON61251115940.0
Suva_14.751.84ON61151115930.0
TPHA0B044701.84ON59956215900.0
KLLA0C02365g1.84ON57955415800.0
KNAG0F004801.84ON59756715810.0
AFR667C1.84ON56355715450.0
AFR668W1.83ON55652015030.0
ZYRO0F16632g1.84ON60751514850.0
CAGL0A01199gna 1ON6135188461e-105
Kpol_358.3na 1ON5755388361e-104
KLLA0E16281gna 1ON6055508351e-103
Skud_16.12na 1ON6075128141e-100
KAFR0B06430singletonON5935268121e-100
Suva_16.40na 1ON6065388121e-100
Kwal_26.69407.44ON5705298024e-99
YPL265W (DIP5)na 1ON6084858045e-99
KNAG0L02470singletonON6385378041e-98
SAKL0G14916gna 1ON5815297982e-98
Smik_6.473na 1ON6064858002e-98
TPHA0M00130singletonON6115258002e-98
NCAS0D02260na 1ON5975507983e-98
Kwal_33.15545na 1ON5765367886e-97
TBLA0A07060na 1ON6254807891e-96
Ecym_80357.44ON5635267842e-96
NDAI0I02660na 1ON5945127862e-96
TDEL0A08030singletonON5145047713e-95
ZYRO0D17908gna 1ON5185037699e-95
SAKL0C01232gsingletonON6135477715e-94
KLTH0D01474g7.44ON6245777646e-93
TPHA0H028507.44ON6015197592e-92
KLTH0B01166gna 1ON5775317554e-92
Ecym_47895.158ON5885127556e-92
TDEL0H040707.44ON5775087547e-92
CAGL0E05632g7.44ON5984957559e-92
SAKL0G14014g5.158ON6055107506e-91
Ecym_2480na 1ON5864887461e-90
Kwal_27.126811.244ON5935547452e-90
TPHA0B010901.244ON6065487444e-90
AFR156W7.44ON5585557405e-90
NDAI0E038007.44ON6215387437e-90
SAKL0F09790gsingletonON5585537371e-89
TDEL0C00930singletonON5955607401e-89
SAKL0B10956g7.44ON5725317363e-89
ZYRO0D03762g1.244ON6005537332e-88
YOR348C (PUT4)7.44ON6275567316e-88
CAGL0K05753g1.50ON6605197311e-87
Suva_3.1891.50ON6335317282e-87
CAGL0B01012g1.50ON6235297253e-87
NCAS0B085801.50ON6275177238e-87
Smik_3.531.50ON6335387221e-86
KLTH0B02046g5.158ON5895347191e-86
TDEL0E05750singletonON5485197152e-86
YCL025C (AGP1)1.50ON6335187212e-86
KNAG0L02460singletonON5885007182e-86
NCAS0A004201.50ON6795227242e-86
NDAI0B052201.244ON6115507183e-86
TBLA0A051801.50ON6765137223e-86
Kwal_33.154075.158ON5874947163e-86
NDAI0A006401.50ON6415257203e-86
Suva_2.6881.50ON6615147206e-86
Kpol_367.77.44ON5845417146e-86
YDR508C (GNP1)1.50ON6635277197e-86
SAKL0C01650g1.50ON6135007158e-86
ACL135Wna 1ON5885117121e-85
Smik_4.7901.50ON6635107171e-85
Smik_15.5327.44ON6315337142e-85
KNAG0E003907.44ON5995207112e-85
KAFR0D00520na 2ON5985387103e-85
AFR698C1.50ON6094917114e-85
CAGL0L03267g1.244ON5974977104e-85
Skud_4.7841.50ON6635237144e-85
TDEL0C065101.50ON6425187125e-85
Kwal_23.4026singletonON5345087045e-85
KAFR0D00510na 3ON6174967105e-85
SAKL0D00836gna 4ON6014737096e-85
Suva_8.4027.44ON6835217137e-85
TBLA0C01240singletonON6295337062e-84
SAKL0D02970g3.284ON6015377042e-84
Skud_3.381.50ON6335367045e-84
Skud_15.5157.44ON6264977036e-84
KLTH0E15642g1.244ON5965507017e-84
KLLA0A11770g5.158ON5814866991e-83
KLTH0C05170g3.284ON5984747001e-83
KNAG0C02140singletonON5984726991e-83
Ecym_60211.244ON6004806982e-83
KAFR0D005001.50ON6174906974e-83
AFR230C1.244ON6044936964e-83
NDAI0D021605.158ON5875366937e-83
Kwal_33.14276na 4ON5964816921e-82
CAGL0H08393g3.284ON6125106931e-82
Smik_6.482na 5ON5585286892e-82
NCAS0A071105.158ON5925246912e-82
TPHA0E036601.50ON6475086942e-82
Suva_13.517singletonON5475246872e-82
KLLA0F27093gsingletonON5635086883e-82
Kpol_2000.921.50ON6375046933e-82
Suva_4.3073.284ON6095016913e-82
Ecym_10561.50ON6065386894e-82
KLTH0F01584g1.50ON5965136885e-82
Suva_2.2033.284ON6045256886e-82
SAKL0D04664g1.244ON5934966868e-82
Kpol_1010.325.158ON5995256851e-81
Kwal_26.9612singletonON5434896802e-81
YBR068C (BAP2)3.284ON6095186852e-81
Ecym_26643.285ON5754836822e-81
CAGL0B03773g5.158ON6055266834e-81
AGR039Cna 6ON5865046814e-81
TBLA0B077605.158ON6584846864e-81
KLTH0H13398g1.368ON5875166815e-81
KAFR0E018505.158ON5604816786e-81
AGR038C3.284ON5805126797e-81
Kpol_543.791.244ON6054786808e-81
SAKL0A09724gna 7ON5515076769e-81
YKR039W (GAP1)1.244ON6024956791e-80
TBLA0A05190na 2ON6674986813e-80
SAKL0D02948gna 6ON5945316753e-80
Kwal_33.132041.50ON6074916755e-80
KAFR0D04120na 2ON6485606785e-80
Suva_2.716singletonON6034956746e-80
NCAS0D018705.158ON5955086737e-80
Skud_16.2na 5ON4964926667e-80
Skud_11.2751.244ON6024956738e-80
NCAS0B079001.244ON6195396758e-80
ZYRO0F17446g1.50ON6334946741e-79
Smik_2.2013.284ON6095276721e-79
KNAG0H011503.284ON6175176731e-79
KAFR0A011203.284ON5925116712e-79
Smik_11.3021.244ON5534726672e-79
NCAS0A106803.284ON5935256702e-79
Skud_6.2na 8ON5585076682e-79
KAFR0C051607.44ON5845226692e-79
Smik_13.1singletonON5234686643e-79
Smik_2.2023.285ON6175396703e-79
Skud_2.1923.285ON6195516704e-79
KLLA0C01606g1.50ON6205416687e-79
NDAI0C029505.158ON6095016678e-79
NDAI0F043901.50ON6675196701e-78
KLTH0B00154gna 9ON5565076621e-78
Kwal_27.105383.284ON6025176651e-78
Suva_11.2731.244ON6014966642e-78
AGR319W5.158ON6265196662e-78
KLLA0A06930g1.244ON5874796623e-78
KNAG0F002701.50ON6344926653e-78
AGR040C3.285ON5734826603e-78
YFL055W (AGP3)na 8ON5585106585e-78
KAFR0D041401.50ON6375226635e-78
Skud_2.1913.284ON6094966616e-78
KLTH0A00308gsingletonON5415116566e-78
NCAS0E022607.44ON5935216606e-78
KAFR0C004003.284ON5825356596e-78
KLLA0A06886gsingletonON5874956597e-78
TPHA0A047005.158ON5695066579e-78
TDEL0F02830na 10ON5614986561e-77
SAKL0D02926g3.285ON5834976571e-77
Ecym_26623.284ON5894886571e-77
Sklu_YGOB_Anc_1.3681.368ON5414746541e-77
Ecym_2663na 6ON5894966572e-77
YGR191W (HIP1)5.158ON6035106563e-77
Kpol_2002.441.50ON6275056564e-77
NDAI0A074903.284ON5964996544e-77
NDAI0G060301.368ON5994406537e-77
TPHA0A002405.158ON6034846521e-76
Skud_7.5255.158ON6034856521e-76
KLLA0A10813g1.368ON5845256502e-76
YDR046C (BAP3)3.284ON6045236502e-76
Smik_16.1155.158ON6034666477e-76
ZYRO0A00308gsingletonON5644736447e-76
TBLA0G031203.284ON6735226517e-76
KNAG0J022003.284ON6075006451e-75
KLLA0F23419g7.44ON5735186421e-75
SAKL0C13992gsingletonON5524676402e-75
AEL030W1.368ON5824756422e-75
CAGL0M00154gsingletonON5505276402e-75
Kwal_34.16254singletonOFF4814886342e-75
Kwal_YGOB_34.162541.368ON4914886343e-75
Smik_4.2843.284ON6045236423e-75
Suva_7.4855.158ON6035106414e-75
ZYRO0G07172gna 10ON5675006385e-75
Kpol_543.78singletonON6055676406e-75
NCAS0J00140na 8ON5585076377e-75
KNAG0G009005.158ON6135006408e-75
Skud_4.3003.284ON6045276399e-75
Kwal_8.590na 9ON6295366401e-74
NDAI0A056203.284ON5715356351e-74
KNAG0C005901.50ON6345486391e-74
NCAS0A089201.368ON5994786372e-74
Suva_4.3083.285ON6185226382e-74
TPHA0B047501.50ON6395086374e-74
NDAI0A01340singletonON5545086305e-74
KLTH0F01606gna 2ON6044866321e-73
CAGL0D02178g1.368ON5775276272e-73
Ecym_27161.368ON5925286283e-73
KNAG0J022103.285ON5814906273e-73
KNAG0L00110na 8ON5714686263e-73
ADL272Wna 11ON5644966254e-73
KAFR0D04130na 3ON6445106261e-72
KLLA0B14685gna 12ON5715136202e-72
TBLA0I020103.285ON6284536224e-72
KLTH0D07128gna 7ON5434946164e-72
CAGL0L07546g3.284ON6345496225e-72
SAKL0F16544gsingletonON5675116169e-72
TBLA0C012101.368ON6004826189e-72
NCAS0I015303.284ON5954826171e-71
YBR069C (TAT1)3.285ON6195436191e-71
Kpol_1065.133.284ON5965366143e-71
YOL020W (TAT2)1.368ON5924806134e-71
Ecym_8297na 11ON5695106114e-71
ZYRO0C18502g7.44ON5755116107e-71
TPHA0M012003.284ON6074746128e-71
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F04200
         (566 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}           1065   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   735   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   727   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   723   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   723   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   720   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   716   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   712   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   699   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              697   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            692   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   692   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   691   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   688   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   684   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            682   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   681   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   678   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   676   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   675   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   665   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   655   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   658   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   655   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   652   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   647   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   647   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   645   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   641   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   641   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   641   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   642   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   638   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   637   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   635   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   633   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   630   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              630   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   628   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   625   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   625   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   618   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   618   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   617   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   613   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                613   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   599   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   583   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   576   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   330   e-105
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   326   e-104
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   326   e-103
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   318   e-100
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   317   e-100
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   317   e-100
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   313   4e-99
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   314   5e-99
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             314   1e-98
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   311   2e-98
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   312   2e-98
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     312   2e-98
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              311   3e-98
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   308   6e-97
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   308   1e-96
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   306   2e-96
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   307   2e-96
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            301   3e-95
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   300   9e-95
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   301   5e-94
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   298   6e-93
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   296   2e-92
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   295   4e-92
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   295   6e-92
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   295   7e-92
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   295   9e-92
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   293   6e-91
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   291   1e-90
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   291   2e-90
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   291   4e-90
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   289   5e-90
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     290   7e-90
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   288   1e-89
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   289   1e-89
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   288   3e-89
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   286   2e-88
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   286   6e-88
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   286   1e-87
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   285   2e-87
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   283   3e-87
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   283   8e-87
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   282   1e-86
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   281   1e-86
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            280   2e-86
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   282   2e-86
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             281   2e-86
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   283   2e-86
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   281   3e-86
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   282   3e-86
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   280   3e-86
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   281   3e-86
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   281   6e-86
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   279   6e-86
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   281   7e-86
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   280   8e-86
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   278   1e-85
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   280   1e-85
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   279   2e-85
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   278   2e-85
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   278   3e-85
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   278   4e-85
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   278   4e-85
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   279   4e-85
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   278   5e-85
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   275   5e-85
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      278   5e-85
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   277   6e-85
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   279   7e-85
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   276   2e-84
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   275   2e-84
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   275   5e-84
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   275   6e-84
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   274   7e-84
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   273   1e-83
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   274   1e-83
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   273   1e-83
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   273   2e-83
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      273   4e-83
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   272   4e-83
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    271   7e-83
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   271   1e-82
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   271   1e-82
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   270   2e-82
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   270   2e-82
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   271   2e-82
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   269   2e-82
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   269   3e-82
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   271   3e-82
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   270   3e-82
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   270   4e-82
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   269   5e-82
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   269   6e-82
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   268   8e-82
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   268   1e-81
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   266   2e-81
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   268   2e-81
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   267   2e-81
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   267   4e-81
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   266   4e-81
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   268   4e-81
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   266   5e-81
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   265   6e-81
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   266   7e-81
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   266   8e-81
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   265   9e-81
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   266   1e-80
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   266   3e-80
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   264   3e-80
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   264   5e-80
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   265   5e-80
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   264   6e-80
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   263   7e-80
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   261   7e-80
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   263   8e-80
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   264   8e-80
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   264   1e-79
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   263   1e-79
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              263   1e-79
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   263   2e-79
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   261   2e-79
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   262   2e-79
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      261   2e-79
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   262   2e-79
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    260   3e-79
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   262   3e-79
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   262   4e-79
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   261   7e-79
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    261   8e-79
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   262   1e-78
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   259   1e-78
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   260   1e-78
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   260   2e-78
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   261   2e-78
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   259   3e-78
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   260   3e-78
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   258   3e-78
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   258   5e-78
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              259   5e-78
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   259   6e-78
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   257   6e-78
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     258   6e-78
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                258   6e-78
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   258   7e-78
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   257   9e-78
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   257   1e-77
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   257   1e-77
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   257   1e-77
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   256   1e-77
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   257   2e-77
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   257   3e-77
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   257   4e-77
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   256   4e-77
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   256   7e-77
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   255   1e-76
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   255   1e-76
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   254   2e-76
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   254   2e-76
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   253   7e-76
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   252   7e-76
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              255   7e-76
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   253   1e-75
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   251   1e-75
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   251   2e-75
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   251   2e-75
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   251   2e-75
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   248   2e-75
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   248   3e-75
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   251   3e-75
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   251   4e-75
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   250   5e-75
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   251   6e-75
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      249   7e-75
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   251   8e-75
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   250   9e-75
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   251   1e-74
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            249   1e-74
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   250   1e-74
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   249   2e-74
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   250   2e-74
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   249   4e-74
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              247   5e-74
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   248   1e-73
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   246   2e-73
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   246   3e-73
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   246   3e-73
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   245   3e-73
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   245   4e-73
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              245   1e-72
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   243   2e-72
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   244   4e-72
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   241   4e-72
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   244   5e-72
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   241   9e-72
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   242   9e-72
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              242   1e-71
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   243   1e-71
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   241   3e-71
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   240   4e-71
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   239   4e-71
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   239   7e-71
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   240   8e-71
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   239   1e-70
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   237   2e-70
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   237   7e-70
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   237   8e-70
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   236   1e-69
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   236   2e-69
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   234   7e-69
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   234   7e-69
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              232   2e-68
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   232   4e-68
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   231   2e-67
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              230   5e-67
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   230   6e-67
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   229   3e-66
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   226   1e-65
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   225   2e-65
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   224   4e-65
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   224   4e-65
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                223   1e-64
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   223   2e-64
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   221   7e-64
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   220   1e-63
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              220   1e-63
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   219   3e-63
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   219   3e-63
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   218   5e-63
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    216   2e-62
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   216   6e-62
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                216   6e-62
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              216   1e-61
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   214   1e-61
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   214   2e-61
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      211   3e-60
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   211   3e-60
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   210   4e-60
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   210   4e-60
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   210   5e-60
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   210   8e-60
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   207   1e-59
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   208   4e-59
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   206   2e-58
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   206   2e-58
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   204   1e-57
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   204   2e-57
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   203   2e-57
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   203   3e-57
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                203   3e-57
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   201   1e-56
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   201   2e-56
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   200   3e-56
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   204   5e-56
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   199   5e-56
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   199   8e-56
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   199   9e-56
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   199   1e-55
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   199   1e-55
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   197   2e-55
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   198   2e-55
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   197   4e-55
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   197   6e-55
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   196   2e-53
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   191   7e-53
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   193   2e-52
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   192   4e-52
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   186   4e-51
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   189   4e-51
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   185   1e-50
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   188   1e-50
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   183   3e-50
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   183   3e-50
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   182   5e-50
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   185   2e-49
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   185   2e-49
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   184   2e-49
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   182   1e-48
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   181   5e-48
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   180   7e-48
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   178   4e-47
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   176   3e-46
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   174   8e-46
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   171   7e-45
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     163   9e-45
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     162   2e-44
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   169   5e-44
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   169   6e-44
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   166   3e-43
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   162   1e-41
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         134   3e-34
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   127   1e-32
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    87   2e-19
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          85   2e-18
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      87   3e-18
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     87   7e-18
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          84   1e-17
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      77   1e-16
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    60   1e-09
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      47   1e-05
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    48   4e-05
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    40   0.012
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              37   0.059
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    36   0.35 
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    32   4.5  
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    31   9.0  

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score = 1065 bits (2753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/566 (94%), Positives = 533/566 (94%)

Query: 1   MSILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEV 60
           MSILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEV
Sbjct: 1   MSILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEV 60

Query: 61  KRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA 120
           KRDLSKRH                   NPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA
Sbjct: 61  KRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA 120

Query: 121 TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAW 180
           TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAW
Sbjct: 121 TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAW 180

Query: 181 ISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWR 240
           ISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWR
Sbjct: 181 ISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWR 240

Query: 241 NPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKV 300
           NPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKV
Sbjct: 241 NPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKV 300

Query: 301 VFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILV 360
           VFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILV
Sbjct: 301 VFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILV 360

Query: 361 TIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTG 420
           TIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTG
Sbjct: 361 TIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTG 420

Query: 421 GDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATI 480
           GDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATI
Sbjct: 421 GDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATI 480

Query: 481 VMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXX 540
           VMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLV       
Sbjct: 481 VMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDIDKD 540

Query: 541 XXXXXXXVWQDTTPANLWGKFWDFVA 566
                  VWQDTTPANLWGKFWDFVA
Sbjct: 541 RREIEDRVWQDTTPANLWGKFWDFVA 566

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/543 (69%), Positives = 431/543 (79%), Gaps = 8/543 (1%)

Query: 27  EQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXX 86
           + H  Q + + +TPTT  + ++  E ++D    VKR+L KRH                  
Sbjct: 7   QVHSFQVDSN-DTPTTISTLDDDQEKQQD----VKRELKKRHISMIALGGTIGTGLFLGI 61

Query: 87  XNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANG 146
             PL+I+GP+G+LIAYLF+GTVV+SVTQSLGEM TFIPVTASFT+F+ RFLSPA GAANG
Sbjct: 62  ARPLIIAGPIGALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANG 121

Query: 147 YMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWI 206
           YMYWFSWAMTFALELSVVGQIIQFWT AVPL AWISI WV+LTISNLFPVRIYGEIEFWI
Sbjct: 122 YMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWI 181

Query: 207 AFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSL 266
           A +KV AILGFIIY  CI+CGAG TGPVGFRYW+NPGPWG GIISSN+ EARF GW SSL
Sbjct: 182 ASVKVLAILGFIIYGICIICGAGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSL 241

Query: 267 INAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL 326
           INAAFTFQGTELVGITAGE   PR+TVPKAI+KVVFRILVFYI SL  IGLLVPY+D KL
Sbjct: 242 INAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL 301

Query: 327 KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTG 386
           +S +SYVSSSPFII I+N+GTKILPHIFN VIL+TIISAGNSNVYIGSR+L+GLAKN   
Sbjct: 302 QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAA 361

Query: 387 PKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFA 446
           PK F  T+K+GVP   V+FTS+FG+LA+MET+TGGD+AF WLLN+VGVAGFF+WLLIS +
Sbjct: 362 PKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCS 421

Query: 447 HIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFAS 506
           HIRFM+ L+ RGISRNDLP+KA  MP+LAYYA   M+III  QGFT+FAPKF V NFFA+
Sbjct: 422 HIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAA 481

Query: 507 YISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXVWQDTTP---ANLWGKFWD 563
           YISVFLF IFW +FQ+WFKCR VWKL               VW D       N W +FW+
Sbjct: 482 YISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWN 541

Query: 564 FVA 566
           +VA
Sbjct: 542 YVA 544

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/565 (63%), Positives = 428/565 (75%), Gaps = 3/565 (0%)

Query: 5   DINTEETLEGKSKIVIKSTESLEQHDLQGNEDK-NTPTTTPSKENVSENEKDEYH--EVK 61
           D+   +T   +  + +K  +S E + L+   +  N   T   +E++ + ++ E    EVK
Sbjct: 26  DVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVK 85

Query: 62  RDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT 121
           R+L +RH                    PL  +GPVG+LI+YLF+G++ YSVTQSLGEMAT
Sbjct: 86  RELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT 145

Query: 122 FIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWI 181
           FIPVT+SFT+FS RFLSPA GAANGYMYWFSWA+TFALELSVVGQ+IQFWT+AVPL AWI
Sbjct: 146 FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWI 205

Query: 182 SIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRN 241
           SIFWVI+T  N+FPV+ YGE EFW+A +KV AI+GF+IYCFC+VCGAG TGPVGFRYWRN
Sbjct: 206 SIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRN 265

Query: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVV 301
           PG WG GIIS N  EARFLGW SSLINAAFTFQGTELVGITAGEAANPR+TVP+AI+KVV
Sbjct: 266 PGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVV 325

Query: 302 FRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVT 361
           FRIL FYI SL FIGLLVPY+D KL S  SYVS+SPFIIAIENSGTK+LPHIFN VIL T
Sbjct: 326 FRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTT 385

Query: 362 IISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGG 421
           IISA NSN+Y+GSR+LFGL+K+   PK F+KTTK GVP  AV  TS+FGALA+METSTGG
Sbjct: 386 IISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGG 445

Query: 422 DEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIV 481
            + F WLLN+ GVAGFF+WL IS +HIRFMQ L+ RGISR++LPFKAK MP LAYYAT  
Sbjct: 446 GKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFF 505

Query: 482 MIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXX 541
           M++II  QGFT+F P F+ +NF A+YISVFLF   W  F+L F+CR+VWK+         
Sbjct: 506 MVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDR 565

Query: 542 XXXXXXVWQDTTPANLWGKFWDFVA 566
                 VW++  P  LW KFW+ V 
Sbjct: 566 RDIEAIVWEEPEPKTLWDKFWNVVG 590

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/565 (62%), Positives = 424/565 (75%), Gaps = 3/565 (0%)

Query: 5   DINTEETLEGKSKIVIKSTESLEQHDLQGNEDK-NTPTTTPSKENVSENEKDEYH--EVK 61
           D+   +T   +  I +K  +S E + L+    + N   T   ++ + + ++ E    EVK
Sbjct: 26  DVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMEDGIGDEDEGEVQNAEVK 85

Query: 62  RDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT 121
           R+L +RH                    PL  +GPVG+LI+YLF+G++ YSVTQSLGEMAT
Sbjct: 86  RELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT 145

Query: 122 FIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWI 181
           FIPVT+SFT+FS RFLSPA GAANGYMYWFSWA+TFALELSVVGQ+IQFWT+ VPL AWI
Sbjct: 146 FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWI 205

Query: 182 SIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRN 241
           SIFWVI+TI NLFPV+ YGE EFW+A +KV AI+GF+IYCFC+VCGAG TGPVGFRYWRN
Sbjct: 206 SIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRYWRN 265

Query: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVV 301
           PG WG GIIS +  E RFLGW SSLINAAFTFQGTELVGITAGEAANPR++VP+AI+KVV
Sbjct: 266 PGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVV 325

Query: 302 FRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVT 361
           FRIL FYI SL FIGLLVPY+D KL    SYVS+SPFIIAIENSGTK+LPHIFN VIL T
Sbjct: 326 FRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTT 385

Query: 362 IISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGG 421
           IISA NSN+Y+GSR+LFGL+KN   PK  ++TTK GVP  AV  T+ FGALA+METSTGG
Sbjct: 386 IISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGG 445

Query: 422 DEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIV 481
           D+ F+WLLN+ GVAGFF+WL IS +HIRFMQ L+ RGISR++LPFKAK MP LAYYA   
Sbjct: 446 DKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATF 505

Query: 482 MIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXX 541
           M III  QGFTAFAPKF+ ++F A+YIS+FLF   W  FQ  F+CR++WK+         
Sbjct: 506 MTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDR 565

Query: 542 XXXXXXVWQDTTPANLWGKFWDFVA 566
                 VW+D  P   W KFW+ VA
Sbjct: 566 RDIEAIVWEDHEPKTFWDKFWNVVA 590

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/565 (62%), Positives = 423/565 (74%), Gaps = 3/565 (0%)

Query: 5   DINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKD---EYHEVK 61
           D+   +T   +  + +K  ++ E + L     +     T S  +V  +E        EVK
Sbjct: 26  DVEASQTHRRRGSLPLKDEKNKELYPLHSFSTRVDGEDTFSMGDVIRDEDQGEVRNAEVK 85

Query: 62  RDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT 121
           R+L +RH                    PL  +GPVG+LI+YLF+G++ YSVTQSLGEMAT
Sbjct: 86  RELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSLGEMAT 145

Query: 122 FIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWI 181
           FIPVT+SFT+FS RFLSPA GAANGYMYWFSWA+TFALELSVVGQ+I+FWT  VPL AWI
Sbjct: 146 FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNKVPLAAWI 205

Query: 182 SIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRN 241
           SIFWVI+TI NLFPV+ YGE EFW+A +KV AI+GF+IYCFC+VCGAG TGPVGFRYWRN
Sbjct: 206 SIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRYWRN 265

Query: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVV 301
           PG WG GIIS +  E RFLGW SSLINAAFTFQGTELVGITAGEAANPR+TVP+AI+KVV
Sbjct: 266 PGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVV 325

Query: 302 FRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVT 361
           FRIL FYI SL FIGLLVPY+D KL +  SYVS SPFIIAIENSGTK+LPHIFN VIL T
Sbjct: 326 FRILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVSPFIIAIENSGTKVLPHIFNAVILTT 385

Query: 362 IISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGG 421
           IISA NSN+Y+GSR+LFGL+KN   PK  ++TTK GVP  AV  T++FGALA+METSTGG
Sbjct: 386 IISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALAYMETSTGG 445

Query: 422 DEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIV 481
           D+ F+WLLN+ GVAGFF+WLLIS +HIRFMQ L+ RGISR++LPFKAK MP LAY+A   
Sbjct: 446 DKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPGLAYFAATF 505

Query: 482 MIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXX 541
           MIIII  QGFTAFAPKFD ++F A+YIS+FLF   W  F++ F+CR++WK+         
Sbjct: 506 MIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFIWKIEDVDIDSDR 565

Query: 542 XXXXXXVWQDTTPANLWGKFWDFVA 566
                 VW+D  P   W KFW+ VA
Sbjct: 566 RDIEAIVWEDHEPKTFWDKFWNVVA 590

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/570 (62%), Positives = 428/570 (75%), Gaps = 12/570 (2%)

Query: 4   LDINTEETLE-GKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKD------E 56
           +D   EE L+ GK K     + S E  D   +   N+  + PS+  +   E++       
Sbjct: 1   MDKKQEEPLKNGKIK-----SSSYELDDYPLHRRTNSVHSIPSQITIESQEEEIANGQIR 55

Query: 57  YHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSL 116
             EVKR+L +RH                    PL  +GPVG+LIAYLF+GT+VYSVTQSL
Sbjct: 56  EAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSL 115

Query: 117 GEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVP 176
           GEMATFIPVT+SFT+FS RFLSP+ GAANGYMYWFSWA+TFALELSVVGQIIQFWT AVP
Sbjct: 116 GEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVP 175

Query: 177 LPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF 236
           + AWISIFWV+L   N+FPVR YGE EFW+A +KV AI+GF+IYC C+VCGAG TGPVGF
Sbjct: 176 IVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGF 235

Query: 237 RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKA 296
           RYWRNPGP G GII+ N+ EA+FLGW SSLINAAFT+QGTELVGITAGEAANPR++VP+A
Sbjct: 236 RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 295

Query: 297 IRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNG 356
           I+KVVFRIL FYI SLFFIGLLVPY+D KL S++SYV++SPFII+I+NSGT ILPHIFN 
Sbjct: 296 IKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNA 355

Query: 357 VILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFME 416
           VIL TIISA NSNVY+GSR++FGL+K+   P++ ++T K+GVP  +V+FT LFGALA+ME
Sbjct: 356 VILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYME 415

Query: 417 TSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAY 476
           TSTGG+ AF WLLN+ GVAGFFSWL IS +H+RFMQ L+ RGISR+DLPFKAKFMP LAY
Sbjct: 416 TSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAY 475

Query: 477 YATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXX 536
           YA   M +II  QGFT+F P FD ++F A+YIS FLF   W  FQLWF+CR +WK+    
Sbjct: 476 YAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVD 535

Query: 537 XXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                      VW+D  P   W KFW+ VA
Sbjct: 536 IDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/565 (62%), Positives = 426/565 (75%), Gaps = 14/565 (2%)

Query: 15  KSKIVIKSTESL------EQHDLQ----GNEDKNTPTTTPSKENVSENEKDE---YHEVK 61
           K K VI+  +++      + H+      G   + T  ++   E+++  EKDE   +H+VK
Sbjct: 9   KEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLA-TEKDELLEHHDVK 67

Query: 62  RDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT 121
           R L +RH                    PL  +GPVG+L+AYLF+GTVV+SVTQSLGEMAT
Sbjct: 68  RSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMAT 127

Query: 122 FIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWI 181
           FIPVT+SF++F+ RFLSPALGAANGYMY+ SW  TFALELSVVGQIIQFWTF VPL AWI
Sbjct: 128 FIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWI 187

Query: 182 SIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRN 241
           SIFWV+LT  N+FPV+ YGE EFWIA +KV A++GF+IY  CIVCGAGKTGP+GFRYWRN
Sbjct: 188 SIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRYWRN 247

Query: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVV 301
           PG  G GIISSN  EARFLGW SSLINAAFT+QGTELVGITAGEAANPR+ VP+AIRKV+
Sbjct: 248 PGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVL 307

Query: 302 FRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVT 361
            RIL+FYI SLFFIGL VPY+D KL S +SYVSSSPFII I+N+GT++LPHIFN VIL T
Sbjct: 308 IRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTT 367

Query: 362 IISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGG 421
           IISAGNSNVY+GSR+LF +AKNG  PK  AKTT  GVP  +V+  S FG+L++ME STGG
Sbjct: 368 IISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGG 427

Query: 422 DEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIV 481
            +AF WLLN+ GVAGFF+WLLIS +H+RFMQ L+ RGISR+DLP+KA +MP+LAYYA   
Sbjct: 428 AKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFF 487

Query: 482 MIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXX 541
           M++II  QGFT+FAP F   +F A+YISV LF +FWG FQ++F+CR +WKL         
Sbjct: 488 MVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDR 547

Query: 542 XXXXXXVWQDTTPANLWGKFWDFVA 566
                 VW+D  P  LW KFWDFVA
Sbjct: 548 REIESVVWEDDAPKTLWDKFWDFVA 572

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/565 (62%), Positives = 425/565 (75%), Gaps = 3/565 (0%)

Query: 5   DINTEETLEGKSKIVIKSTESLEQHDLQG-NEDKNTPTTTPSKENVSENEKDEYH--EVK 61
           D+   +T   +  + +K  +S E + L+      N   T   +EN+ + ++ E    EVK
Sbjct: 26  DVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVK 85

Query: 62  RDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT 121
           R+L +RH                    PL  +GPVG+LIAYLF+G++ +SVTQSLGEMAT
Sbjct: 86  RELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVTQSLGEMAT 145

Query: 122 FIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWI 181
           FIPVT+SFT+FS RFLSPA GAANGYMYWFSWA+TFALELSVVGQ+IQFWT  VPL AWI
Sbjct: 146 FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWI 205

Query: 182 SIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRN 241
           SIFWV++TI NLFPV+ YGE EFW+A +KV AI+GF+IYCFC+VCGAG TGPVGFRYWRN
Sbjct: 206 SIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRN 265

Query: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVV 301
           PG WG GIIS N  E RFLGW SSLINAAFTFQGTELVGITAGEAANPR+TVP+AI+KVV
Sbjct: 266 PGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVV 325

Query: 302 FRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVT 361
           FRIL FYI SL FIGLLVPY+D KL    SYVS+SPFI+AI+NSGTK+LPHIFN VIL T
Sbjct: 326 FRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTT 385

Query: 362 IISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGG 421
           IISA NSN+Y+GSR+LFGL+KN   PK  ++T+K GVP  AV  T++FGALA+METSTGG
Sbjct: 386 IISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGG 445

Query: 422 DEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIV 481
           D+ F+WLLN+ GVAGFF+WL IS +HIRFMQ L+ RGISR++LPFKAK MP LAYY++  
Sbjct: 446 DKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFF 505

Query: 482 MIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXX 541
           MIIII  QGFTAFAPKF+  +F A+YIS+FLF   W  F+  F+CR++WK+         
Sbjct: 506 MIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDR 565

Query: 542 XXXXXXVWQDTTPANLWGKFWDFVA 566
                 VW+D  P   W KFW+ VA
Sbjct: 566 RDIEAIVWEDHEPKTFWDKFWNVVA 590

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/558 (64%), Positives = 424/558 (75%), Gaps = 15/558 (2%)

Query: 14  GKSKIVIKSTE-----SLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRH 68
           G S IV+  +      S   H + G+ED          E   +    +  EVKR+L +RH
Sbjct: 48  GSSSIVVDGSSRHLHGSHGSHSVSGDED----------EPYVDQGVVQDAEVKRELKQRH 97

Query: 69  XXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTAS 128
                               PL  +GPVGSLIAYLF+ T+V+SVTQSLGEMATFIPVT+S
Sbjct: 98  IGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSS 157

Query: 129 FTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVIL 188
           FT+FS RF+SP++GAANGYMYWFSWA+TFALELSVVGQIIQFWT AVPL AWI I+W IL
Sbjct: 158 FTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFIL 217

Query: 189 TISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTG 248
           TI N+FPV+ YGE EFW+A +KV AI+GF+IYC C+VCGAG TGPVGFRYWRNPGPWG G
Sbjct: 218 TIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPG 277

Query: 249 IISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFY 308
           IISS +AE RFLGW SSLINAAFT+QGTELVGITAGEAANPR+TVP+AI+KV FRIL+FY
Sbjct: 278 IISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFY 337

Query: 309 ILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNS 368
           ILSLFFIGLLVP+DD KL S++SYVSSSPFIIAI+NSGTK+LPHIFN VIL TIISAGNS
Sbjct: 338 ILSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNS 397

Query: 369 NVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWL 428
           N+Y+GSR++FGLAK    P+ F  TTK GVP  AV+FTS FGALAF+E S+GG +AF WL
Sbjct: 398 NIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWL 457

Query: 429 LNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFF 488
           LN+VGVAGFF+WLLIS AH+RF+Q L+ RGISR+DLPFKA  MP+LAYYA   MIIII  
Sbjct: 458 LNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIII 517

Query: 489 QGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXV 548
           QGFTAFAP F+  +F A+YISVFLFF  W SFQL+F+C+  W L               +
Sbjct: 518 QGFTAFAPTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAII 577

Query: 549 WQDTTPANLWGKFWDFVA 566
           W+D+ P   W +FWD VA
Sbjct: 578 WEDSAPKTFWDRFWDVVA 595

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/508 (65%), Positives = 402/508 (79%)

Query: 59  EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118
           EVKR+L +RH                    PL  +GPVG+LI+Y+F+GT+VYSVTQSLGE
Sbjct: 72  EVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSLGE 131

Query: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178
           MATFIPVT+SFT+F+ RFLSP++GAA GYMYWFSWA+TFALELSV+GQ+IQ+WT+AVPL 
Sbjct: 132 MATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAVPLA 191

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRY 238
           AWISIFWV++T  N+FPV+ YGE+EFWIAF+KV AI+GF++YC C+VCGAG TGPVGFRY
Sbjct: 192 AWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGPVGFRY 251

Query: 239 WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIR 298
           WRNPGPWG GIIS +  EARFLGW SSLIN AFT+QGTELVGI+AGEAANPR+ VP+AI+
Sbjct: 252 WRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPRAIK 311

Query: 299 KVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVI 358
           KVVFRIL FYI SLFFIGLLVPY+D  L + +SYV+SSPFIIAI+NSGT +LPHIFN VI
Sbjct: 312 KVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLPHIFNAVI 371

Query: 359 LVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETS 418
             TI+SAGNSNVY+GSR+LFGL+KN   PK+ ++TTK GVP  AV+ TS+ GALA+METS
Sbjct: 372 ACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAYMETS 431

Query: 419 TGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYA 478
           TGG  AF WLLN+  VAGFF+WL IS +HIRFMQ L+ RGISR+DLPFKA  MP LAYYA
Sbjct: 432 TGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGLAYYA 491

Query: 479 TIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXX 538
           + +M +II  QGFTAFAPKF   +F A+YIS+FLF   W  FQ+ F+CR++ K+      
Sbjct: 492 SFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVEDVDID 551

Query: 539 XXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                    VW+D  P  +W KFW+ +A
Sbjct: 552 TDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/522 (64%), Positives = 406/522 (77%), Gaps = 2/522 (0%)

Query: 46  KENVSENEKD-EYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLF 104
           KE + E   + E   V+R+L +RH                    PLM +GPVG+LIAYLF
Sbjct: 12  KEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLF 71

Query: 105 LGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVV 164
           + T+ YSVTQSLGEMATFIPVT+SFT+FS RF+SPA GAANGYMYWFSW +TFALELSVV
Sbjct: 72  MATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVV 131

Query: 165 GQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI 224
           GQ+IQFWTFAVPL AWISIFWV+LT  N+FPV+ YGE EFW+A +KV AI+GF+IYCFC+
Sbjct: 132 GQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM 191

Query: 225 VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAG 284
           VCGAG TGPVGFRYWR+PG +G GII+ +  +ARFLGW SSLINAAFTFQGTELVGITAG
Sbjct: 192 VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251

Query: 285 EAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIEN 344
           EAANPR+TVP+AI+KVVFRIL FYILSLFFIGLLVPYDD KL S +SYVS+SPFIIAIEN
Sbjct: 252 EAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVSASPFIIAIEN 311

Query: 345 SGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVV 404
           SGT +LPHIFN VI+ TIISAGNSN+Y+GSR+++GL+ +   P + ++TT+ GVP  AV+
Sbjct: 312 SGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVL 371

Query: 405 FTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDL 464
            TSLFGALA+METSTGG +AF WLLN+ GVAGFF+WL IS +HIRFMQ L+ RGISR+DL
Sbjct: 372 VTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDL 431

Query: 465 PFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWF 524
           PFKAK+MP LAYY    M +II  QGFT+F P ++ ++F  +YISVF+F   W +FQ WF
Sbjct: 432 PFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWF 490

Query: 525 KCRYVWKLVXXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
           +CR +W++               VW +  P   W KFW+ VA
Sbjct: 491 RCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/508 (68%), Positives = 405/508 (79%)

Query: 59  EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118
           EVKR L +RH                    PL  +GPVG+LIAYLF+ T+V+SVTQSLGE
Sbjct: 96  EVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQSLGE 155

Query: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178
           MATFIPVT+SFT+FS RFLSPA+GAANGYMYWFSWA+TFALELSVVGQIIQFWT AVPL 
Sbjct: 156 MATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAVPLS 215

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRY 238
           AWI I+WVILTI NLFPV+ YGE EFW+A +KV AI+GF+IYC C+VCGAG TGPVGFRY
Sbjct: 216 AWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGPVGFRY 275

Query: 239 WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIR 298
           WRNPGPWG GIIS ++ E RFLGW SSLINAAFT+QGTELVGITAGEAANPR+TVP+AI+
Sbjct: 276 WRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 335

Query: 299 KVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVI 358
           KV FRIL+FYILSLFFIGLLVPYDD KL S +SY+S+SPFIIAIENSGTKILPHIFN VI
Sbjct: 336 KVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSGTKILPHIFNAVI 395

Query: 359 LVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETS 418
           L TIISAGNSNVY+GSR+LFGLAK    PK F  T++ GVP ++V FTS FGALAF+E S
Sbjct: 396 LSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALAFLEVS 455

Query: 419 TGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYA 478
           +GG +AF WLLN++ VAGFF+WLLIS AH+RFMQ L+ RGISR+DLPFKA+FMP+LAYY+
Sbjct: 456 SGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMPHLAYYS 515

Query: 479 TIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXX 538
              M III  QGFTAFAP F+  +F A+YIS+FLFF  W  FQL+F+ + +W +      
Sbjct: 516 IFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTVEEVDID 575

Query: 539 XXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                    +W+D+ P   W KFWD VA
Sbjct: 576 TDRRDVDAIIWEDSGPKTFWDKFWDVVA 603

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/562 (61%), Positives = 415/562 (73%), Gaps = 7/562 (1%)

Query: 9   EETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYH----EVKRDL 64
           E +   +     K T+S ++     ++     T +P   NVS +  DE +    EVKR L
Sbjct: 30  ESSTASEEPFGCKDTKSTDEKTRVVSQVSPMRTGSP---NVSIDYMDEGNVQDAEVKRAL 86

Query: 65  SKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP 124
             RH                   +PL  +GPVG+LIAY+F+GT+ Y VTQSLGEMATFIP
Sbjct: 87  KPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMATFIP 146

Query: 125 VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIF 184
           VT+SFT+F+ RFLSPA G ANGY+YWFSW +TFALELSVVGQIIQFWTFAVPL AWI+IF
Sbjct: 147 VTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFAVPLGAWIAIF 206

Query: 185 WVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGP 244
           WVILT SNLFPV+ YGE+EFWIA +KV AI+GFIIY F +VCGAGKTGPVGFRYWRNPGP
Sbjct: 207 WVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGP 266

Query: 245 WGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRI 304
           WG GIIS ++ E RFLGW SSLINAAFT+QGTELVGITAGE+ NPR+TVP+AI KV FRI
Sbjct: 267 WGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINKVFFRI 326

Query: 305 LVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIIS 364
           L FYILSL FIGLLVP++D KLKSE+SY+SSSPF+IAIENSGTK+LPHIFN VIL TIIS
Sbjct: 327 LFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIIS 386

Query: 365 AGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEA 424
           AGNSN+Y+GSR+L+GLAKN   PK+FA+ TK GVP  +V+ T+ FG LA++  S    + 
Sbjct: 387 AGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNSAQKV 446

Query: 425 FQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMII 484
           F WLLN+  +AGFF+WL IS AHIRFMQ L+ R +SRNDLPFKAKFMP+ AYY+   + +
Sbjct: 447 FDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISL 506

Query: 485 IIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXX 544
           II  QGFTAFAPKF+V NFFA+YISVFLF   W  FQ+ F+ R++               
Sbjct: 507 IIIIQGFTAFAPKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFILTKNDVDIDTDRRDI 566

Query: 545 XXXVWQDTTPANLWGKFWDFVA 566
              VW++ TP N W KFW  +A
Sbjct: 567 DCIVWEEETPKNAWDKFWAAMA 588

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/546 (62%), Positives = 409/546 (74%), Gaps = 2/546 (0%)

Query: 21  KSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXX 80
           K  E+  + D  G+     P+      ++      +  +VKR L  RH            
Sbjct: 5   KDYEATREKD--GSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGT 62

Query: 81  XXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPA 140
                   PL  +GPVG+LIAY+F+GT+ YSVTQSLGEMATFIPVT+SFT+F+ RFLSPA
Sbjct: 63  GLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPA 122

Query: 141 LGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYG 200
           LG+ANGY+YW SWA+TFALELSVVGQIIQFWT AVPL AWI+IFWVILTISNLFPV+ YG
Sbjct: 123 LGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYG 182

Query: 201 EIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFL 260
           E+EFWIA +KV AI+GFIIY F +VCGAGKTGPVGFRYWRNPGPWG GIIS ++ E RFL
Sbjct: 183 EVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFL 242

Query: 261 GWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVP 320
           GW SSLI+AAFT+QGTELVGITAGEAANPR+TVP+AI KV FRIL FYILSL FIGLLVP
Sbjct: 243 GWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVP 302

Query: 321 YDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGL 380
           ++D KLKSE+SY+SSSPF+IAIENSGTK+LPHIFN VIL TIISAGNSNVY+GSR+ + +
Sbjct: 303 FNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSM 362

Query: 381 AKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSW 440
           A NG  PK    TTKSG+P  AV+ TS+ G LA++E+S+G    F WLLN+  VAGFF+W
Sbjct: 363 AMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTW 422

Query: 441 LLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDV 500
           +LIS +HIRFMQ L+ +GISR+DLPFKAKFMP+ AYYA   + +II  QGFTAFAPKF V
Sbjct: 423 ILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKV 482

Query: 501 LNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXVWQDTTPANLWGK 560
            +FF +YISV LFF+FW  FQ+WF+     K                VW++  P NLW K
Sbjct: 483 SDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEK 542

Query: 561 FWDFVA 566
           FW  +A
Sbjct: 543 FWAAIA 548

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/573 (61%), Positives = 425/573 (74%), Gaps = 16/573 (2%)

Query: 10  ETLEGKSKIVIKSTES-LEQHDLQGNEDKNTPTTTPSKENVSENEKDEYH---------E 59
           +TLE  S+ V +  +S ++       +D         + + S   +DE           E
Sbjct: 2   DTLESSSQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAE 61

Query: 60  VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEM 119
           VKR+L +RH                    PL  SGPVGSLIAY+F+GT+ Y+VTQSLGEM
Sbjct: 62  VKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEM 121

Query: 120 ATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPA 179
           ATFIPVT+SFT+F+ RFLSP++GAA GYMYWFSWA+TFALELSVVGQI+ +WTFAVP+ A
Sbjct: 122 ATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAA 181

Query: 180 WISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYW 239
           WISIFWVILT  N+FPV+ YGEIEFW+A +KV AI+GF+IYC C+VCGAG TGPVGFRYW
Sbjct: 182 WISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPVGFRYW 241

Query: 240 RNPGPWGTGI------ISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTV 293
           RNPGPWG G+      IS N    RFLGW +SLINAAFT+QGTELVGITAGEAANPR+TV
Sbjct: 242 RNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTV 301

Query: 294 PKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHI 353
           P+AI+KVVFRIL+FYI SLFFIGLLVP+DD KL S++SYVSSSPFIIAIENSGTKILP I
Sbjct: 302 PRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIENSGTKILPDI 361

Query: 354 FNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALA 413
           FN +IL+TIISAGNSN+Y+GSR+LF LAK G  PK+ ++TTK GVP  +V+ T++FG LA
Sbjct: 362 FNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLA 421

Query: 414 FMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPY 473
           +MET+ GG   F WL+N+  +AGF++WL I  +HIRFMQ L+ RGISR+DLPFKA  MP 
Sbjct: 422 YMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPG 481

Query: 474 LAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLV 533
           LAYYA   M+III FQGFTAF P FDV +FFA+YISV LFF+ WG+FQLWFKCR++WKL 
Sbjct: 482 LAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLE 541

Query: 534 XXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                         +W+D  P   W KFW+ VA
Sbjct: 542 DVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/562 (59%), Positives = 411/562 (73%), Gaps = 9/562 (1%)

Query: 5   DINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDL 64
           ++ +    E  S+    +   L    LQ   +  T  T          E  ++  VKR L
Sbjct: 47  ELKSTNASEAASQSTSPTGSELIPDCLQSATNTGTLCT---------EEHVKHRSVKRAL 97

Query: 65  SKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP 124
             RH                    PL  +GPVG+LIAY+F+GT+++SVTQSLGEM TFIP
Sbjct: 98  KPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQSLGEMVTFIP 157

Query: 125 VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIF 184
           VT+SFT+FSHRFLSPA GAANGYMYWFSWAMTFA+ELSV+G++IQFWT AVPL AWI IF
Sbjct: 158 VTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTAVPLAAWIVIF 217

Query: 185 WVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGP 244
           W +LT+SN+FPV+ YGEIEFWIAFLKV +++GF+I+C CI  GAG  GP GFRYWR+PG 
Sbjct: 218 WFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGPHGPFGFRYWRDPGA 277

Query: 245 WGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRI 304
           WG GII+ + +EARFLGW SSLINAAFT+QGTELVGITAGEAANPR+ VPKAI+KV+ RI
Sbjct: 278 WGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPKAIKKVILRI 337

Query: 305 LVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIIS 364
           L FY+ SLFFIG+LVP++D KL S  S+VSSSPFIIAI+NSG  +LP IFNGVIL+TIIS
Sbjct: 338 LFFYVGSLFFIGMLVPFNDPKLTSATSFVSSSPFIIAIQNSGVSLLPSIFNGVILITIIS 397

Query: 365 AGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEA 424
           AGNSNVY+GSR+LFGLA +   P+ F +TTK+GVP  AV+FTSLFG+LAF+E +T GD+ 
Sbjct: 398 AGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLAFLELTTDGDKV 457

Query: 425 FQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMII 484
           F WLL++V +AGFF+WLLIS +HIRFM+ L+ RGISRN LPFKA FMP+LAYYAT  +I+
Sbjct: 458 FNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPWLAYYATAFIIL 517

Query: 485 IIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXX 544
           II  QGFTAFAP+F+V +F ASYIS+ LF I WG FQ   KCR  WK+            
Sbjct: 518 IILIQGFTAFAPRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWKVEDIDLDSDRKDI 577

Query: 545 XXXVWQDTTPANLWGKFWDFVA 566
               W+D +P   W K W  +A
Sbjct: 578 EDIRWEDDSPKTFWTKVWQTLA 599

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/563 (61%), Positives = 417/563 (74%), Gaps = 2/563 (0%)

Query: 6   INTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHE--VKRD 63
           +N E++  G++  +    +S+       +E     +++  + +    ++ + HE  VKR 
Sbjct: 21  MNDEDSSSGQAGAINHRKKSVVSKTTAVDESLPGLSSSDLESSDDFVKEGQVHEAEVKRA 80

Query: 64  LSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFI 123
           L +RH                    PL  +GPVG LIAYLF+ T+VYSV QSLGEMATFI
Sbjct: 81  LKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEMATFI 140

Query: 124 PVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISI 183
           PVT++FT+FS RFLSPA GAA+GYMYWFSWA+TFALELSVVGQII+FWT AVP+ AWI+I
Sbjct: 141 PVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMAAWITI 200

Query: 184 FWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPG 243
           FWV+LT+SNLFPV+ YGE EFWIAF+KV A++GFIIYC C+VCGAG TGPVGFRYWRNPG
Sbjct: 201 FWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPVGFRYWRNPG 260

Query: 244 PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFR 303
            WG GIIS +  E RFLGW SSLINAAFT+QGTELVGITAGEAANPR++VP+AI+KVVFR
Sbjct: 261 AWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFR 320

Query: 304 ILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTII 363
           ILVFY     FIGLLVPY+D KL S +SYVSSSPFIIAIENSGTK+LPHIFN V+L TII
Sbjct: 321 ILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPHIFNAVVLTTII 380

Query: 364 SAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDE 423
           SAGNSNVY+GSR+++GLAK    P  F +T  +GVP FAV FTS FGALA+ME STGG  
Sbjct: 381 SAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYMELSTGGAS 440

Query: 424 AFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMI 483
           AF WLLN+ GVAGFF+W+LIS  HIRFMQ L+ RGISR+DLPFKAKFMP+LAYYA   M+
Sbjct: 441 AFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAYYALFFMV 500

Query: 484 IIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXX 543
           +II  QGFTAFAP F  ++F A+Y+SVFLF   W   Q+WF+CR   +L           
Sbjct: 501 VIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEVDIDTDRRD 560

Query: 544 XXXXVWQDTTPANLWGKFWDFVA 566
               VW D  P  LW KFW+ VA
Sbjct: 561 IEAVVWDDEPPKTLWDKFWNIVA 583

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/570 (59%), Positives = 410/570 (71%), Gaps = 8/570 (1%)

Query: 4   LDINT--EETLEGKSKIVIKSTE----SLEQHDLQGNEDKNTPTTTPSKENVSENEKDEY 57
           +DI T  E   E  S   IK  E      E+ D       N+       +  +E      
Sbjct: 5   VDICTSKEGKREANSAPTIKEKELVDAQYEEQDTSAAIAANSSIENDGAKG-TETSPRSR 63

Query: 58  HEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLG 117
            EV+R L +RH                    PL  +GPVG+LI+YLF+GTV+YSVTQSLG
Sbjct: 64  GEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLG 123

Query: 118 EMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPL 177
           EMATFIPVT+SF++F+ RFLSPALGA NGYMYW SW  TFALELSV+GQIIQ+WT AVPL
Sbjct: 124 EMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVPL 183

Query: 178 PAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGK-TGPVGF 236
            AWI IFW +LT+ N+FPV+ YGE EF IA +KV  +LGFII+ FCIVCGAG+  GP+GF
Sbjct: 184 AAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGF 243

Query: 237 RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKA 296
           RYWRNPG WG GIISSN  E RFLGW SSLINAAFT+QGTELVGITAGEAANPR+ VP+A
Sbjct: 244 RYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRA 303

Query: 297 IRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNG 356
           I+KVV RILVFYILSLFFIGLLVPY+D KL S+ ++VS+SPF+I+IENSGTK+LP IFN 
Sbjct: 304 IKKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIFNA 363

Query: 357 VILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFME 416
           V+L+TI SAGNSNVYIGSR+L+ L+KN   PK  +  T+ GVP  AV+ TSLFG LAF+E
Sbjct: 364 VVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLE 423

Query: 417 TSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAY 476
           TS G  +AF WLLN+ GVAGFF+WLLISF+HIRFMQ ++ RGISR+DLP+KA+ MP+LAY
Sbjct: 424 TSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAY 483

Query: 477 YATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXX 536
           YA+  + +I+  QGFTAFAP F  ++F A+YISVFLF I W SFQLWFKCR + KL    
Sbjct: 484 YASFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDID 543

Query: 537 XXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                      VW +      W + WD ++
Sbjct: 544 IDSDRREIEEQVWIEPECKTRWQRVWDILS 573

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/569 (58%), Positives = 418/569 (73%), Gaps = 8/569 (1%)

Query: 6   INTEETLEGKSKI----VIKSTESLEQHDLQGNEDKNTPTTTPSKENV---SENEKDEYH 58
           +N + + EG+ +I    +IK  E +++     N  K   T    +++    +E+   E  
Sbjct: 5   VNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVEDDAAKETESSPQERR 64

Query: 59  EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118
           EVKR L +RH                    PL  +GPVG+LI+YLF+GTV+YSVTQSLGE
Sbjct: 65  EVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124

Query: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178
           M TFIPVT+SF++F+ RFLSPALGA NGYMYW SW  TFALELSV+G++IQ+WT AVPL 
Sbjct: 125 MVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLA 184

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT-GPVGFR 237
           AWI IFW +LT  N+FPV+ YGE EF IA +KV A+LGFII+ FC+VCGAG++ GP+GFR
Sbjct: 185 AWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFR 244

Query: 238 YWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAI 297
           YWRNPG WG GIISS+  E RFLGW SSLINAAFT+QGTELVGITAGEAANPR+ +P+AI
Sbjct: 245 YWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAI 304

Query: 298 RKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGV 357
           +KVV RILVFYILSLFFIGLLVPY+D KL S+  +VSSSPF+I+IENSGTK+LP IFN V
Sbjct: 305 KKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAV 364

Query: 358 ILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMET 417
           +L+TI+SAGNSNVYIGSR+L+ L+KN   P+  +  T+ GVP F+V+ TS+FG LAF+E 
Sbjct: 365 VLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEV 424

Query: 418 STGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYY 477
           S G  +AF WLLN+ GVAGFF+WLLISF+HIRFMQ ++ RGISR+DLP+KA+ MP+LAYY
Sbjct: 425 SAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYY 484

Query: 478 ATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXX 537
           A+  + +I+  QGFTAFAP F  ++F A+YIS+FLF   W SFQ+WFKCR +WKL     
Sbjct: 485 ASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDI 544

Query: 538 XXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                     VW +      W + WD ++
Sbjct: 545 DSDRRQIEELVWIEPECKTRWQRVWDVLS 573

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/569 (58%), Positives = 414/569 (72%), Gaps = 10/569 (1%)

Query: 1   MSILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYH-- 58
           +S  +IN+  T++ +  I  +       +D Q  E+     ++ + ++  E E       
Sbjct: 12  VSQYEINSISTIKEEELICAR-------YDGQDTEEAVAGKSSINNDSAKETETSPRKGG 64

Query: 59  EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118
           EVKR L +RH                    PL  +GPVG+LI+YLF+GTV+YSVTQSLGE
Sbjct: 65  EVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124

Query: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178
           MATFIPVT+SF++F+ RFLSPALGA NGYMYW SW  TFALELSV+GQIIQ+WT AVPL 
Sbjct: 125 MATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAVPLV 184

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTG-PVGFR 237
           AWI IFW +LT+ N+FPV+ YGE EF IA +KV A+LGFI + FCIVCGAG++G P+GFR
Sbjct: 185 AWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGFR 244

Query: 238 YWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAI 297
           YWRNPG WG GIIS N  E RFLGW SSLINAAFT+QGTELVGITAGEAANPR+ VP+AI
Sbjct: 245 YWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRAI 304

Query: 298 RKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGV 357
           +KVV RILVFYILSLFFIGLLVPY+D KL SE ++VSSSPF+I+IENSGTK+LP IFN V
Sbjct: 305 KKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSPFMISIENSGTKVLPDIFNAV 364

Query: 358 ILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMET 417
           +L+TI+SAGNSNVYIGSR+L+ L+KN   P+  +  TK GVP FAV+ TS FG LAF+ET
Sbjct: 365 VLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFLET 424

Query: 418 STGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYY 477
           S G  + F WLLN+ GVAGFF+WLLIS +HIRFMQ ++ RGISR+DLP++A+ MP+LAYY
Sbjct: 425 SAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLAYY 484

Query: 478 ATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXX 537
           A+  + +I+  QGFTAFAP F  ++F A+YISVFLF   W  FQ+WFKCR+VWKL     
Sbjct: 485 ASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQDVDI 544

Query: 538 XXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                     VW +      W   WD ++
Sbjct: 545 DSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/547 (61%), Positives = 402/547 (73%), Gaps = 5/547 (0%)

Query: 25  SLEQH---DLQGNEDKNTPTTTPSKENVSENEKDEYHE--VKRDLSKRHXXXXXXXXXXX 79
           S +QH   + + N ++     + SK+ VS        E  VKR L  RH           
Sbjct: 2   SAQQHHSSEKEKNSEELVSEFSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIG 61

Query: 80  XXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSP 139
                    PL  +GPVG+LIAY+F+GT+ Y V+QSLGEMATFIPVT+SF +F+ RFLSP
Sbjct: 62  TGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSP 121

Query: 140 ALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIY 199
           ALGAANGYMY+ SW++TFALELSVVGQ+IQFWT AVPL AWI I WV+L  +NL PV+ Y
Sbjct: 122 ALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIILWVVLVSANLAPVKFY 181

Query: 200 GEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARF 259
           GE+EFWIA +KV AI+GFIIY F +VCGAGKTGPVGFRYWRNPGPWG GIIS ++ E RF
Sbjct: 182 GEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGPWGPGIISKDVNEGRF 241

Query: 260 LGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLV 319
           LGW SSLI+AAFT+QGTELVGITAGEAANPR+TVP+AI KV FRIL FYILSL FIGLLV
Sbjct: 242 LGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLV 301

Query: 320 PYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFG 379
           P++D KLKSE+SY+SSSPF+IAIENSGTK+LPHIFN VIL TIISAGNS+VYI SR+L+ 
Sbjct: 302 PFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYS 361

Query: 380 LAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFS 439
           +  NG  PK    TTKSG+P  AV+ TSL G LA++E+S G    F WLLN+  VAGFF+
Sbjct: 362 MGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFA 421

Query: 440 WLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFD 499
           W+LIS AHIRFMQ L+ +GISR+DLPFKAKFMP+ AYYA   + +II  QGFTAFAPKF+
Sbjct: 422 WMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFN 481

Query: 500 VLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXVWQDTTPANLWG 559
           V +FF +Y+SV LFF  W  FQ+WF+     K                VW++  P NLW 
Sbjct: 482 VSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDNDVWEEDEPKNLWE 541

Query: 560 KFWDFVA 566
           KFW  VA
Sbjct: 542 KFWSAVA 548

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/479 (67%), Positives = 383/479 (79%), Gaps = 1/479 (0%)

Query: 89  PLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYM 148
           PL  +GPVG+LI+Y+F+GTV+YSVTQSLGEMATFIPVT+SF++F+ RFLSPALGA NGYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 149 YWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAF 208
           YW SW  TFALELSV+GQIIQ+WT AVPL AWI IFW +LT+ N+FPV+ YGE EF IA 
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 209 LKVNAILGFIIYCFCIVCGAGK-TGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLI 267
           +KV A+LGFIIY FC+VCGAG+  GP+GFRYWRNPG WG GIISS+  E RFLGW SSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 268 NAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLK 327
           NAAFT+QGTELVGITAGEAANPR+ VP+AI+KVV RILVFYI+SLFFIGLLVPY+D KL 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 328 SENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGP 387
           S+ S+VS+SPF+I+IENSGTK+LP IFN V+L+TI+SAGNSNVYIGSR+L+ L+KN   P
Sbjct: 259 SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAP 318

Query: 388 KLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAH 447
           +  +  TK GVP FAV+ TS+FG LAF+ETS G  +AF WLLN+ GVAGFF+WLLISF+H
Sbjct: 319 RFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSH 378

Query: 448 IRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASY 507
           IRFMQ +  RGISRNDLP+KA+ MPYLAYYA+  + +I+  QGFTAFAP F  ++F A+Y
Sbjct: 379 IRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAY 438

Query: 508 ISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
           ISVFLF   W SFQLWFKC  + KL               VW +      W   WD +A
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/521 (62%), Positives = 391/521 (75%), Gaps = 2/521 (0%)

Query: 46  KENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFL 105
           +E++      E  +VKR+L  RH                    P+  +GPVGSLIAY+F+
Sbjct: 88  EEDIDATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFM 147

Query: 106 GTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVG 165
           GT+V+SVTQSLGEMATFIPVT+SFT+F+ RF+S   GAA GYMYWFSWA+TFALELSVVG
Sbjct: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207

Query: 166 QIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIV 225
           Q+I+FWTF VPL AWISIFWV++ I N FPV++YGE EFW+A +KV AI+GFIIYC C+V
Sbjct: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267

Query: 226 CGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGE 285
           CGAG TGPVGFRYWR+PGPWG GIIS +  EARFLGW SSLINAAFT+QGTELVGITAGE
Sbjct: 268 CGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGE 327

Query: 286 AANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENS 345
           AANPR++VP+AI+KV  RIL+FYILSLFFIGLLVPY+D KL S +SYVS+SPFIIAI+NS
Sbjct: 328 AANPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQNS 387

Query: 346 GTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVF 405
           GTK+LPHIFN VIL TIISA NSNVY+GSR+L+GL+     PK F K T++GVP  AV+F
Sbjct: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLF 446

Query: 406 TSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLP 465
           T+ FGALA+METS GG  AF WLLN+ GVAGFF+WL IS +HIRFMQ L+ RG+SR+DLP
Sbjct: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506

Query: 466 FKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFK 525
           +KA  MP LAYY    + +II  QGFTAFAPKFD   F  +YIS FLF   +   Q +F+
Sbjct: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566

Query: 526 CRYVWKLVXXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
            R +W+ +              V  +  P   W KFW  +A
Sbjct: 567 TR-LWRTLDDVDIDTDRRDIDTVIWEEGPQTFWDKFWAVIA 606

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/555 (57%), Positives = 402/555 (72%), Gaps = 4/555 (0%)

Query: 13  EGKSKIVIKSTESLEQHDLQG-NEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXX 71
           EG S+   K+   LE +++    E+        S+++   +     + V+R L  RH   
Sbjct: 8   EGMSQ---KTETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRHVSM 64

Query: 72  XXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTI 131
                           +PL  +GPVG+LI+YLF+G++ Y VTQSLGEMATFIPVT+SFT+
Sbjct: 65  IALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTV 124

Query: 132 FSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTIS 191
           F+ RFLS  LGAANGYMY FSW++T+ALELS+VGQII++WT AVP  AWI+IFWV +T+S
Sbjct: 125 FTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLS 184

Query: 192 NLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIIS 251
           NL PV+ YGE +FWIA +KV AI+GF++YC C+VCGAGKTGPVGFRYWRNPGPWG GIIS
Sbjct: 185 NLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYWRNPGPWGDGIIS 244

Query: 252 SNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILS 311
            +I E RFLGW SSL+NAAFT+QGTELVGI+AGE+ANPR+TVPKAI KV FRIL+FY+ S
Sbjct: 245 HDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVGS 304

Query: 312 LFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVY 371
           LFFIGLLVP++D KL S +SY + SPFIIAI+NSGTKILP IFN VIL TIISA NSNVY
Sbjct: 305 LFFIGLLVPFNDEKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAANSNVY 364

Query: 372 IGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNV 431
           +GSR+L+GLAK    P+ FA+T + GVP  AV+F + FG L ++  S G  +AF WLLN+
Sbjct: 365 VGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLNI 424

Query: 432 VGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGF 491
             +AGFFSWL IS  H+RFMQ L+ +GISR+DLPFKAK MP+ AYY+   + +II  QGF
Sbjct: 425 TAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGF 484

Query: 492 TAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXVWQD 551
           T+ AP F+V NFFA+YISVF+F + W  FQ W++ R + ++                W +
Sbjct: 485 TSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDAQQWDN 544

Query: 552 TTPANLWGKFWDFVA 566
           T P  LWGKFW  +A
Sbjct: 545 TEPTTLWGKFWAAMA 559

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/510 (62%), Positives = 382/510 (74%), Gaps = 2/510 (0%)

Query: 59  EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118
           EVKR L  RH                    PL  +GPVGSLIA++ +GT+ YSVTQSLGE
Sbjct: 72  EVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGE 131

Query: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178
           MATFIPVT+SFT+FS RF+SPA+GAANGYMYWFSWA+TFALELS+VGQIIQ+WT AVPL 
Sbjct: 132 MATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE 191

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRY 238
           AWI+IFWV+L   N+FPV+ YGE EFW+A +KV AI+GF+IY  C+VCGAG  GP+GFRY
Sbjct: 192 AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRY 251

Query: 239 WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIR 298
           WR PGPWG GII+ N+ +ARFLGW SSLI+AAFT+QGTELVGITAGE  NPR+ VP+AI 
Sbjct: 252 WRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAIN 311

Query: 299 KVVFRILVFYILSLFFIGLLVPYDDVKLKSEN--SYVSSSPFIIAIENSGTKILPHIFNG 356
           KV FRIL+FYI SLFFIGLLVPY+D KL+  +  SY++ SPF+IAI N  T +LPHIFN 
Sbjct: 312 KVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNA 371

Query: 357 VILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFME 416
           VIL TIISAGNSNVY+GSR+LFGL+KN   PK F+KTTK GVP  AV+ T++FG LA++ 
Sbjct: 372 VILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLN 431

Query: 417 TSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAY 476
            S    E F WLLN+  +AGF +WLLIS +HIRFMQ L+ RGISR+DLP+KAKFMPY AY
Sbjct: 432 VSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAY 491

Query: 477 YATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXX 536
           YA   + +II  QGFTAFAP F+V +FFA+YISVFLFFI W  FQ  ++ +    L    
Sbjct: 492 YAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLDEVD 551

Query: 537 XXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                      +W++  P NLW KFW   A
Sbjct: 552 IDSDRRDIDVIIWEEEEPKNLWEKFWAVAA 581

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/571 (56%), Positives = 401/571 (70%), Gaps = 9/571 (1%)

Query: 1   MSILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDE--YH 58
           M ++  N    LE     + +   S +     G+E      T  S +   E  + E  YH
Sbjct: 1   MGVMATNETIVLE----TLTRERYSKKAKGNNGSEIALESITPDSGDEFPEEHEQEGDYH 56

Query: 59  E--VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSL 116
           E  VKR L  RH                   +PL  +GPVGSLIAY+F+GTVVYS+TQSL
Sbjct: 57  ETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQSL 116

Query: 117 GEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVP 176
           GEMATFIPVT+S T+FS RFLSPA G ANGYMYWF+WA+TFA+ELSVVGQII +WT  VP
Sbjct: 117 GEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYWTSVVP 176

Query: 177 LPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF 236
           L AWI+IFW+I+T+ N FPVR YGEIEFWIA +KV  I+G++IY F +VCG    GP+GF
Sbjct: 177 LGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGSSQGPIGF 236

Query: 237 RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKA 296
           R WRNPGPWGTG+ISSN  EARFLGW SSLI AAFT+QGTELVGITAGE+ NPR+TVPKA
Sbjct: 237 RNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 296

Query: 297 IRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSGTKILPHIFN 355
           I KV FRIL FYILSLFF+GLLVPY+D ++  + ++ V++SPF+I+I N+GTKILP IFN
Sbjct: 297 INKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAGTKILPDIFN 356

Query: 356 GVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFM 415
            V+LVT++SA NSNVYIGSR+++ LA++G  PK F    + GVPV  V+ T+L G +AF+
Sbjct: 357 AVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAFL 416

Query: 416 ETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLA 475
             +     AF WL+N+  +AG  +WL IS AHIRFMQCL+ RGISR+ LPFKAKFMP+ A
Sbjct: 417 VVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWAA 476

Query: 476 YYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXX 535
           YYA   + +IIF QG+TAF+PKFDV  FF +YIS+ L  + +   Q+++KCR++WKL   
Sbjct: 477 YYAASFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLWKLEDI 536

Query: 536 XXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                       VW+D  P NLW KFW  +A
Sbjct: 537 DIDTNRREIDAIVWEDDEPKNLWDKFWSTIA 567

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/569 (54%), Positives = 408/569 (71%), Gaps = 3/569 (0%)

Query: 1   MSILDINTEETLEGKSKIVIKSTESLEQHDLQ-GNEDKNTPTTTPSKENVSENEKDEYHE 59
           + +++ N+ +    K  I ++ ++  E   L  G+      TT+   +  S+ E+ +Y +
Sbjct: 42  IELINTNSFKDSSDKPPITLRKSKLSEIGSLHSGSNLHQHGTTSLHDDEESDTEEAQYQD 101

Query: 60  --VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLG 117
             VKR L +RH                    PL  +GPVGSLIAY+F+G+VVY VTQSLG
Sbjct: 102 TRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYFVTQSLG 161

Query: 118 EMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPL 177
           EMATFIPVT+S T+FS RFLSPA G ANGYMYWF+WA+T+A+E+SV+GQ+IQ+WT AVPL
Sbjct: 162 EMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPL 221

Query: 178 PAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFR 237
            AWI IFWVI+T+ N FPV++YGE EFWIA +KV AI+G++IY   IVCG    GP+GFR
Sbjct: 222 AAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGSHQGPIGFR 281

Query: 238 YWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAI 297
           YWRNPGPWG GIIS    EARFLGW SSLINAAFT+QGTELVGITAGEAANPR++VP+AI
Sbjct: 282 YWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 341

Query: 298 RKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGV 357
            KVVFRI +FYI+SLFFIGLLVP++D +L ++++ ++SSPF+I+I+N+GT+ LP IFN V
Sbjct: 342 NKVVFRIALFYIMSLFFIGLLVPFNDDRLANDSAVIASSPFVISIQNAGTRALPDIFNAV 401

Query: 358 ILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMET 417
           +L+TIISA NSNVY+GSR+L+ LA  G  PK+F+  TK GVP   V+ T+  G LAF+  
Sbjct: 402 VLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAALGLLAFLVV 461

Query: 418 STGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYY 477
           +   + AF WL+N+  +AG  +WL IS +HIRFMQ L+ RGISR+DLPFKAK MP+ AYY
Sbjct: 462 NNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLMPWGAYY 521

Query: 478 ATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXX 537
           A+  + +IIF QGF AF PKFDV  FF SYIS+ L  + +   QL+++CR++WK+     
Sbjct: 522 ASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIWKVEDIDI 581

Query: 538 XXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                     +W++  P NLW KFW +VA
Sbjct: 582 DSDRREIEAIIWEEDEPKNLWEKFWAWVA 610

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/560 (57%), Positives = 399/560 (71%), Gaps = 6/560 (1%)

Query: 10  ETLEGKSKIVIKSTESLEQHD-LQGNEDKNTPTTTPSKENVSENEK---DEYHEVKRDLS 65
           ET     +   +S ES E  D L   ++        ++EN+SE E    ++  +VKRDL 
Sbjct: 8   ETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLK 67

Query: 66  KRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPV 125
            RH                   +P+ ++GPVGSL+AYLF+GT+ + VTQSLGEMATFIPV
Sbjct: 68  PRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPV 127

Query: 126 TASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFW 185
           T+SFT+++ RFLSPALGAANGY+YWFSW +TFALELS++GQ+IQ+WTFAVPL  WI +FW
Sbjct: 128 TSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFW 187

Query: 186 VILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPW 245
           ++LT SN+ PVR YGEIEFWIA LKV +I GF+IY   +VCG    G +GFRYW+NPGPW
Sbjct: 188 ILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPW 247

Query: 246 GTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRIL 305
           G G+ISSN  EARFLGW SSLI AAFT+QGTELVGITAGE+ NPR+TVPKAI KV FRIL
Sbjct: 248 GMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRIL 307

Query: 306 VFYILSLFFIGLLVPYDDVKLK-SENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIIS 364
            FYILSLFF+GLLVPY D +L  + +S +++SPF++AI+NSGTK+LP +FNGVILVTI+S
Sbjct: 308 FFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILS 367

Query: 365 AGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEA 424
           AGNSN+YIGSR+L+GL+K+G  P LF KT K GVP +AV+ +S+FG LA++  S    + 
Sbjct: 368 AGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKV 427

Query: 425 FQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMII 484
           F WLL +  VAGFF+WLLIS +HIRFMQ L+ RGISRNDLPFKAKFMP+ AYYA   + +
Sbjct: 428 FDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITV 487

Query: 485 IIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXX 544
           II  QGF +FAP+F    F A YISVFLF + W  FQ+ FK R + +             
Sbjct: 488 IILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREI 547

Query: 545 XXXVW-QDTTPANLWGKFWD 563
              VW  D  P  L  K W 
Sbjct: 548 DALVWSDDDEPKTLLQKLWQ 567

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/540 (58%), Positives = 391/540 (72%)

Query: 27  EQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXX 86
           E   ++  E  +       +++  +    +   ++R L  RH                  
Sbjct: 16  EIKVMEEGESSSLADGVLEQQSQIDTASSQERGIQRALKPRHVSMIALGGTIGTGLFVGI 75

Query: 87  XNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANG 146
            NPL  +GPVGSLI+YLF+G++ + VTQSLGEMATFIPV +SFT+F+ RFLSPALGAANG
Sbjct: 76  ANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVASSFTVFTRRFLSPALGAANG 135

Query: 147 YMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWI 206
           YMY FSW +TFALELS+VG+IIQ+WT  VP  AWI IFWV +++SNL  V+ YGE +FWI
Sbjct: 136 YMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWI 195

Query: 207 AFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSL 266
           A +KV AI+GF+IYC C+VCGAGKTGPVGFRYWRNPGPWG GIIS + +E RFLGW SSL
Sbjct: 196 ALIKVIAIVGFLIYCLCMVCGAGKTGPVGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSL 255

Query: 267 INAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL 326
           +NAAFT+QGTELVG++AGE+ANPR+TVPKAIRKV  RIL+FY+ SLFFIGLLVP++D KL
Sbjct: 256 VNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKL 315

Query: 327 KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTG 386
            S  +Y +SSPFIIAI+NSGT+ LP IFN VIL TIISA NSNVY+GSR+L+GLAK G  
Sbjct: 316 DSTANYSASSPFIIAIQNSGTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLA 375

Query: 387 PKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFA 446
           PK+  +  + GVP   V   SLFG L ++  S+G  +AF WLLN+  +AGFF+WL IS  
Sbjct: 376 PKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLC 435

Query: 447 HIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFAS 506
           HIRFMQ L+ +GISR+DLPFKAK MP+ AYYA   +++II  QGFTAFAPKF+V NFFA+
Sbjct: 436 HIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLIIIIQGFTAFAPKFNVSNFFAA 495

Query: 507 YISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
           Y+SVFLF   W  FQ+ FK R + K+               VW+D  P NLWGKFW  +A
Sbjct: 496 YVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSDRREIEAEVWEDDEPTNLWGKFWAAMA 555

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/539 (57%), Positives = 392/539 (72%), Gaps = 7/539 (1%)

Query: 35  EDKNTPTTTPSKENVSEN---EKDEYH----EVKRDLSKRHXXXXXXXXXXXXXXXXXXX 87
           ED  +  T P   +  +N   EK E      EVKR L  RH                   
Sbjct: 24  EDYVSSETLPIYSHSGDNAPCEKGEGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIA 83

Query: 88  NPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGY 147
           +PL  SGPVG+LIAY+F+G++VY VTQSLGEMATFIPVT+S T+FS RFLSPA G ANGY
Sbjct: 84  SPLSESGPVGALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGY 143

Query: 148 MYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIA 207
           MYWF+WA+T+A+E++VVGQ+IQ+WT AVPL AWI+IFWV++T++N FPV+ YGE+EFW+A
Sbjct: 144 MYWFNWAITYAVEIAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVA 203

Query: 208 FLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLI 267
            +KV AI+G++IY   IVCG    GP+GFRYWRNPGPWG GIIS ++ E RFLGW SSLI
Sbjct: 204 SVKVIAIVGYLIYALVIVCGGSHQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLI 263

Query: 268 NAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLK 327
           NAAFT+QGTELVGITAGEAANPR+TVP+AI KV FRIL FYILSLFFIGLLVPYDD++L 
Sbjct: 264 NAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLFFIGLLVPYDDLRLS 323

Query: 328 SENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGP 387
           +  + ++SSPF+I+I+N+GTK+LPHIFN ++++TIISA NSNVY+GSR+L+ LA +G  P
Sbjct: 324 NTTAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAP 383

Query: 388 KLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAH 447
           K F   TK GVP   V+ T+L G LAF+  +   +EAF WL+N+  +AG  +WL IS +H
Sbjct: 384 KQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSH 443

Query: 448 IRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASY 507
           +RFMQCL+ RGISR DLPFKAK MP+ AYYA   + +II  QGF AF PKF V +FF SY
Sbjct: 444 VRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSY 503

Query: 508 ISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
           IS+ L  + +   QL+++CR++W L               VW+D  P NLW KFW  VA
Sbjct: 504 ISLILLAVLFLGCQLFYRCRFIWSLDDIDIDSDRREIDAIVWEDDEPKNLWEKFWVAVA 562

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/577 (55%), Positives = 400/577 (69%), Gaps = 31/577 (5%)

Query: 21  KSTESLEQHDLQGN-EDKNTPT-------------TTPSKENVS---------------E 51
           K      QH+L  + E+ + P+             ++P KEN                 +
Sbjct: 4   KGPLEFNQHELDSSKENTDKPSLNETYVKEYDRSISSPPKENDGYGYRVDNEYDVDDSVD 63

Query: 52  NEKDEYH--EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVV 109
            EK E    EVKR L  RH                    PL  +GPVG LIAYLF+ T+ 
Sbjct: 64  GEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIA 123

Query: 110 YSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQ 169
           +SV QSLGEMAT+IPVT++F++FS RFLSPA GAANGYMYWFSW++TFALELSV+GQI+Q
Sbjct: 124 FSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQ 183

Query: 170 FWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG 229
           +WTF VP+ AWISIFWV++   N  PV+ YGE EFWIAF+KV AI+GFIIYCF +VCGAG
Sbjct: 184 YWTFKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAG 243

Query: 230 KTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANP 289
           KTGPVGFRYWR+   +G GIIS N  EARFLGW SSLINAAFT+QGTELVGITAGEAANP
Sbjct: 244 KTGPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 303

Query: 290 RQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKI 349
           R+TVPK+I++ ++RIL+FYI SL F+GLLVP++D  L+   SY +SSPFI+AI+NSGTK 
Sbjct: 304 RKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASSPFILAIKNSGTKA 363

Query: 350 LPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLF 409
           LP IFN VIL T+ISA NS+VY+GSR+++ +A+N   P + AK +K GVP  AV+FTS  
Sbjct: 364 LPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAI 423

Query: 410 GALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAK 469
           GALA++ETS+ G   F WL+N+ GVAGFFSW LIS++H+RFM+ L+ RGISRNDLPFKA 
Sbjct: 424 GALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKAS 483

Query: 470 FMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529
           FMP++A Y+   M +II  QGFT F P F   +F ASYISV LFF+ W  FQ+WF+C  +
Sbjct: 484 FMPWIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCPLL 543

Query: 530 WKLVXXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
             +               VW+D  P  LW KFW+ VA
Sbjct: 544 VPIAEIDIDTDRRDVDAEVWEDEPPKTLWDKFWNIVA 580

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/562 (55%), Positives = 400/562 (71%), Gaps = 8/562 (1%)

Query: 13  EGKSKIVIKSTESLEQHDLQGN--EDKNTPTTTPSKENVSENEKDEYH------EVKRDL 64
           + K   V    E LE+ D + +     N   + PS+  +S +E D         +VKR L
Sbjct: 47  DKKDMTVTYDNEILEKKDSKSDIFTSVNRYASHPSEARISSDEYDHQEAEFKDTKVKRAL 106

Query: 65  SKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP 124
             RH                   +PL  SGPVGSLIAY+F+GTVVY VTQ+LGEMATFIP
Sbjct: 107 KPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALGEMATFIP 166

Query: 125 VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIF 184
           VT+S T+FS RFLSPA G +NGY+YWF+WA+T+A+E+SVVGQ+I+FWT  VPL AWISIF
Sbjct: 167 VTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTKVPLAAWISIF 226

Query: 185 WVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGP 244
           WV++T  N FPV +YGEIEFW+A +KV AI+G++IY   IVCG  K GP+GFRYWR+   
Sbjct: 227 WVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGSKQGPIGFRYWRHGYA 286

Query: 245 WGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRI 304
            G G+IS +  EARFLGW +SLINAAFT+QGTELVGITAGEAANPR++VP+AI KVVFRI
Sbjct: 287 MGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRI 346

Query: 305 LVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIIS 364
           ++FYILSLFFIGLLVPY+D KL S  SY++SSPF+I+IEN+GT+ LPHIFN +I++TIIS
Sbjct: 347 VIFYILSLFFIGLLVPYNDPKLNSATSYIASSPFVISIENAGTRALPHIFNAIIMITIIS 406

Query: 365 AGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEA 424
           A NSNVY+ SR+L+ LA +G  PK+FA+ T  GVP   V+ T+L G LAF+  +   +EA
Sbjct: 407 AANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFLVVNNNANEA 466

Query: 425 FQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMII 484
           F WL+N+  +AG  +WL IS +H+RFM+ L+ RGISR+DLPFKA+FMPY +YYA   + +
Sbjct: 467 FNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGSYYACFFITV 526

Query: 485 IIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXX 544
           IIF QGFTAF+PKFDV +FF +YIS+ L  + +   QL+++CR+ WK+            
Sbjct: 527 IIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDIDIDTDRREI 586

Query: 545 XXXVWQDTTPANLWGKFWDFVA 566
              VW+D  P   W KFW  VA
Sbjct: 587 DEIVWEDDEPKTAWDKFWAAVA 608

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/532 (57%), Positives = 383/532 (71%), Gaps = 1/532 (0%)

Query: 36  DKNTPTTTPSKENVSENEKD-EYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISG 94
            ++ P+T P   +    E D +  +VKR L  RH                   +PL  SG
Sbjct: 90  SQDEPSTDPLGSDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSG 149

Query: 95  PVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWA 154
           PVG+LIAY+F+GTVVY VTQS+GEMATFIPVT+S T+FS RFLSPA G ANGYMYWF+WA
Sbjct: 150 PVGALIAYIFMGTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWA 209

Query: 155 MTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAI 214
           +TFA+ELSV GQ+I++WT AVP  AWI+IFWV++T++N FPV+ YGE+EFW+A +KV AI
Sbjct: 210 ITFAVELSVTGQVIEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAI 269

Query: 215 LGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQ 274
           +G++IY   IVCG  K GP+GFRYWRNPGPWG GIIS +  E RFLGW +SLINA+FT+Q
Sbjct: 270 VGYLIYALVIVCGGSKQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQ 329

Query: 275 GTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVS 334
           GTELVGITAGEAANPR+TVP+AI KV FRIL FYILSLFF+GLLVPY+   L    + ++
Sbjct: 330 GTELVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIA 389

Query: 335 SSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTT 394
           SSPF+I+I+N+GT+ LP IFN V+LVTIISA NSNVY+GSR+LF LA  G  PK+F+  T
Sbjct: 390 SSPFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVT 449

Query: 395 KSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCL 454
             GVP   V+ TSL G LAF+  +   +EAF WL+N+  +AG  +WL IS +HIRFMQCL
Sbjct: 450 PQGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCL 509

Query: 455 QSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFF 514
           + RGISR+DLPFK+K MPY AYYA   + +IIF QGF AF+P F V  FF SYIS+ L  
Sbjct: 510 KQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLV 569

Query: 515 IFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
           + +   QL+++CR+  +L               +W+D  P  LWGKFW  VA
Sbjct: 570 VVFCGAQLFYRCRFFNRLEDIDIDSDRREADALIWEDDEPTTLWGKFWTAVA 621

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/508 (59%), Positives = 385/508 (75%)

Query: 59  EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118
            VKR L +RH                    PL  SGPVG+LIAY+F+GT++Y VTQSLGE
Sbjct: 90  RVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGE 149

Query: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178
           MATFIPVT+S T+FS RFLSPA G ANGYMYWF+WA+T+A+E+SV+GQ+IQ+WTF VPL 
Sbjct: 150 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKVPLA 209

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRY 238
           AWI IFWV++T+ N FPV+IYGE EFW+A +KV AI+G++IY   IVCG    GP+GFRY
Sbjct: 210 AWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPIGFRY 269

Query: 239 WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIR 298
           WRNPG  G GIISS++ EARFLGW SSLINAAFT+QGTELVGITAGEAANPR++VP+AI 
Sbjct: 270 WRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIN 329

Query: 299 KVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVI 358
           KVVFRI++FYI+SLFF+GLLVPY+D +L + ++ ++SSPF+I+I+N+GTK+LP IFN V+
Sbjct: 330 KVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIFNAVV 389

Query: 359 LVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETS 418
           LVT+ISA NSNVY+GSR+L+ LA++G  PK FA  T+ GVP   V+ T+L G LAF+  +
Sbjct: 390 LVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAFLVVN 449

Query: 419 TGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYA 478
              + AF WL+N+  +AG  +WL IS AHIRFMQ L+ RGISR+DLPFKAKFMP+ AYYA
Sbjct: 450 HNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWGAYYA 509

Query: 479 TIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXX 538
           +  + +IIF QGF AFAPKFDV  FF +YIS+ L  + +   QL+++CR++WKL      
Sbjct: 510 SFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLEDIDID 569

Query: 539 XXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                    VW+D  P NLW KFW  VA
Sbjct: 570 SDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/575 (53%), Positives = 406/575 (70%), Gaps = 20/575 (3%)

Query: 3   ILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDE------ 56
           I  IN E+ +  K K+          H  Q N D N+ T + ++  ++ + +D+      
Sbjct: 34  IETINDEKIVFDKKKLA---------HTNQFNADINSITHSLTRSRIATHHEDDQEEEAE 84

Query: 57  ---YHE--VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYS 111
              YH+  VKR L +RH                    PL  SGPVGSLIAYLF+G+++Y 
Sbjct: 85  EAQYHDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYF 144

Query: 112 VTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW 171
           +TQSLGEMATFIPVT+S T+FS RFLSPA G ANGYMYWF+WA+TFA+E+SVVGQ+I++W
Sbjct: 145 ITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYW 204

Query: 172 TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT 231
           T  VPL AWI+IFWV++T+ N FPV++YGEIEFWIAF+KV AI+G+++Y   IVCG    
Sbjct: 205 TDKVPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQ 264

Query: 232 GPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQ 291
           GP+GFRYWRNPGPWG GIIS ++   RFLGW SSLINAAFT+QGTELVGITAGEAANPR+
Sbjct: 265 GPIGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 324

Query: 292 TVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILP 351
           TVP+AI KVVFRI +FYI+SLFFIG+LVPY+D +L S ++ ++SSPF+I+I+N+GTK+LP
Sbjct: 325 TVPRAINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGTKVLP 384

Query: 352 HIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGA 411
            IFN ++++TIISA NSNVY+GSR+L+ LA +G  PK FA  T+ GVP   V+ TS  G 
Sbjct: 385 DIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGL 444

Query: 412 LAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFM 471
           LAF+  +   + AF WL+N+  +AG  +WL IS +HIRFMQ L+ RGISR+DLPFKAK M
Sbjct: 445 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLM 504

Query: 472 PYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWK 531
           P+ AYYAT  + +IIF QGF AF+P +D   FF SYIS+ +  + +   Q++++CR+ W+
Sbjct: 505 PFGAYYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWR 564

Query: 532 LVXXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
           +               +W+D  P  LW KFW  VA
Sbjct: 565 VEDIDIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/579 (53%), Positives = 403/579 (69%), Gaps = 17/579 (2%)

Query: 1   MSILDINTEETLEGKSKIVIKSTESLEQHDLQGNE--DKNTPTTTPSKENVSENEKDEY- 57
           M ++DIN + TL    +   K     ++H LQ +   D N+ T + ++  +  +E     
Sbjct: 37  MEVIDINNKSTLYSIDE---KQYNLKKKHGLQDDAIADVNSTTNSLTRTQIVSHEAGADE 93

Query: 58  ----------HEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGT 107
                       VKR L +RH                    PL  +GPVGSLIAY+F+GT
Sbjct: 94  EDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGT 153

Query: 108 VVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQI 167
           V+Y +TQSLGEMATFIPVT+S T+FS RFLSPA G +NGYMYWF+WA+T+A+E+SV+GQ+
Sbjct: 154 VIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQV 213

Query: 168 IQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG 227
           IQ+WT  VPL AWI+IFWV++T+ N FPV++YGE EFW+A +KV AI+G++IY   IVCG
Sbjct: 214 IQYWTDKVPLAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCG 273

Query: 228 AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAA 287
               GP+GFRYWRNPG WG GIIS N +E RFLGW SSLINAAFT+QGTELVGITAGEAA
Sbjct: 274 GSHQGPIGFRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 333

Query: 288 NPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGT 347
           NPR+TVP+AI KVVFRI++FYI+SLFFIGLLVPY++ +L   ++ ++SSPF+I+I+N+GT
Sbjct: 334 NPRKTVPRAINKVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGT 393

Query: 348 KILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTS 407
             LP IFN V+L+T+ISA NSNVY+GSR+L+ LA++G  PK F   TK GVP   V+ T+
Sbjct: 394 YALPDIFNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTA 453

Query: 408 LFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFK 467
             G LAF+  +   + AF WL+++  +AG  +WL IS AHIRFMQ L+ RGISR+DLPFK
Sbjct: 454 ALGLLAFLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFK 513

Query: 468 AKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCR 527
           AK MPY AYYA+  + IIIF QGF AF P F V  FF SYIS+ L  + + S QL++KCR
Sbjct: 514 AKLMPYGAYYASFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCR 572

Query: 528 YVWKLVXXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
           ++WKL               +W+D  P NLW KFW  VA
Sbjct: 573 FIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/530 (55%), Positives = 387/530 (73%), Gaps = 7/530 (1%)

Query: 44  PSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYL 103
           P  +  +E    E  +VKR+L +RH                    PL  +GPVG+LIAY+
Sbjct: 68  PEHDEDAEEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYI 127

Query: 104 FLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSV 163
           F+G++VY VTQ+LGEMATFIPVT+S T+FS RFLSPA G ANGYMYWF+WA+TFA+E+SV
Sbjct: 128 FMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISV 187

Query: 164 VGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFC 223
           VGQ+IQ+WT AVPL AWI+IFWV++T+ N FPV++YGE+EFW+AF+KV AI+G+++Y   
Sbjct: 188 VGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALI 247

Query: 224 IVCG-AGKTGPVGFRYWRNPGPWGTGIIS------SNIAEARFLGWASSLINAAFTFQGT 276
           IVCG + K GP+GFRYWRNPG WG G+ S      S+  E RFLGW +SLINAAFT+QGT
Sbjct: 248 IVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGT 307

Query: 277 ELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSS 336
           ELVGITAGEAANPR+TVP+AI KVVFRI++FYI+SLFFIGLLVP+ D +L  + + ++SS
Sbjct: 308 ELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRLSDDTTVIASS 367

Query: 337 PFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKS 396
           PF+I+IEN+GTKILP IFN +++VT++SA NSNVY+GSR+L+ LA     PK+FA+ T+ 
Sbjct: 368 PFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQ 427

Query: 397 GVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQS 456
           GVP   V+ TSL G LAF+      + AF WL+++  +AG  +WL IS AH+RFMQ L+ 
Sbjct: 428 GVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQ 487

Query: 457 RGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIF 516
           RGISR+DLPFKAKFMP+ +YYA   + +IIF QGF AF+P FDV  FF  YIS+ L  + 
Sbjct: 488 RGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISLILLAVV 547

Query: 517 WGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
           +   QL+++CR++WKL               +W+D  P  +W KFW  +A
Sbjct: 548 FIGAQLYYRCRFLWKLEDVDIDSDRREIEDAIWEDDEPKTIWDKFWAAIA 597

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/575 (54%), Positives = 405/575 (70%), Gaps = 17/575 (2%)

Query: 9   EETLEGKSKIVIKSTESLEQ------HDLQGNEDKNTPTTTPSKENVSE---------NE 53
           E+T      I I   E LE+      H  Q + D ++ T + ++  +            E
Sbjct: 33  EQTSPDDHSIEIIKNEILEKDKKKIAHTNQFSSDIHSITDSLARSRLPHLGDDDDEEDAE 92

Query: 54  KDEYH--EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYS 111
           + +YH  EVKR L +RH                    PL  SGPVGSLIAYLF+G+++YS
Sbjct: 93  EAQYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYS 152

Query: 112 VTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW 171
           +TQSLGEMATFIPVT+S T+FS RFLSPA G ANGYMYWF+WA+T+A+E+SVVGQ+I++W
Sbjct: 153 ITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYW 212

Query: 172 TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT 231
           T  VPL AWI+IFWV +T+ N FPV++YGEIEFWIAF+KV AI G+++Y   IVCG    
Sbjct: 213 TKKVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQ 272

Query: 232 GPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQ 291
           GP+GFRYWRNPGPWG GIIS +   +RFLGW SSLINAAFT+QGTELVGITAGEAANPR+
Sbjct: 273 GPIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 332

Query: 292 TVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILP 351
           +VP+AI KVVFRI +FYI+SLFFIGLLVPYDD +L S+++ V+SSPF+I+I+N+GTKILP
Sbjct: 333 SVPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKILP 392

Query: 352 HIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGA 411
            IFN ++++T+ISA NSNVY+GSR+L+ LA+ G  PK FA  T+ GVP   V+ T+  G 
Sbjct: 393 DIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGL 452

Query: 412 LAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFM 471
           LAF+  +   + AF WL+N+  +AG  +WL IS +HIRFMQ L+ RGISR+DLPFKAKFM
Sbjct: 453 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFM 512

Query: 472 PYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWK 531
           P+ AYYAT  + +IIF QGF AF+P FDV  FF +YIS+ +  + +   Q++++CR+ WK
Sbjct: 513 PWAAYYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWK 572

Query: 532 LVXXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
           L               +W+D  P   W KFW  VA
Sbjct: 573 LEDIDIDTDRREIEEVIWEDDEPKTYWDKFWAAVA 607

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/545 (55%), Positives = 396/545 (72%), Gaps = 5/545 (0%)

Query: 27  EQHDLQGNEDKNT-PTTTPSKENVSENEKDE--YHE--VKRDLSKRHXXXXXXXXXXXXX 81
           E H L     + T  T T   + + E + +E  YH+  VKR L +RH             
Sbjct: 29  ELHPLDPVTQQVTLRTVTNVCDGLEEEDAEEAGYHDTRVKRALKQRHIGMIALGGTIGTG 88

Query: 82  XXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPAL 141
                  PL  +GPVGSLIAYLF+G++VY +TQSLGEMATFIPVT+S T+FS RFLSPA 
Sbjct: 89  LFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQSLGEMATFIPVTSSITVFSKRFLSPAF 148

Query: 142 GAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGE 201
           G ANGYMYWF+WA+T+A+E+SV+GQ+IQFWT AVPL AWI+IFWV +++ N FPV++YGE
Sbjct: 149 GVANGYMYWFNWAITYAVEISVIGQVIQFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGE 208

Query: 202 IEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLG 261
           IEFW+A +KV AI+G++IY   IVCG    GP+GFRYWRNPGPWG GIIS +  E RFLG
Sbjct: 209 IEFWVASIKVIAIVGYLIYALVIVCGGSSQGPIGFRYWRNPGPWGPGIISDDKNEGRFLG 268

Query: 262 WASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPY 321
           W SSLINAAFT+QGTELVGITAGEAANPR++VP+AI KVVFRI++FYI+SLFF+G+LVP+
Sbjct: 269 WVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPF 328

Query: 322 DDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLA 381
           +D +L S  + ++SSPF+I+I+N+GT++LPHIFN V+++TIISA NSNVY+GSR+L+ L+
Sbjct: 329 NDPRLASNVAVIASSPFVISIQNAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALS 388

Query: 382 KNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWL 441
           + G  PK F   T+ GVP   V+ TSL G LAF+  +   + AF WL+N+  +AG  +WL
Sbjct: 389 QTGNAPKQFGYVTRHGVPYLGVIATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWL 448

Query: 442 LISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVL 501
            IS +HIRFMQ L+ RGISR+DLPFKAK MP+ AYYA   + +IIF QGF AF+PKFDV 
Sbjct: 449 FISLSHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGFEAFSPKFDVS 508

Query: 502 NFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXVWQDTTPANLWGKF 561
            FF +YIS+ +  +     QL+++CR++WKL               +W++  P NLW KF
Sbjct: 509 GFFTAYISLIILVVLLIGCQLYYRCRFLWKLEDIDIDTDRREIECIIWEEEEPQNLWEKF 568

Query: 562 WDFVA 566
           W  +A
Sbjct: 569 WSIMA 573

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/559 (54%), Positives = 391/559 (69%), Gaps = 2/559 (0%)

Query: 9   EETLEGKSKIVIKSTESLE-QHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKR 67
           +++ E  S +    T S E Q  +  NE +N  +   S     E +  E  +VKR L  R
Sbjct: 3   DKSSELSSPLTQGKTRSDEFQMYVYSNETQNGGSGHNSSFEDDEGDLQE-GQVKRALKPR 61

Query: 68  HXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTA 127
           H                   +PL  +GPVG+LIAY+F+G++VY VTQS+GEMATFIPVT+
Sbjct: 62  HVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMATFIPVTS 121

Query: 128 SFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVI 187
           S T+FS+RFLSPA G ANGYMYWF+WA+T+A+E+SV+GQ+IQ+WT AVPL AWI IFWV 
Sbjct: 122 SITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVA 181

Query: 188 LTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGT 247
           +T++N FPVR YGE+EFW+A +KV AI+G+++Y   IVCG  K GP+GFRYWRNPGPWG 
Sbjct: 182 ITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGSKQGPIGFRYWRNPGPWGD 241

Query: 248 GIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVF 307
           GIIS +  + RFLGW +SLINA+FT+QGTELVGITAGEAANPR+TVPKAI KV FRIL F
Sbjct: 242 GIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKTVPKAINKVFFRILFF 301

Query: 308 YILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGN 367
           YILSLFF+GLLVPY+   L    S ++SSPF+I+I+++GT+ILP IFN V+LVTIISA N
Sbjct: 302 YILSLFFVGLLVPYNHPGLDKHTSVIASSPFVISIQSAGTRILPDIFNAVVLVTIISAAN 361

Query: 368 SNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQW 427
           SNVY+GSR+LF LA  G  PK F+  T  GVP   V+ T+L G LAF+      +E F W
Sbjct: 362 SNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVVDDNANEGFNW 421

Query: 428 LLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIF 487
           L+N+  +AG  +WL IS +HIRFMQCL+ RGISR+DLPFK+K MPY AYYA   + +IIF
Sbjct: 422 LINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVAVIIF 481

Query: 488 FQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXX 547
            QGF AF PKF V  FF  YIS+ L  + +   QL+++CR+  +L               
Sbjct: 482 VQGFQAFCPKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFFNRLEDIDIDSDRREIDAL 541

Query: 548 VWQDTTPANLWGKFWDFVA 566
           +W++  P  LWGKFW  VA
Sbjct: 542 IWEEEEPTTLWGKFWVAVA 560

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/559 (55%), Positives = 401/559 (71%), Gaps = 14/559 (2%)

Query: 21  KSTESLEQH-DLQGNE--DKNTPTTTPSK-------ENVSENEKDEYHE---VKRDLSKR 67
           K   + ++H  LQG    D N+ T + ++        +++E+E++ ++E   VKR L +R
Sbjct: 54  KQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRALKQR 113

Query: 68  HXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTA 127
           H                    PL  +GPVGSLIAY+F+GT+VY VTQSLGEMATFIPVT+
Sbjct: 114 HIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTS 173

Query: 128 SFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVI 187
           S T+FS RFLSPA G +NGYMYWF+WA+T+A+E+SV+GQ+I++WT  VPL AWI+IFWVI
Sbjct: 174 SITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVI 233

Query: 188 LTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGT 247
           +T+ N FPV++YGE EFW+A +KV AI+G++IY   IVCG    GP+GFRYWRNPG WG 
Sbjct: 234 ITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGP 293

Query: 248 GIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVF 307
           GIISS+ +E RFLGW SSLINAAFT+QGTELVGITAGEAANPR+TVP+AI KVVFRI++F
Sbjct: 294 GIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLF 353

Query: 308 YILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGN 367
           YI+SLFFIGLLVPY+D +L + ++ ++SSPF+I+I+N+GT  LP IFN V+L+T++SA N
Sbjct: 354 YIMSLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAAN 413

Query: 368 SNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQW 427
           SNVY+GSR+L+ LA+ G  PK F   T+ GVP   VV T+  G LAF+  +   + AF W
Sbjct: 414 SNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNW 473

Query: 428 LLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIF 487
           L+N+  +AG  +WL IS AHIRFMQ L+ RGISR+DLPFKAK MPY AYYA   + +IIF
Sbjct: 474 LINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIF 533

Query: 488 FQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXX 547
            QGF AF P F V  FF SYIS+ L  + +   Q+++KCR++WKL               
Sbjct: 534 IQGFQAFCP-FKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRREIEAI 592

Query: 548 VWQDTTPANLWGKFWDFVA 566
           +W+D  P NLW KFW  VA
Sbjct: 593 IWEDDEPKNLWEKFWAAVA 611

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/511 (58%), Positives = 375/511 (73%), Gaps = 1/511 (0%)

Query: 56  EYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQS 115
           E   VKR L +RH                    PL  +GPVGSLI+Y+F+GTVVY +TQS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 116 LGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAV 175
           LGEMATFIPVT+S T+FS RFLSPA G ANGYMYWF+WA+T+A+E+SV+GQ+IQ+WT  V
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 176 PLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVG 235
           PL  WI+IFWV++T+ N FPV++YGE EFW+A +KV AI+G++IY   IVCG    GP+G
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIG 282

Query: 236 FRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPK 295
           FRYWRNPG WG GIISS+  E RFLGW SSLINAAFT+QGTELVGITAGEAANPR+TVP+
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 296 AIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFN 355
           AI KVVFRI++FYI+SLFFIGLLVPY++ +L + ++ ++SSPF+I+I+N+GT  LP IFN
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASSPFVISIQNAGTYALPDIFN 402

Query: 356 GVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFM 415
            V+L+T+ISA NSNVY+GSR+L+ LA+ G  PK F   TK GVP   V+ T+  G LAF+
Sbjct: 403 AVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 462

Query: 416 ETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLA 475
             +   + AF WL+N+  +AG  +WL IS AHIRFMQ L+ RGISR+DLPFKAK MPY A
Sbjct: 463 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGA 522

Query: 476 YYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXX 535
           YYA   + +IIF QGF AF P F V +FF SYIS+ L  + +   QL++KCR++WKL   
Sbjct: 523 YYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 581

Query: 536 XXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                       +W+D  P NLW KFW  VA
Sbjct: 582 DIDTDRREIEAIIWEDDEPKNLWEKFWAAVA 612

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/511 (58%), Positives = 376/511 (73%), Gaps = 1/511 (0%)

Query: 56  EYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQS 115
           E   V+R L +RH                    PL  +GPVGSLIAY+F+GTVVY VTQS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 116 LGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAV 175
           LGEMATFIPVT+S T+FS RFLSPA G +NGYMYWF+WA+T+A+E+SV+GQ+I++WT  V
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 176 PLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVG 235
           PL  WI+IFWV++T+ N FPV++YGE EFW+A +KV AI+G++IY   IVCG  K GP+G
Sbjct: 222 PLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIG 281

Query: 236 FRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPK 295
           FRYWRNPG WG GIISS+  E RFLGW SSLINAAFT+QGTELVGITAGEAANPR+TVP+
Sbjct: 282 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 296 AIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFN 355
           AI KVVFRI++FYI+SLFFIGLLVPY D +L + ++ ++SSPF+I+I+N+GT  LP IFN
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASSPFVISIQNAGTYALPDIFN 401

Query: 356 GVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFM 415
            ++L+T+ISA NSNVY+GSR+L+ LA+ G  PK F   TK GVP   V+ T+  G LAF+
Sbjct: 402 AIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 461

Query: 416 ETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLA 475
             +   + AF WL+N+  +AG  +WL IS +HIRFMQ L  RGISR+DLPFKAKFMPY A
Sbjct: 462 VVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGA 521

Query: 476 YYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXX 535
           YYA+  + +IIF QGF +F P F V +FF SYIS+ L  + +   QL++KCR++WKL   
Sbjct: 522 YYASFFVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 580

Query: 536 XXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
                       +W+D  P NLW KFW  VA
Sbjct: 581 DIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/562 (52%), Positives = 391/562 (69%), Gaps = 1/562 (0%)

Query: 5   DINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDL 64
           D + E +   K+ +  K       +++   ++ +         +  E    +   VKR L
Sbjct: 39  DTDMEPSQRKKAAMAGKLFSDQLSYNVSVADNSSAANGDLDLSDTEEAGHVQDTRVKRAL 98

Query: 65  SKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP 124
            +RH                    PL  +GPVG+LIAY+F+G+++Y +TQSLGEMATFIP
Sbjct: 99  KQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQSLGEMATFIP 158

Query: 125 VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIF 184
           VT+S T+FS RFLSPA G  NGYMYWF+WA+T+A+E+SVVGQ+IQ+WT AVPL AWI+IF
Sbjct: 159 VTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWTDAVPLAAWIAIF 218

Query: 185 WVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGP 244
           WV +T+ N FPV++YGE+EFW+A +KV AI+G++IY   IVCG    GP+GFRYWRNPGP
Sbjct: 219 WVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGSSQGPIGFRYWRNPGP 278

Query: 245 WGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRI 304
           WG GIIS ++ E RFLGW SSLINAAFT+QGTELVGITAGEAANPR++VP+AI KVVFRI
Sbjct: 279 WGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRI 338

Query: 305 LVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIIS 364
            +FYI+SLFFIGLLVPY+D  L S +SY++SSPF+I+I+N+GT  LP IFN V+++TIIS
Sbjct: 339 ALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQNAGTYALPDIFNAVVMLTIIS 398

Query: 365 AGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEA 424
           A NSNVY+GSR+L+ LA+ G  PK FA  TK GVP   V+ T+  G LAF+  +   + A
Sbjct: 399 AANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLAFLVVNNNANTA 458

Query: 425 FQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMII 484
           F WL+N+  +AG  +W  I+ +HIRFMQ L+ RGISR+DLPFKAK MP+ AYY+   + +
Sbjct: 459 FNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYSAFFVFV 518

Query: 485 IIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXX 544
           IIF QGF AF P +D   FF SYIS+ L  + +   QL+++CR++ K+            
Sbjct: 519 IIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKVEDIDIDTDRREI 577

Query: 545 XXXVWQDTTPANLWGKFWDFVA 566
              +W+D  P NLW KFW +VA
Sbjct: 578 EAIIWEDDEPKNLWEKFWAWVA 599

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/554 (55%), Positives = 398/554 (71%), Gaps = 12/554 (2%)

Query: 11  TLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHE--VKRDLSKRH 68
           TL  +SK      +S+E  D+Q + +             SE  + ++HE  VKR L  RH
Sbjct: 32  TLSKRSK---AGEDSIELSDVQVSSEL-------YDHAESEEGEGDFHETEVKRALKPRH 81

Query: 69  XXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTAS 128
                               PL +SGPVGSLIAY+F+G+VVY VTQSLGEMATFIPVT+S
Sbjct: 82  VSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSS 141

Query: 129 FTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVIL 188
            T+FS RFLSPA G ANGYMYWF+WA+T+A+ELSV+GQII +WT AVPL AWI+IFWV+L
Sbjct: 142 ITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLL 201

Query: 189 TISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTG 248
           T +N FPV+ YGE EF +A +KV AI+G+++Y   IVCG    GP+GFRYWRNPGPWGTG
Sbjct: 202 TAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGTG 261

Query: 249 IISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFY 308
            I+ N+ +ARFLGW  SL+NA+FT+QGTELVGITAGEA+NPR+TVPKAI KV FRILVFY
Sbjct: 262 TIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFY 321

Query: 309 ILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNS 368
           I SLFF+GLLVPY+  +L+S ++ ++SSPF+I+I+N+GTK+LP IFN V+LVTI+SAGNS
Sbjct: 322 IGSLFFVGLLVPYNSPQLESNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNS 381

Query: 369 NVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWL 428
           NVY+GSR+L+ LA +G  PK F+  TK GVP   V+ T+L G LAF+ T+   + AF WL
Sbjct: 382 NVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWL 441

Query: 429 LNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFF 488
           +N+  +AG  +W  IS AHIRFMQCL+ RGISR+ LPFKAK MP+ AYYA   + +I+F 
Sbjct: 442 INISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFI 501

Query: 489 QGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXV 548
           QGFTAFAP+FDV  FF +YIS+ L  + +   QL+++CR++ K+               +
Sbjct: 502 QGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLYYRCRFLTKIEDIDIDSDRREIDAII 561

Query: 549 WQDTTPANLWGKFW 562
           W+D  P NLW KFW
Sbjct: 562 WEDDEPKNLWEKFW 575

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/567 (53%), Positives = 404/567 (71%), Gaps = 8/567 (1%)

Query: 5   DINTEETLEGKSKIVIKSTESLEQHDLQGNEDK---NTPTTTPSKENVSENEKDEYHE-- 59
           DI  +E +  + K+   ST++ + H + G+  +   N+     ++ + S+  + E HE  
Sbjct: 34  DIVPDEKIRLQ-KLKHVSTQA-DVHSVTGSLTRSRLNSRVDDGAESDGSDELEAEVHETK 91

Query: 60  VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEM 119
           VKR L +RH                    PL ++GPVGSLIAY+F+GT++Y VTQSLGEM
Sbjct: 92  VKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEM 151

Query: 120 ATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPA 179
           ATFIPVT+S T+FS RFLSPA G ANGYMYWF+WA+T+A+E+SV+GQ+IQ+WT AVPL A
Sbjct: 152 ATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAA 211

Query: 180 WISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYW 239
           WI+IFWV++T+ N FPV++YGE+EFWIAF+KV AI+G++IY   IVCG    GP+GFRYW
Sbjct: 212 WIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGSHQGPIGFRYW 271

Query: 240 RNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRK 299
           R+PG +G GIIS N    +FLGW +SLINAAFT+QGTELVGITAGEAANPR+TVP+AI K
Sbjct: 272 RHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINK 331

Query: 300 VVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVIL 359
           VVFRI++FYI+SLFFIG+L+PY+D +L ++++ ++SSPF+I+I+N+ TK+LP IFN V++
Sbjct: 332 VVFRIVLFYIMSLFFIGMLLPYNDKRLSAQDAVIASSPFVISIKNAHTKVLPDIFNAVVM 391

Query: 360 VTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETST 419
           VT++SA NSNVY+GSR+L+ LA  G  PK F+  T+ GVP   VV T+  G LAF+  + 
Sbjct: 392 VTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNN 451

Query: 420 GGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYAT 479
             + AF WL+N+  +AG  +WL IS AHIRFMQ L+ RGISR+DLPFKAK MP+ AYYA 
Sbjct: 452 NANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAA 511

Query: 480 IVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXX 539
             + +IIF QG+ AF P +DV  FF SYIS+ L  +     QL+++ R++ KL       
Sbjct: 512 FFVTVIIFIQGYQAFCP-WDVSTFFTSYISLILLAVLVVGCQLYYRGRFLLKLEDIDIDT 570

Query: 540 XXXXXXXXVWQDTTPANLWGKFWDFVA 566
                   VW+D  P  LW KFW + A
Sbjct: 571 DRREIESIVWEDDEPKTLWDKFWAWAA 597

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/557 (55%), Positives = 382/557 (68%), Gaps = 21/557 (3%)

Query: 20  IKSTESLEQH-DLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXX 78
           IK  ++LE   +LQ      TP T    E+ +E    +  EVKR L  RH          
Sbjct: 18  IKKGKTLENDIELQ----SVTPATGEFPEDHTEEGDYQETEVKRALKARHISMIALGGTI 73

Query: 79  XXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLS 138
                    +PL  +GPVGSL+AY+F+GTVVYS+TQSLGEMATFIPVT+S T+FS RFLS
Sbjct: 74  GTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLS 133

Query: 139 PALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRI 198
           PA G ANGYMYWF+WA+TFA+ELSVVGQIIQ+WT  VP+ AWI IFWV++T+ N FPVR 
Sbjct: 134 PAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRVPIAAWIVIFWVLVTLVNFFPVRF 193

Query: 199 YGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGI------ISS 252
           YGEIEFWIA +KV  I+G++IY F IVCG  K GP+G        P   GI       SS
Sbjct: 194 YGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIGL-------PATGGIPARGARASS 246

Query: 253 NIAEAR--FLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYIL 310
                R  FLGW SSLI AAFT+QGTELVGITAGE+ NPR+ VPKAI KV FRIL FYI 
Sbjct: 247 RTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYIG 306

Query: 311 SLFFIGLLVPYDDVKLKSENSY-VSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSN 369
           SL F+GLLVPYDD +L SE+S  V++SPF+I+I+N+GTKILP IFN V+L+T+ISA NSN
Sbjct: 307 SLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAANSN 366

Query: 370 VYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLL 429
           VYIGSR+ + LA  G  PK  A  TK GVP F V+ TSL G ++F+  +     AF WL+
Sbjct: 367 VYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLV 426

Query: 430 NVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQ 489
           N+  +AG  +WL IS AHIRFMQCL+ RGISR+DLPFKAKFMP+ AYYAT  + +IIF Q
Sbjct: 427 NISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQ 486

Query: 490 GFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVXXXXXXXXXXXXXXVW 549
           G+TAF PKFDV  FF SYIS+FL  + +   Q+++KCR++W +               VW
Sbjct: 487 GYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDSDRREIDAIVW 546

Query: 550 QDTTPANLWGKFWDFVA 566
           ++  P N+W KFW  VA
Sbjct: 547 EEDEPKNIWDKFWSAVA 563

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/520 (56%), Positives = 367/520 (70%), Gaps = 3/520 (0%)

Query: 45  SKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLF 104
           + E  S  EK    +VKR+L  RH                   +P+  +GPVGSL+AY+F
Sbjct: 34  TSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIF 93

Query: 105 LGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVV 164
           + T+ Y VTQSLGEMATFIPVT+SFT+F+ RF+SPALGAANGY+YW SW +TFALE+SV+
Sbjct: 94  VATMAYCVTQSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVI 153

Query: 165 GQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI 224
           G++I +W+ AVP+ AW++IFWV+LT  NL PV+ YGE EFWIA LKV AIL F+ Y   +
Sbjct: 154 GRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVV 213

Query: 225 VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAG 284
           VCG  K G +GFRYW++PGPWG GI+S  I  A+FLGW SSLI AAFTFQGTELVG+TAG
Sbjct: 214 VCGGSKLGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAG 273

Query: 285 EAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYV--SSSPFIIAI 342
           E  NPR+TVPKAI  V FRIL+FYI SL  IGLLV YDD +L  + S    ++SPF++AI
Sbjct: 274 ETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAI 333

Query: 343 ENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFA 402
             +GTK+LP I NGVI+VTIISAGNSN+Y+GSR+L+GL ++G  P   ++TT  GVP  A
Sbjct: 334 NAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVA 393

Query: 403 VVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRN 462
           V+ TS+FGAL ++  S+     F WLL++  V+GFF+WLLIS +HIRFMQCL+ RGISR+
Sbjct: 394 VLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRD 453

Query: 463 DLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQL 522
           DLPFKAKFMPY AYYA   +I+II  QGFTAF P F  ++F A YIS F+F + W  FQ 
Sbjct: 454 DLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQF 512

Query: 523 WFKCRYVWKLVXXXXXXXXXXXXXXVWQDTTPANLWGKFW 562
            FK R+   +               +W D  P  LWGK W
Sbjct: 513 LFKGRWFHTVDEIDIDTDRRDIDAIIWDDDKPTTLWGKIW 552

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/515 (55%), Positives = 365/515 (70%), Gaps = 3/515 (0%)

Query: 54  KDEYHE--VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYS 111
           K ++H+  VKR L  RH                    PL  SGPVGSLIAY+F+G+VVY 
Sbjct: 94  KGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYF 153

Query: 112 VTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW 171
           VTQSLGEMATFIPVT+S T+F+ RFLSPALG +NGYMYWF+WA+TFA ELSV GQIIQ+W
Sbjct: 154 VTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYW 213

Query: 172 TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT 231
           T+ VPL AWI IFWVI+ + N FPV+IYGEIEFW++ +KV AI+G++IY   IVCG  + 
Sbjct: 214 TYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSRQ 273

Query: 232 GPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQ 291
           GP+GFRYWR+   +G G IS N  EARFLGW SSLINAAFT+QGTELVGI+AGEAANPR+
Sbjct: 274 GPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRK 333

Query: 292 TVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILP 351
           TVP+AI KV+FRI +FYILSLFFIGLLVPY+D +L   ++ ++SSPF+I++ N+GT  LP
Sbjct: 334 TVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPFVISMLNAGTSALP 393

Query: 352 HIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGA 411
            IFN VIL+T++SA NS+VYI SR+L+ LA  G  PK F    + GVP   V  T L G 
Sbjct: 394 DIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGW 453

Query: 412 LAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFM 471
           LAF+  S   + AF WL+N+  +AG  +W  I FAHIRFMQ L+ +GISR+DLPFKA+FM
Sbjct: 454 LAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFM 513

Query: 472 PYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWK 531
           P+ AYYA   + +IIF QG+ AF P +D  +FF SYIS+ LF + +    ++++ R + K
Sbjct: 514 PWGAYYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYYRGRLLIK 572

Query: 532 LVXXXXXXXXXXXXXXVWQDTTPANLWGKFWDFVA 566
           +               VW++  P N W KFW  VA
Sbjct: 573 IEDIDIDTDRKEVEAYVWEEDAPRNWWEKFWAAVA 607

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  330 bits (846), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 180/518 (34%), Positives = 296/518 (57%), Gaps = 15/518 (2%)

Query: 27  EQHDLQGNEDKNTPTTTPSKENVSENE------KDEYHEVKRDLSKRHXXXXXXXXXXXX 80
           ++  L  N+  N  T +   E+  + +      KDE+  +++DL  RH            
Sbjct: 47  KKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGT 106

Query: 81  XXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPA 140
                  N L  +GP+   IAY F+G +V+    +LGEMA++IP+   FT ++ R+  PA
Sbjct: 107 GLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPA 165

Query: 141 LGAANGYMYWFSWAMTFALELSVVGQIIQFW--TFAVPLPAWISIFWVILTISNLFPVRI 198
           LG A GY Y   + +    +L+    +IQ+W     V    WI+IF VI+   N   V+ 
Sbjct: 166 LGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKF 225

Query: 199 YGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTGIISSNIAEA 257
           +GE EFW++  KV  ++G II  F I+ G G T   +GFR++ +PG +     S + ++ 
Sbjct: 226 FGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKG 285

Query: 258 RFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGL 317
           +F+ + + L+ A F + G EL GI A EAANPR+++PKAI+  ++RI+VFY++++F +G+
Sbjct: 286 KFVAFVAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345

Query: 318 LVPYDD---VKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGS 374
            V YDD    K K+  +  ++SP+++AI NSG K LPHIFN  +L+ + SA NS++Y+ S
Sbjct: 346 CVAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405

Query: 375 RLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGV 434
           R L+GLA +   PK+FA T + GVP ++++ +S F  LA+M  S+G  + F + +NVV +
Sbjct: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465

Query: 435 AGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF 494
            G  SW+ I   ++ F + ++++ + R+   ++A F PY +Y+     I+I F + FT F
Sbjct: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF 525

Query: 495 -APKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWK 531
               FD  NF   YI + +F I +  ++   K + +WK
Sbjct: 526 LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWK 562

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  326 bits (836), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/538 (34%), Positives = 299/538 (55%), Gaps = 23/538 (4%)

Query: 1   MSILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEV 60
           MS+ ++  +  L  +  I ++   +   +  +  +D N          +S+ ++D    +
Sbjct: 1   MSVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSN---------KISDGKEDGVR-L 50

Query: 61  KRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA 120
           K++L  RH                     L   GP   LIAY F+G +V+ V   LGEMA
Sbjct: 51  KKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMACLGEMA 110

Query: 121 TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW--TFAVPLP 178
           T+IP+   FT ++ R+  PALG A GY Y F + +    +L+    +IQ+W     V   
Sbjct: 111 TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPG 169

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVGFR 237
            WI+IF V++ I N   VR +GE EFW++  K+  + G I++ F I+ G G     +GFR
Sbjct: 170 VWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFR 229

Query: 238 YWRNPG---PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVP 294
           YW+NPG   P+   I  S   + +F+ + +  + A F + G EL GI A EA NPR+ +P
Sbjct: 230 YWKNPGAFKPYSESITGS---KGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIP 286

Query: 295 KAIRKVVFRILVFYILSLFFIGLLVPYDDVKL---KSENSYVSSSPFIIAIENSGTKILP 351
           +AI+  ++RI++FYI+++F +G+ V Y+D +L      ++  ++SPF++AI+NSG + LP
Sbjct: 287 RAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALP 346

Query: 352 HIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGA 411
           HIFN  +L+ + SA NS++Y+G+R L+ LA +G  PKLFAKT + GVP  A+    LF  
Sbjct: 347 HIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCL 406

Query: 412 LAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFM 471
           LA+M  S+G  + F + +NVV + G  SW+ I   +I F +   ++ + RN   ++A F 
Sbjct: 407 LAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQ 466

Query: 472 PYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529
           PY AY      ++I F + FT F  +FD  +F   YI + L+ IF+  +++ +K + V
Sbjct: 467 PYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV 524

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  326 bits (835), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/550 (35%), Positives = 303/550 (55%), Gaps = 35/550 (6%)

Query: 6   INTEETLE-----GKSKIVIKSTESL---EQHDLQ--------GNEDKNTPTTTPSKENV 49
           ++T+E +E     G   IVI+ +  L    Q D +        G++ KN  T T      
Sbjct: 14  VDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHT------ 67

Query: 50  SENEKDEYHE---VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLG 106
             +E D  H+   +K+ L  RH                   + L ++GP   LIAY F+G
Sbjct: 68  --SEFDGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVG 125

Query: 107 TVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQ 166
            +V+ V   LGEMA +IP+   FT +S R+  PALG A GY Y F + +    +L+    
Sbjct: 126 LLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184

Query: 167 IIQFWTF--AVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI 224
           +IQ+W     V    WI+I  V +   N   VR +GEIE++I+ +K+  +LG II    +
Sbjct: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVL 244

Query: 225 VCGAGKTGPV-GFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITA 283
            CG G    V GF+YW+NPG +     +   A+ RF+ +AS  + A F + GTEL GI  
Sbjct: 245 ACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVV 304

Query: 284 GEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDD---VKLKSENSYVSSSPFII 340
            E  NPR+ VPKAI+  ++RI+VFY++S+F +G+ VP++D   +  KS  +  S+SPF++
Sbjct: 305 SECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVV 364

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           AI N+G  +LPHI N  IL+ + SA NS++Y+ SR L+GLA +   P++FAKT K GVP 
Sbjct: 365 AIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPY 424

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
           ++++   LF  LA+M  S+G  E F + +N V + G  SW+ I   +IRF +  + +GI 
Sbjct: 425 WSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGID 484

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGS 519
           ++ L +++   PY A+++    I+I   + F AF    FD  +F   YI +  + I +  
Sbjct: 485 KSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIG 544

Query: 520 FQLWFKCRYV 529
           ++LW+K + +
Sbjct: 545 YKLWYKTKII 554

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  318 bits (814), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/512 (36%), Positives = 292/512 (57%), Gaps = 13/512 (2%)

Query: 30  DLQGNE--DKNTPTTTPSKENVS---ENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXX 84
           DL+ N    +++  T+PS  + S    + KDE   +++DL  RH                
Sbjct: 46  DLEENNVSSRSSTFTSPSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLI 105

Query: 85  XXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAA 144
                LM  GPV  LIAY F+G +V+     LGEMA++IP+   FT ++ R++ PALG A
Sbjct: 106 GTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPLDG-FTSYASRYVDPALGFA 164

Query: 145 NGYMYWFSWAMTFALELSVVGQIIQFWTFA--VPLPAWISIFWVILTISNLFPVRIYGEI 202
            GY Y F + +    +L+    +IQ+W     V    WI+IF V++   N+  V+ +GE 
Sbjct: 165 IGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEF 224

Query: 203 EFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVGFRYWRNPGPWGTGIISSNIAEARFLG 261
           EFW++  KV  +LG I+  F I+ G G     +GFRYWR+PG +     +    + +F+ 
Sbjct: 225 EFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVS 284

Query: 262 WASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPY 321
           + +  + + F++ G EL GI   EA NPR++VPKAI+  V+RI+VFY+ ++F +G+ V Y
Sbjct: 285 FLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAY 344

Query: 322 DDVKL---KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLF 378
           +D +L   K +    ++SPF++AI+NSG K+LPHIFN  +LV + SA NS++Y+ SR L+
Sbjct: 345 NDPRLISTKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLY 404

Query: 379 GLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFF 438
            LA +G  PK+F+KT K GVP  A++F+ LF  LA+M  S G  + F + +NVV + G  
Sbjct: 405 ALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGIL 464

Query: 439 SWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF-APK 497
           SW+ I   +I F +  +++GI ++   + A    Y AY+A +  I I   + FT F   K
Sbjct: 465 SWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHK 524

Query: 498 FDVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529
           FD   F   YI + ++   W  ++L +K + +
Sbjct: 525 FDYKTFITGYIGLPVYVFSWVGYKLIYKTKVI 556

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  317 bits (812), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/526 (33%), Positives = 298/526 (56%), Gaps = 15/526 (2%)

Query: 12  LEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXX 71
           L+ +S  V  S++ LEQ+ +     +N+   +    ++ ++ K E   +K++L  RH   
Sbjct: 20  LQKQSDQVTISSD-LEQNSISIASSRNS---SIGDRDIFDDGKTEGFRLKKNLKARHVSM 75

Query: 72  XXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTI 131
                             L  +GP    I Y F+G +V+     LGEMA FIP+   FT 
Sbjct: 76  IAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEMAAFIPLDG-FTS 134

Query: 132 FSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP--AWISIFWVILT 189
           ++ R++ PALG A GY Y   + +  A +L+    ++Q+W     L    +I+IF +++ 
Sbjct: 135 YASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLNPGVFITIFLILIV 194

Query: 190 ISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPG---PW 245
             N+F V+I+GE EFW++  KV  +LG I+  F I+ G G     +GFRYWR+PG   P+
Sbjct: 195 TINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLGFRYWRDPGSFKPY 254

Query: 246 GTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRIL 305
            + IIS + +  +F+ + S  + A F + G EL GI A EA NPR+ +PKAI+  ++RI+
Sbjct: 255 SSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKNIPKAIKLTMYRII 314

Query: 306 VFYILSLFFIGLLVPYDD---VKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTI 362
           +FY++++  + + V Y+D   +K   +++  ++SPF++AIENSG  ILPHIFN  +L  +
Sbjct: 315 IFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINILPHIFNVCVLAFV 374

Query: 363 ISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGD 422
           +SA NS++Y+ SR L+ LA +   PK F KT K G+P +++ F++ F  LA+M  S+   
Sbjct: 375 LSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAFSCLAYMNVSSSAS 434

Query: 423 EAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVM 482
             F + +N V + G  SW+ I   +I F +  +++G+ +++  + A + PY AY+A    
Sbjct: 435 NVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAPWQPYGAYFALFFC 494

Query: 483 IIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWFKCR 527
            ++   + FT F   +FD  NF   YI + +FFI +  +++ +K +
Sbjct: 495 CVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVYKTK 540

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  317 bits (812), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/538 (35%), Positives = 293/538 (54%), Gaps = 37/538 (6%)

Query: 28  QHDLQGNEDKNTPTTTPSKE------NVSENE-----------------------KDEYH 58
            +D  G   K  P   P KE      ++ EN                        KDE  
Sbjct: 19  DNDRDGYSMKQNPDKFPVKEQEIYNIDLEENNVSSRSSTSTSPSARDDSFAVPDGKDETT 78

Query: 59  EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118
            +++DL  RH                     L+  GPV  LIAY F+G +V+     LGE
Sbjct: 79  RLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTMACLGE 138

Query: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFA--VP 176
           MA++IP+   FT ++ R++ PALG A GY Y F + +    +L+    +IQ+W     V 
Sbjct: 139 MASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVN 197

Query: 177 LPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVG 235
              WI+IF V++   N+  VR +GE EFW++  KV  +LG I+  F I+ G G     +G
Sbjct: 198 PGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRLG 257

Query: 236 FRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPK 295
           FRYWR+PG +     +   ++ +F+ +AS  + + F++ G EL GI   EA NPR++VPK
Sbjct: 258 FRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNPRKSVPK 317

Query: 296 AIRKVVFRILVFYILSLFFIGLLVPYDDVKL---KSENSYVSSSPFIIAIENSGTKILPH 352
           AI+  V+RI+VFY+ ++F +G+ V Y+D +L   K +    ++SPF++AI+NSG K+LPH
Sbjct: 318 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSGIKVLPH 377

Query: 353 IFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGAL 412
           IFNG +LV + SA NS++Y+ SR L+ LA +G  PK+FAKT+K GVP +A++ + LF  L
Sbjct: 378 IFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVSVLFCCL 437

Query: 413 AFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMP 472
           A+M  S G  + F + +NVV + G  SW+ I   +I F +  +++G+ ++   + A    
Sbjct: 438 AYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAYVAPGQR 497

Query: 473 YLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529
           Y AY+A    I+I   + FT F    FD   F   YI + ++   W  ++L +K + V
Sbjct: 498 YGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYKTKVV 555

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  313 bits (802), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 179/529 (33%), Positives = 286/529 (54%), Gaps = 23/529 (4%)

Query: 14  GKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXX 73
           G++ IV K T  + + D +     NT          SE++K E H +K+ L  RH     
Sbjct: 11  GQTSIVDKQTGQVFELDTESLSALNT--------GGSESQKREPHTLKQGLQSRHIQLIA 62

Query: 74  XXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTA-----S 128
                         + L   GP G L +Y+ +  V+Y V  +LGEM  ++P +      S
Sbjct: 63  LGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGS 122

Query: 129 FTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVIL 188
            +    R+  P+LG A G+ Y++ + +  A E +    ++ +WT  VP  AWI+IF  ++
Sbjct: 123 ISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTVVPKAAWITIFLGVV 182

Query: 189 TISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT-GPVGFRYWRNPGPWGT 247
           T+ N  PV+ YGE EFW A LK+  I+G +   F +  G G +   +GFRYW+ PG +  
Sbjct: 183 TMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAFAY 242

Query: 248 GIISSNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRILV 306
            I + N    RFL   + +I   F F  G ELV +T+ EA + R+ + KA R+  +R++ 
Sbjct: 243 HITTGN--TGRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIF 300

Query: 307 FYILSLFFIGLLVPYDDVKLK----SENSYVSSSPFIIAIENSGTKILPHIFNGVILVTI 362
           FY+ S   IG++V  +D  L+    S  +  +SSPF+IAI+N+  KILPHI N  IL + 
Sbjct: 301 FYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIKILPHIINACILSSA 360

Query: 363 ISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGD 422
            S+GNS ++  SR L  +A++G  PK+F K  ++GVP  AV  ++ F  LA++  S+G  
Sbjct: 361 WSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSA 420

Query: 423 EAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVM 482
           +AF W  N+  ++GF  W+ I  A++RF + +  RG+  + +PFK+ F PY  Y+  IV+
Sbjct: 421 KAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKSPFQPYGTYFFIIVV 479

Query: 483 IIIIFFQGFTAFAPKF-DVLNFFASYISVFLFFIFWGSFQLWFKCRYVW 530
            II    G+  F P+F    +F A+YI++ +F + W   +++ +    W
Sbjct: 480 SIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVGHKIYTRTLSTW 528

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  314 bits (804), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 177/485 (36%), Positives = 282/485 (58%), Gaps = 8/485 (1%)

Query: 52  NEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYS 111
           + KDE   +++DL  RH                     L+  GPV  LIAY F+G +V+ 
Sbjct: 74  DGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFY 133

Query: 112 VTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW 171
               LGEMA++IP+   FT ++ R++ PALG A GY Y F + +    +L+    +IQ+W
Sbjct: 134 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192

Query: 172 --TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG 229
                V    WI+IF V++   N+  V+ +GE EFW++  KV  +LG I+  F I+ G G
Sbjct: 193 ISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGG 252

Query: 230 KT-GPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAAN 288
                +GFRYWR+PG +     +    + +F+ + +  + + F++ G EL GI   EA N
Sbjct: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312

Query: 289 PRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL---KSENSYVSSSPFIIAIENS 345
           PR++VPKAI+  V+RI+VFY+ ++F +G+ V Y+D +L   K ++   ++SPF++AI+NS
Sbjct: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372

Query: 346 GTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVF 405
           G ++LPHIFN  +LV + SA NS++Y+ SR L+ LA +G  PK+FAKT++ GVP  A++ 
Sbjct: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432

Query: 406 TSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLP 465
           + LF  LA+M  S+G  + F + +NVV + G  SW+ I   +I F +  +++GI ++   
Sbjct: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492

Query: 466 FKAKFMPYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWF 524
           + A    Y AY+A    I+I   + FT F   KFD   F   YI + ++ I W  ++L +
Sbjct: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552

Query: 525 KCRYV 529
           K + +
Sbjct: 553 KTKVI 557

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  314 bits (804), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 184/537 (34%), Positives = 300/537 (55%), Gaps = 22/537 (4%)

Query: 10  ETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENE----KDEYHEVKRDLS 65
            T+  K     + T S    +++   D+++ +   S  +V  +E    K E   +K+ L 
Sbjct: 11  STISPKGDNAKEVTASKLALNIEVQSDQSSKSLCDSASDVLASEIGDGKYEGIRLKKQLK 70

Query: 66  KRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPV 125
            RH                     L ++GPV +LIAY F+G +V+     LGEMATFIP+
Sbjct: 71  SRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEMATFIPL 130

Query: 126 TASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPA-----W 180
              FT ++ R+  PALG A GY Y   + +    +L+    ++Q+W   VP        W
Sbjct: 131 DG-FTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYW---VPRDTVNPGIW 186

Query: 181 ISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYW 239
           +++ + ++T+ N+F VR +GE EFW++ LKV  ++G II  F I+ G AG    +GFRYW
Sbjct: 187 VTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLGFRYW 246

Query: 240 RNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRK 299
           ++PG +       + +  +F+ + + L+   F + G EL GI A EA+NPR++VPKAI+ 
Sbjct: 247 KHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPKAIKL 306

Query: 300 VVFRILVFYILSLFFIGLLVPYDDVKL--KSENSYVSSSPFIIAIENSGTKILPHIFNGV 357
             +RILVFY++S+F +G+ VPY+D KL   +ENS +++SPF IAI N+G  +LP IFNG 
Sbjct: 307 TFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENS-LTASPFSIAILNAGITVLPDIFNGC 365

Query: 358 ILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMET 417
           +L+ + SA NS++Y+ SR L+ LA +   PK+FA T + G+P  ++  + LF  LA+M  
Sbjct: 366 LLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAYMTV 425

Query: 418 STGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYY 477
           S+   + F++ +NVV +AG  +W+ I   +I F + ++++ + ++   + A F PY AY 
Sbjct: 426 SSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPYGAYV 485

Query: 478 ATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFK-----CRYV 529
           +     +I   + FT F   FD   F   YI + +F + +  +++  K      RYV
Sbjct: 486 SLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITCKSEIRSARYV 542

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  311 bits (798), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 184/529 (34%), Positives = 300/529 (56%), Gaps = 20/529 (3%)

Query: 1   MSILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEV 60
           MS +  +  + LE   KIV  S  +    D++  +  N    +  + +++ + K +   +
Sbjct: 1   MSFIQDSYRKDLE---KIV--SNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRL 55

Query: 61  KRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA 120
           K++L  RH                     L ++GPV  LIAY F+G +VY V   LGEMA
Sbjct: 56  KKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMA 115

Query: 121 TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTF--AVPLP 178
           T+IP+   FT ++ R+  PALG A GY Y F + +    +L+    ++Q+W     V   
Sbjct: 116 TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPG 174

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFR 237
            WI+IF VI+   N+  V+ +GE EFW++  KV  +L  I+  F I+ G G +   +GFR
Sbjct: 175 VWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFR 234

Query: 238 YWRNPG---PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVP 294
           ++++PG   P+   I  S   + +F+ + +  + A F + GTEL GI A E  NPR+ VP
Sbjct: 235 FYKDPGAFRPYSEAISGS---KGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVP 291

Query: 295 KAIRKVVFRILVFYILSLFFIGLLVPYDD---VKLKSENSYVSSSPFIIAIENSGTKILP 351
           +AI+  ++RI+VFY++++F +G+ V Y+D   ++ K +++  ++SPF++AI+N+G  +LP
Sbjct: 292 RAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLP 351

Query: 352 HIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGA 411
           HIFN  +L+ + SA NS++Y+ SR L+GLA +   PK+FAKT K GVP  +++   LF  
Sbjct: 352 HIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCL 411

Query: 412 LAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFM 471
           LA+M  S+G  + F + +NVV + G  SW+ I   +I F + L+++G+ ++ L + A   
Sbjct: 412 LAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLA 471

Query: 472 PYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFI-FWG 518
              AY+A     +I   + FT F   KFD  NF   YI + +F I F+G
Sbjct: 472 SKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFG 520

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  312 bits (800), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 178/485 (36%), Positives = 281/485 (57%), Gaps = 8/485 (1%)

Query: 52  NEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYS 111
           + KDE   +K++L  RH                     L+  GPV  LIAY F+G +V+ 
Sbjct: 72  DGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFF 131

Query: 112 VTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW 171
               LGEMA++IP+   FT ++ R++ PALG A GY Y F + +    +L+    +IQ+W
Sbjct: 132 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 190

Query: 172 --TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG 229
                V    WI+IF V++   N+  V+ +GE EFW++  KV  +LG I+  F I+ G G
Sbjct: 191 ISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGG 250

Query: 230 -KTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAAN 288
                +GFRYWR+PG +     +   +  +F  + +  + + F++ G EL GI   EA N
Sbjct: 251 PDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAEN 310

Query: 289 PRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL---KSENSYVSSSPFIIAIENS 345
           PR++VPKAI+  V+RI+VFY+ ++F +G+ V Y+D +L   K ++   ++SPF++AI+NS
Sbjct: 311 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 370

Query: 346 GTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVF 405
           G K+LPHIFN  +LV + SA NS++Y+ SR L+ LA +G  PK+FAKT+K GVP  A++ 
Sbjct: 371 GIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALIL 430

Query: 406 TSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLP 465
           + LF  LA+M  S+G  + F + +NVV + G  SW+ I   +I F +  +++GI ++   
Sbjct: 431 SVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 490

Query: 466 FKAKFMPYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWF 524
           + A    Y AY+A    I+I   + FT F   KFD   F   YI + ++ + W  ++L +
Sbjct: 491 YVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIY 550

Query: 525 KCRYV 529
           K + +
Sbjct: 551 KTKVI 555

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  312 bits (800), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 179/525 (34%), Positives = 288/525 (54%), Gaps = 18/525 (3%)

Query: 21  KSTESLEQHDLQGNEDKNTPTTTPSKE------NVSENEKDEYHEVKRDLSKRHXXXXXX 74
           K       +DL+ N+     T            NV +  KD+   +K+DL  RH      
Sbjct: 38  KKDNGTVAYDLEVNDQTRQNTLDDDASADSDGYNVMDG-KDDGTRLKKDLKARHISMIAI 96

Query: 75  XXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSH 134
                          L  +GP   LIAY F+GT+V+    +LGEMA +IP+   FT ++ 
Sbjct: 97  GGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAALGEMAAYIPLDG-FTSYAS 155

Query: 135 RFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTF--AVPLPAWISIFWVILTISN 192
           R+  PALG A GY Y F + +    +L+    +IQ+W     V    WI+IF V++   N
Sbjct: 156 RYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRDTVNPGVWITIFLVVIIAIN 215

Query: 193 LFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVGFRYWRNPG---PWGTG 248
              V+ +GE EFW++  K+  ++G +I+ F I+ G G     +GFRYW+ PG   P+ + 
Sbjct: 216 TIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLGFRYWKTPGAFKPYSSS 275

Query: 249 IISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFY 308
           +++   +  +F+ + +  + A F + G EL GI A EA NPR+ +P+AI+  V+RIL FY
Sbjct: 276 VVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTVWRILFFY 335

Query: 309 ILSLFFIGLLVPYDDVKL---KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISA 365
           + ++F +G+ V YDD  L    +  +  ++SPF++AI+NSG  +LPHIFN  +L+ + SA
Sbjct: 336 VATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSGVDVLPHIFNVCVLMFVFSA 395

Query: 366 GNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAF 425
            NS++Y+G+R L+ LA +G  PK+FAKT + GVP  A+    LF  LA+M  S+G  E F
Sbjct: 396 CNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGCVLFCLLAYMNVSSGSAEIF 455

Query: 426 QWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIII 485
            + +NVV + G  SW  I    I F + ++++GI R+   + A F PY +Y+A    +++
Sbjct: 456 NYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAYVAPFQPYGSYFALFFCVLL 515

Query: 486 IFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529
              + F+ F   +FD   F   YI + ++   +  ++L++K + V
Sbjct: 516 ALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKLYYKTKTV 560

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  311 bits (798), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 185/550 (33%), Positives = 307/550 (55%), Gaps = 19/550 (3%)

Query: 1   MSILDINTEETLEGK-------SKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSE-- 51
           M+I ++ TEET   +        K V   T   ++ +L  ++ +N  + + S E+ ++  
Sbjct: 1   MTIREVLTEETTSDRYEEYFDPQKKVDSKTFPTQERELLHDDLENNISLSTSAEDQNDSY 60

Query: 52  --NEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVV 109
             + K E   +K+ L  R                    N L  +GPV  LIAY F+G +V
Sbjct: 61  NVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLV 120

Query: 110 YSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQ 169
           +    SLGEMA++IP+   FT ++ R+  PALG A GY Y F + +    +L+    +IQ
Sbjct: 121 FFTMASLGEMASYIPLDG-FTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQ 179

Query: 170 FW--TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG 227
           +W     V    WI+IF V++   N   V+ +GE EFW++  KV  +   II  F ++ G
Sbjct: 180 YWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLG 239

Query: 228 AGKT-GPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEA 286
            G     +GFR+W++PG +     +      +F+ + S  + A F + GTELVGI  GEA
Sbjct: 240 GGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEA 299

Query: 287 ANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDD---VKLKSENSYVSSSPFIIAIE 343
            NPR++VPKAI+  ++RI++FY++S+  +G+ V YDD   ++ K++++  ++SPF++AI 
Sbjct: 300 RNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIV 359

Query: 344 NSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAV 403
           NSG K+LPHIFN  +LV + SA NS++Y+ SR L+ LA +   PK+FA+T + G+P +++
Sbjct: 360 NSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSL 419

Query: 404 VFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRND 463
             + LF  LA+M  S+G  + F + +NVV + G  SW+ I   ++ F + ++++GI ++ 
Sbjct: 420 GLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKST 479

Query: 464 LPFKAKFMPYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQL 522
             + A    Y AY+A     +I   + FT F   +FD   F   YI + +FFI +  ++L
Sbjct: 480 FSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKL 539

Query: 523 WFKCRYVWKL 532
            +K + +  L
Sbjct: 540 IYKTKIIDPL 549

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  308 bits (788), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 187/536 (34%), Positives = 304/536 (56%), Gaps = 23/536 (4%)

Query: 6   INTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSE--NEKDEYHEVKRD 63
           +N++ ++E K+  V+ S E+LE       E   T  +     +VSE  + K E   +K++
Sbjct: 1   MNSDTSMEKKNAGVLYSNETLE-------EGIVTLESEGQVRSVSEGVDGKHEGIRLKKE 53

Query: 64  LSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFI 123
           L  RH                   + L  +GPV  LI+Y F+G +VY+V   LGEMA FI
Sbjct: 54  LEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFI 113

Query: 124 PVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFA--VPLPAWI 181
           P+   FT ++ R++ PA+G A GY Y F + +    +L+    ++QFW     V    WI
Sbjct: 114 PLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWI 172

Query: 182 SIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT-GPVGFRYWR 240
           +IF  ++ + N   VR +GE EFW++ +KV  +LG I+  F I+ G G      GFR+WR
Sbjct: 173 TIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWR 232

Query: 241 NPG---PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAI 297
           +PG   P+   I  S   + +F+ +AS    A F + GTEL GI A EA NPR++VP+AI
Sbjct: 233 DPGAFKPYSEAISGS---KGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAI 289

Query: 298 RKVVFRILVFYILSLFFIGLLVPYDD---VKLKSENSYVSSSPFIIAIENSGTKILPHIF 354
           +  ++RI+VFY++++  +G+ V Y+D   +K K   +  ++SPF++AIEN+   +LPHIF
Sbjct: 290 KLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIF 349

Query: 355 NGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAF 414
           N  +LV + SA NS++Y+ SR L+GLA +G  P++FA T K GVP +++  + LF  LA+
Sbjct: 350 NVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAY 409

Query: 415 METSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYL 474
           M  S+G  + F + +NVV + G  SW+ I   +IRF + ++ +   ++ L + A F P+ 
Sbjct: 410 MNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWS 469

Query: 475 AYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529
            Y A     +I   + +T F   KFD   F + YI + ++ I +  +++ ++ + +
Sbjct: 470 TYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLI 525

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  308 bits (789), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 171/480 (35%), Positives = 277/480 (57%), Gaps = 14/480 (2%)

Query: 60  VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEM 119
           +K++L  RH                     L  +GP    IAY F+G +V+    ++GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 120 ATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW--TFAVPL 177
           A++IP+   FT ++ R++ PALG A GY Y F + +    +L+    +IQ+W     V  
Sbjct: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217

Query: 178 PAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVGF 236
             WI+IF V++ I N+  V+ +GE EFW++  KV  +LG I+  F ++ G G     +GF
Sbjct: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGF 277

Query: 237 RYWRNPG---PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTV 293
           RYW++PG   P+   I  S     +F+ + S  + A F + G EL GI A EA NPR++V
Sbjct: 278 RYWQHPGAFKPYSDAIDGS---VGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSV 334

Query: 294 PKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL---KSENSYVSSSPFIIAIENSGTKIL 350
           P+A++  V+RI++FY++++F +G+ V Y+D +L   K   +  ++SPF++AI+NSG ++L
Sbjct: 335 PRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVL 394

Query: 351 PHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFG 410
           PHIFN  +L+ + SA NS++Y+GSR L+ LA +G  P +F +TT  G+P +++    LF 
Sbjct: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454

Query: 411 ALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKF 470
            LA+M  S+G  + F + +NVV + G  SW+ I   +I FM+ ++ +G+ R+   + A F
Sbjct: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514

Query: 471 MPYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529
            PY  Y++    + I F + FT F    FD  NF   YI + +F IF+  ++   K + V
Sbjct: 515 QPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV 574

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  306 bits (784), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 180/526 (34%), Positives = 280/526 (53%), Gaps = 12/526 (2%)

Query: 11  TLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXX 70
           +LE K +  +   E     +++ NE+    + +  +   S+   D  H +K+ LS RH  
Sbjct: 2   SLEIKKEASVSKQEFNGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQ 61

Query: 71  XXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFT 130
                            + L   GP    ++++ + T+VY +  +L EM  ++P   S  
Sbjct: 62  LIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVP 121

Query: 131 IFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTI 190
               R++ P+LG A G+ Y +S+AM  A EL+    I+++WT  VP   WI+IF +++ +
Sbjct: 122 ELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVV 181

Query: 191 SNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIV-CGAGKTGPVGFRYWRNPGPWGTGI 249
            N   VR YGE EFW A LK+  IL  ++    I   GA     VGFRYWRNPG +G  I
Sbjct: 182 LNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHI 241

Query: 250 ISSNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRILVFY 308
              N+   RFL   +++I +AF F    ELVG+   EA + R+ + KA R+ ++RI+ FY
Sbjct: 242 TGGNLG--RFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFY 299

Query: 309 ILSLFFIGLLVPYDD----VKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIIS 364
           + S   IG++V  +D    + L+      +SSPF+  I NSG  +L H+ N  IL +  S
Sbjct: 300 LSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWS 359

Query: 365 AGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEA 424
           AGNS  Y  SR +  L+K G  PK+F+K  + GVP  AV   SL   LA++  S+   + 
Sbjct: 360 AGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKV 419

Query: 425 FQWLLNVVGVAGFFSWLLISFAHIRFMQC-LQSRGISRNDLPFKAKFMPYLAYYATIVMI 483
           FQWL N+  ++GF  W LI  A+IRF +  L +R + R  +P+++   P+ AY+ TIV+ 
Sbjct: 420 FQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRLLDR--IPYRSPLQPFSAYFFTIVVA 477

Query: 484 IIIFFQGFTAFAP-KFDVLNFFASYISVFLFFIFWGSFQLWFKCRY 528
           II    G+  F   ++D  +F  SYIS+ +F  F+   +  +K R+
Sbjct: 478 IITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRF 523

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  307 bits (786), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 177/512 (34%), Positives = 290/512 (56%), Gaps = 10/512 (1%)

Query: 27  EQHDLQGNEDKNTPTTTPSKENVSEN--EKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXX 84
           E+  +  + ++N  + +   EN S N   K E   +K+ L  RH                
Sbjct: 33  EEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLI 92

Query: 85  XXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAA 144
                L ++GPV +LIAY F+G +V+     LGEMAT+IP+   FT ++ R+  PALG A
Sbjct: 93  GTGTSLALAGPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDG-FTSYASRYCDPALGFA 151

Query: 145 NGYMYWFSWAMTFALELSVVGQIIQFWTFA--VPLPAWISIFWVILTISNLFPVRIYGEI 202
            GY Y F + +    +L+    +IQ+W     V    W++IF V++   N+F VR +GE 
Sbjct: 152 VGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEF 211

Query: 203 EFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVGFRYWRNPGPWGTGIISSNIAEARFLG 261
           EFW++  KV  +LG ++  F ++ G G     +GFRYWR+PG +     +      RF+ 
Sbjct: 212 EFWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVA 271

Query: 262 WASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPY 321
           + S  + A + + G EL GI A EA NPR+++PKAI+  ++RI++FY++S+F +G+ V Y
Sbjct: 272 FVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAY 331

Query: 322 DD---VKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLF 378
           DD   +K K+ ++  ++SPF++AI NSG   LPHI N  +LV + SA NS++Y+ SR L+
Sbjct: 332 DDPLLIKAKNSSTSAAASPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLY 391

Query: 379 GLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFF 438
            LA +   PK+FAKT + G+P +A+  + LF  LA+M  S+   + F + +NVV + G  
Sbjct: 392 SLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGIL 451

Query: 439 SWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF-APK 497
           SW+ I   +I F + ++++G+ ++   + A F PY A+++     +I   + FT F   +
Sbjct: 452 SWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQ 511

Query: 498 FDVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529
           FD  NF   YI + +FF  +  ++  +K + +
Sbjct: 512 FDYKNFITGYIGLPVFFFCYFGYKFTYKTKVI 543

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  301 bits (771), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 169/504 (33%), Positives = 271/504 (53%), Gaps = 14/504 (2%)

Query: 35  EDKNT-----PTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNP 89
           E KNT     PT + S  +  E        + R+LS                        
Sbjct: 3   EIKNTVTVVEPTLSDSASSRDEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTA 62

Query: 90  LMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMY 149
           L   GP+   +AYLF G+++  V  SL EMA F P+   F+ +  +++ PA G A G+ Y
Sbjct: 63  LARGGPISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNY 122

Query: 150 WFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFL 209
           +  +A+  +  L+  G +I +W   + +  W+++ +    + N   VR +G++E ++   
Sbjct: 123 FLKYAIVLSANLTAFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVA 182

Query: 210 KVNAILGFIIYCFCIVCGAG-KTGPVGFRYWRNPG--PWGTGIISSNIAEARFLGWASSL 266
           K+  +L   I C  I CG G     +GFRYWR  G  P+   ++  N    +FLGW + +
Sbjct: 183 KLTILLLIFIVCLVITCGGGPDHTTIGFRYWRESGFLPY---LVKGN--TGKFLGWWACV 237

Query: 267 INAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLV-PYDDVK 325
           I + F F G+E++GI  GE ANPR+T+PKA R V+ RI VFYI  +F +GL V P++   
Sbjct: 238 IQSIFGFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKL 297

Query: 326 LKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGT 385
           + + ++  ++SPF+IAI  SG K+LP   N  +LV I S+  +++YI SR L+GLAK+G 
Sbjct: 298 VHAHSTDANASPFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGA 357

Query: 386 GPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISF 445
            PK+F +  K  +P+   V  SL G LA+M T       F ++ + V V G  +W  I  
Sbjct: 358 APKIFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILV 417

Query: 446 AHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFA 505
           A+I + + ++S G+  +++PF+  F PY AY A   + +I FF G++AF  KF+   F  
Sbjct: 418 AYIHYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFIT 477

Query: 506 SYISVFLFFIFWGSFQLWFKCRYV 529
           SYI +F   +    ++L++K ++V
Sbjct: 478 SYIGIFANVLLVLGYKLYYKTKWV 501

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  300 bits (769), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 172/503 (34%), Positives = 267/503 (53%), Gaps = 13/503 (2%)

Query: 35  EDKNTPTTTPSKENVSENEKDEYHE----VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPL 90
           E K T           E E +E  E    + R+L  R                    + L
Sbjct: 3   EKKGTVVLERPASGEDECESEEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSAL 62

Query: 91  MISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYW 150
              GP+   IAYLF G+++  V  SL EMA+F P+   F+ + +R++ PA G A G+ Y+
Sbjct: 63  AKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYF 122

Query: 151 FSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLK 210
             +A+  +  L+  G +I +W   V +  W+++ +V +   N   V+ +GEIE  +   K
Sbjct: 123 LKYAIVLSANLTAFGLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFK 182

Query: 211 VNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPG--PWGTGIISSNIAEARFLGWASSLI 267
           +  ++   I C  I CG A      GFRYWR  G  P+  G         +FLGW + ++
Sbjct: 183 LLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPYLVGG-----GTGKFLGWWACVV 237

Query: 268 NAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLV-PYDDVKL 326
            + F F G+E++GI  GE ANP++T+PK+   V FRI   Y+  +F +GL + P +   +
Sbjct: 238 QSIFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLV 297

Query: 327 KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTG 386
            + ++  ++SPF+IAI +SG K+LP+  N  +LV IIS+ N+++YI SR L+GLAK+G  
Sbjct: 298 HAHSTDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAA 357

Query: 387 PKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFA 446
           PK+F    +  VPV   V  SL G LA+M T       F ++ + V V G  +W  I  A
Sbjct: 358 PKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIA 417

Query: 447 HIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFAS 506
           +I + + ++++GIS +D+PF+  F PY AY     + II FF G+ AF  KF    F  S
Sbjct: 418 YINYDRAIKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITS 477

Query: 507 YISVFLFFIFWGSFQLWFKCRYV 529
           YI VF   +    ++L+FK ++V
Sbjct: 478 YIGVFANILMVIGYKLYFKTKFV 500

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  301 bits (771), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 175/547 (31%), Positives = 284/547 (51%), Gaps = 30/547 (5%)

Query: 4   LDINTEETLEGKSKIVIKSTESLEQHDLQ-----------------GNEDKNTP-TTTPS 45
           L  N    + G S      T+ LE+  +Q                  N  K  P +  P 
Sbjct: 22  LKENNPGAVVGSSDFTNNETDYLEKTSVQNSGFEYLENEGNLFRRFANSFKRAPGSNNPD 81

Query: 46  KENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFL 105
           KE+ S+      +++K+ +  RH                     L   GP G +I Y  +
Sbjct: 82  KEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIM 141

Query: 106 GTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVV 164
           G+ +Y + Q+ GE+A  +  ++  F  +    + PALG +  ++Y   W     LEL   
Sbjct: 142 GSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTA 201

Query: 165 GQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI 224
              I++WT +V    +++IF+V++   N+F  R Y E EF+    KV  I GF+I    +
Sbjct: 202 SITIKYWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIV 261

Query: 225 VCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITA 283
            CG AG  G +G +YW +PG +     S +     F G  S+L+ AAF F  TE + +TA
Sbjct: 262 NCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTA 316

Query: 284 GEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAI 342
            E ANPR+++P A +K+++RILV Y+ S+  IG LVP++  +L  S  S   +SP++IAI
Sbjct: 317 AEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAI 376

Query: 343 ENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFA 402
            + G K++PH+ N VIL+++IS GNS  Y  SRLL  LA+ G  P       + G P  A
Sbjct: 377 ASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLA 436

Query: 403 VVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRN 462
           +V +S+FG ++F+  S   +  F WLL + G++  F+W  I  +HIRF + ++ +G S  
Sbjct: 437 MVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLG 496

Query: 463 DLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWG 518
           +L FK++   + +YYAT +M++I+  Q +TA AP    K D   FF +Y+++ +    + 
Sbjct: 497 ELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYF 556

Query: 519 SFQLWFK 525
            +++W +
Sbjct: 557 GYKVWKR 563

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  298 bits (764), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 185/577 (32%), Positives = 298/577 (51%), Gaps = 26/577 (4%)

Query: 4   LDINTEETLE--GKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVK 61
           L ++T   L+  G++ IV K T  + + D    E  +   T+ S  + +     E + +K
Sbjct: 50  LAMSTPRDLKDAGETSIVDKQTGQVFELD---TESLSALNTSGSPGSGAAAAGAEANGLK 106

Query: 62  RDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT 121
           + L  RH                   + L   GP G L +Y+ +  V+Y V  SLGEM  
Sbjct: 107 KGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEMVC 166

Query: 122 FIPVT-----ASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVP 176
           F+P +      S +    R+  P+LG A G+ Y++ + +  A E +    ++ +WT AVP
Sbjct: 167 FLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTAVP 226

Query: 177 LPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VG 235
             AWI+IF  ++T+ N  PV+IYGE EFW A LK+  I+G +   F +  G G T   +G
Sbjct: 227 KGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDRLG 286

Query: 236 FRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVP 294
           FRYW++PG +   I + N    RFL   + +I   F F  G ELV IT+ EA + R+ + 
Sbjct: 287 FRYWQHPGAFAYHITTGN--TGRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRNIE 344

Query: 295 KAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSE----NSYVSSSPFIIAIENSGTKIL 350
           KA R+  +R++ FY+ S   IG++V   D  LK+      +   SSPF+IAI+N+  K+L
Sbjct: 345 KASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIKVL 404

Query: 351 PHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFG 410
           PHI N  IL +  S+GNS ++  SR L  +A++G  P++  +  + GVP +AV  ++ F 
Sbjct: 405 PHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAAFS 464

Query: 411 ALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKF 470
            LAF+  S+G  +AF W  N+  ++GF  W+ I  A+++F + +  RG+    +PFK+  
Sbjct: 465 CLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGLYER-VPFKSPL 523

Query: 471 MPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVW 530
            PY  Y+  +V+ +I    G+ +F   ++  +F A+YI++ +F + W   +++ +    W
Sbjct: 524 QPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWSTW 582

Query: 531 KL------VXXXXXXXXXXXXXXVWQDTTPANLWGKF 561
            L      V                Q   PAN W KF
Sbjct: 583 LLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  296 bits (759), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 168/519 (32%), Positives = 279/519 (53%), Gaps = 17/519 (3%)

Query: 24  ESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXX 83
           +SL+    + +   N   T  S  + +  E+D  + +K+ L  RH               
Sbjct: 39  DSLDDRFNKKDSGLNKVLTVSSDTSTNSLEEDYTNTLKQGLKSRHVQLIALGGCIGTGLF 98

Query: 84  XXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-----VTASFTIFSHRFLS 138
               + L   GP G  IAY  + +V+Y +  ++GEM  ++P        S T    R++ 
Sbjct: 99  VGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHLVKRYVD 158

Query: 139 PALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRI 198
            +L  A G+ Y++ + +  A E +    ++++WT AVP  AWI+IF  I+ + N+  V+ 
Sbjct: 159 ESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNMSSVKY 218

Query: 199 YGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTGIISSNIAEA 257
           +GE EFW A +K+  I+G II  F +  G G +   +GFRYW+NPG +   +   ++   
Sbjct: 219 FGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRYWKNPGAFAHHVTDGSLGN- 277

Query: 258 RFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIG 316
            FL   S +I  AF F  G ELV +T+ E ++ R+ + KA ++ ++R++ FYIL    IG
Sbjct: 278 -FLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFYILGTLAIG 336

Query: 317 LLVPYDDVKLKSENSY----VSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYI 372
           ++V ++D  L S  S       SSPF+I I+N+G ++LPHI N  IL +  S+GN+ ++ 
Sbjct: 337 VIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWSSGNAFMFA 396

Query: 373 GSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVV 432
            SR LF +A+NGT PK+F +  K GVP  AV+ ++L   LA++  S+     F WL N+ 
Sbjct: 397 SSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLAYLNASSSAARVFTWLSNIS 456

Query: 433 GVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFT 492
            ++GF  W+    A++RF + +    +  + +PFK    PYL  ++  V+ II    G+ 
Sbjct: 457 TISGFLGWICACIAYLRFRKAIFYNNL-YDRMPFKTWGQPYLILWSLTVVSIITITNGYQ 515

Query: 493 AFAPKF-DVLNFFASYISVFLFFIFWGSFQLW--FKCRY 528
            F PKF +V +F A+YI++ +F   +   +++  FK  Y
Sbjct: 516 TFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFKNDY 554

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  295 bits (755), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 179/531 (33%), Positives = 298/531 (56%), Gaps = 16/531 (3%)

Query: 9   EETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRH 68
            E+LE K+  ++ S E+LE+       ++     + +  +V  + K E   +K+ L  RH
Sbjct: 2   SESLEKKNAGILYSNETLEEDVAFDKLERGASGASAAGASV--DGKHEGIRLKKALEARH 59

Query: 69  XXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTAS 128
                              + L  +GP   LI+Y F+G +VY+V   LGEMA FIP+   
Sbjct: 60  VSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGEMAAFIPLDG- 118

Query: 129 FTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTF--AVPLPAWISIFWV 186
           FT ++ R++ PALG A GY Y F + +    +L+    ++Q+W     V    WI+IF V
Sbjct: 119 FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLV 178

Query: 187 ILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPG-- 243
           ++ + N   VR +GE EFW++ +KV  +LG I+  F I+ G G      GFRYWR+PG  
Sbjct: 179 LIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRYWRDPGAF 238

Query: 244 -PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVF 302
            P+   I  S   + +F+ +AS    A F + GTEL GI A EA NPR++VP+AI+  ++
Sbjct: 239 KPYSEAISGS---KGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLY 295

Query: 303 RILVFYILSLFFIGLLVPYDD---VKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVIL 359
           RI++FY++S+  +G+ V Y+D   +K K  ++  ++SPF++AI+N+G  +LPHIFN  +L
Sbjct: 296 RIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPVLPHIFNACVL 355

Query: 360 VTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETST 419
           + + SA NS++Y+ SR L+GLA +   PK+FAKT   GVP +++  + LF  LA+M  S+
Sbjct: 356 LFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSS 415

Query: 420 GGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYAT 479
           G  + F + +NVV + G  SW+ I   ++RF + + ++   ++   + A F P+  + + 
Sbjct: 416 GSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSL 475

Query: 480 IVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529
               +I   + +T F    FD   F + YI + ++ I +  ++L  + + +
Sbjct: 476 FFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI 526

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  295 bits (755), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 173/512 (33%), Positives = 280/512 (54%), Gaps = 19/512 (3%)

Query: 21  KSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKR------DLSKRHXXXXXX 74
           K  E +E  +     + +        E++ + EK  ++  KR      DLS RH      
Sbjct: 26  KRMEEVEVVESLTKSNYDVQVMGKKYEDMDDVEKAIFNTTKRSLNLNRDLSIRHLLTLAV 85

Query: 75  XXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSH 134
                        + L I GP   +IA+  + T ++++  +LGE+A   PV   F ++  
Sbjct: 86  GGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNALGELAAVFPVVGGFNVYVT 145

Query: 135 RFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLF 194
           R + P+LG A    Y   WA+   LEL      I++W  +V   AW+++F+V + +++L 
Sbjct: 146 RLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYWNNSVNSDAWVAVFYVCIFLASLL 205

Query: 195 PVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVGFRYWRNPGPWGTGIISSN 253
            V+ +GE EF ++ +K+ AI GF I    ++CG G K G +G +YW +PG +      S 
Sbjct: 206 DVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYIGAKYWNDPGSFVGASPGS- 264

Query: 254 IAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLF 313
               +F G  S  + AAF++ GTELVG++A E+ANPR T+PKA ++  + I + Y+L L 
Sbjct: 265 ----QFKGLCSVFVTAAFSYSGTELVGVSAAESANPRYTLPKASKRTFWLITLSYLLVLT 320

Query: 314 FIGLLVPYDDVKLKSENSYV--SSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVY 371
            IG LV +DD KL S +S V  ++SP +IAIEN G + LP + N +IL+ IIS  NS+VY
Sbjct: 321 IIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQGLPSLMNAIILIAIISVANSSVY 380

Query: 372 IGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNV 431
             SR +  +A+ G  P++F      G P+ A++FT +FG L+F+  S   +E F WL  +
Sbjct: 381 ACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSAL 440

Query: 432 VGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGF 491
            G++  F WL I+ +HIRF + L ++G S ++LP+ +      ++Y  +V+I+++    +
Sbjct: 441 SGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLSMTGVIGSWYGCVVIILVLIASFW 500

Query: 492 TAFAPK----FDVLNFFASYISVFLF-FIFWG 518
           T+  P      D  +FF  Y+S+ +F F F G
Sbjct: 501 TSLFPAGSSGADWESFFKGYLSLPIFLFCFVG 532

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  295 bits (754), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 166/508 (32%), Positives = 275/508 (54%), Gaps = 16/508 (3%)

Query: 31  LQGNEDKNTPTTTPSKENVSENEKDEYH-EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNP 89
           L+ + +  TP  + +   ++ N+  +   ++++ LS RH                   + 
Sbjct: 26  LEIDLESLTPEGSSTNRGINGNKDAKLEGKLQQGLSARHIQLIALGGAIGTGLFVGTSST 85

Query: 90  LMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-----VTASFTIFSHRFLSPALGAA 144
           L   GP G  I+Y+ + TV+Y +  + GEM  ++P        S +    R++ P+L  A
Sbjct: 86  LHTCGPAGLFISYVIISTVLYPIMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFA 145

Query: 145 NGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEF 204
            G+ Y++ + +  A E +    ++++WT AVP  AWI+IF  I+ + NL  V+ YGE EF
Sbjct: 146 TGWNYFYCYVILVAAECTAASGVVKYWTDAVPTAAWITIFLSIVVLLNLCAVKYYGETEF 205

Query: 205 WIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTGIISSNIAEARFLGWA 263
           W A +KV  I+G II  F +  G G     +GFRYW+NPG +   I   N+    FL   
Sbjct: 206 WFASIKVLCIVGLIILSFILFWGGGPNHDRLGFRYWKNPGGFAHHITGGNLGN--FLDVY 263

Query: 264 SSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD 322
           S +I  AF F  G EL+ + + E  + R+ + KA ++ V+R++ FYIL    I ++V  +
Sbjct: 264 SGIIKGAFAFILGPELIALASSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASN 323

Query: 323 DVKLKSE----NSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLF 378
           D  L S          SSPF+I I+N+G KILPHI N  IL +  SAGN+ ++  SR L 
Sbjct: 324 DPALTSALASGKPGAGSSPFVIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLL 383

Query: 379 GLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFF 438
            +A NG  PK+F K  + GVP  AV F++L   LA++  S+   + F W  N+  ++GF 
Sbjct: 384 TMASNGQAPKIFGKINRFGVPWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFI 443

Query: 439 SWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKF 498
            W     A++RF + ++  G+  N LP+  +F  Y+ +++ +V+ ++IF  G+  F P+F
Sbjct: 444 GWDCGLVAYLRFRKAIKYNGL-ENRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRF 502

Query: 499 -DVLNFFASYISVFLFFIFWGSFQLWFK 525
            +V +F A+YI++ LF + W   +++ +
Sbjct: 503 WNVSDFIAAYITLPLFVVLWIGHKIYTR 530

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  295 bits (755), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 164/495 (33%), Positives = 268/495 (54%), Gaps = 16/495 (3%)

Query: 36  DKNTPTTTPSKENVSENEKDEY-HEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISG 94
           D +  + + S E  S +  D   HE+K+ L  RH                   + L   G
Sbjct: 50  DVDVFSLSSSTEKHSPHYTDMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCG 109

Query: 95  PVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTAS-----FTIFSHRFLSPALGAANGYMY 149
           P G  I+Y  + +V+Y + Q +GEM  ++P + S           +++  +LG A+ + Y
Sbjct: 110 PAGLFISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNY 169

Query: 150 WFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFL 209
           ++ + +  A E +    ++++WT +VP  AWI+IF   + I N   V+ YGE EFW A +
Sbjct: 170 YYCYVILVAAECTAASGVVEYWTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASI 229

Query: 210 KVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTGIISSNIAEARFLGWASSLIN 268
           K+  I+G II  F +  G G     +GFRYW+NPG +   I   +     FL   + +I 
Sbjct: 230 KILCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRGGSFGS--FLDIYTGIIK 287

Query: 269 AAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLK 327
             F F  G E++ +T+ E  + R+ + KA R+ V+R++ FYIL    I ++V Y+D  L+
Sbjct: 288 GGFAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALE 347

Query: 328 S----ENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKN 383
           +          SSPF+I I+N+G K+LPHI N  IL +  SAGN+ ++  SR L  +A+N
Sbjct: 348 NALAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQN 407

Query: 384 GTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLI 443
           G  P++FAK  + GVP +AV  +S    LA++  S+   + F W  N+  ++GF  W+ +
Sbjct: 408 GQAPRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICV 467

Query: 444 SFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKF-DVLN 502
             A+IRF + +   G+ ++ LP+ A+ MPYL Y+  +V+ II    G+  F P+F D  N
Sbjct: 468 CIAYIRFHKAILFHGM-QSRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKN 526

Query: 503 FFASYISVFLFFIFW 517
           F A+YI++ +F++ W
Sbjct: 527 FVAAYITLPVFWVLW 541

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  293 bits (750), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 166/510 (32%), Positives = 274/510 (53%), Gaps = 17/510 (3%)

Query: 30  DLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNP 89
           D + N   + P  +  + NV +   D   ++ +DLS RH                     
Sbjct: 60  DSKENIKSDVPHVSDFENNVYDTANDS--KLNKDLSVRHLLTLAVGGAIGTGLFVNSGAS 117

Query: 90  LMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMY 149
           L   GP   ++A++ + T ++++  +LGE+A   PV   F ++  RF+ P+ G A    Y
Sbjct: 118 LNTGGPASLIVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINY 177

Query: 150 WFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFL 209
              WA+   LEL      I++W   +   AW++IF+  + ++N+  V+ +GE EF ++ +
Sbjct: 178 LAQWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMI 237

Query: 210 KVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTGIISSNIAEARFLGWASSLIN 268
           K+ AI+GF I    + CG G +G  +G RYW +PG +       +    RF G  +  + 
Sbjct: 238 KILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAF-----VGDTPGRRFKGVCAVFVT 292

Query: 269 AAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKS 328
           AAF++ GTELV ++A E+ NPR T+PKA ++  + I + YI  L  IG LVPY+D +L +
Sbjct: 293 AAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLN 352

Query: 329 ENSYV--SSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTG 386
            NS V  ++SP +IAIEN G K LP + N +IL+ I+S  NS VY  SR +  +A+ G  
Sbjct: 353 GNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNL 412

Query: 387 PKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFA 446
           PK      K G P++A+  T +FG L+F+  S   +E F WL  + G++  F W  I+ +
Sbjct: 413 PKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLS 472

Query: 447 HIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLN 502
           HIRF Q ++++  S N+LPF +    Y ++Y  IV+ +++    +T+  P      D  +
Sbjct: 473 HIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGADAES 532

Query: 503 FFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
           FF  Y+S+ +F + +   +++ K    W+L
Sbjct: 533 FFEGYLSLPIFIVCYLGHKVYKK---DWRL 559

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  291 bits (746), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 165/488 (33%), Positives = 275/488 (56%), Gaps = 12/488 (2%)

Query: 52  NEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYS 111
           + K +   +K+DL  RH                   + L  +GP+  LIAY  +G VV++
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 112 VTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW 171
           V   LGEMA +IP+   FT ++ R+  PALG A GY Y F + +    +L+    ++Q+W
Sbjct: 110 VMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168

Query: 172 TF--AVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG 229
                V    WI++F  ++   N+  V+ +GE EFW++  KV  +L  +     +V G G
Sbjct: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGG 228

Query: 230 KT-GPVGFRYWRNPG---PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGE 285
            +   +GFRYW++PG   P+ +G +S    + +F+ +AS  + A F + GTEL GI A E
Sbjct: 229 PSHNRLGFRYWKDPGGFKPY-SGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAE 287

Query: 286 AANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDD---VKLKSENSYVSSSPFIIAI 342
             NPR+ VP+AI+  ++RI+VFY+ ++F +GL V Y+D   ++ K   +  ++SP+++AI
Sbjct: 288 CKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAI 347

Query: 343 ENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFA 402
           +N+G  +LPHIFN  +L  + SA NS++Y+GSR L+GLA +   PK+FAKT   GVP  +
Sbjct: 348 KNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNS 407

Query: 403 VVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRN 462
           +   +LF  LA+M  S+  +  F + +NV  + G  SW+ I   +I F +  + +GI +N
Sbjct: 408 LALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKN 467

Query: 463 DLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQ 521
            L ++A F P  A+ A    +++   + FT F    FD   F   YI + ++ + +  ++
Sbjct: 468 TLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYK 527

Query: 522 LWFKCRYV 529
           +  K +++
Sbjct: 528 IVHKTKWI 535

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  291 bits (745), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 183/554 (33%), Positives = 290/554 (52%), Gaps = 40/554 (7%)

Query: 11  TLEGKSKIVIKSTESLEQHDLQGN--EDKNTPTTTPSKENVSENEKDEYHEV-------- 60
           +LE K   V    E LE  D   +  E  ++P  T + ++  ++ KD +  V        
Sbjct: 2   SLEDKKNFVYAQEEPLEAQDAGHSSYETGSSPGQTQASKSRWQDFKDGFKRVELEELDPN 61

Query: 61  ----------------KRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLF 104
                           +R L  RH                     L   GP G LI +  
Sbjct: 62  LTEAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGL 121

Query: 105 LGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVV 164
           +G ++Y V  S+GE+A   PV+  FT ++ RF+  + G A  Y Y   W +   LE+   
Sbjct: 122 IGLMIYCVVMSMGELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAA 181

Query: 165 GQIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFC 223
              + FW T       ++++F++++ I N F VR YGE EF  +F+KV  ++GFII    
Sbjct: 182 SITVNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIV 241

Query: 224 IVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGIT 282
           +VCG G  G     +YW NPG +     S + A +RF G  S  + AAF+F GTELVG+ 
Sbjct: 242 LVCGGGPVGGYIGGKYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLA 296

Query: 283 AGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFIIA 341
           + E ANPR+ +P+A ++V +RIL+FYI+SL  IGLLVP+   +L   +S   ++SPF++A
Sbjct: 297 SAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLA 356

Query: 342 IENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVF 401
           I+  G K LP + N VIL++++S GNS VY  SR +  LA+ G+ P +FA   + G P+ 
Sbjct: 357 IQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLV 416

Query: 402 AVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISR 461
           A++ T +FG L+F+  S    + F WLL + G++  FSW  I   HIRF + L ++G S 
Sbjct: 417 AIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRST 476

Query: 462 NDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYISVFLFFIFWG 518
           ++L F +      +Y+  I++++++  Q + A  P     +  +FF++Y+S  +   F+ 
Sbjct: 477 DELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYI 536

Query: 519 SFQLWFKCRYVWKL 532
             ++W   +  WKL
Sbjct: 537 FHKIW---KRNWKL 547

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  291 bits (744), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 183/548 (33%), Positives = 295/548 (53%), Gaps = 28/548 (5%)

Query: 5   DINTE---ETLEGKSKIVIKSTESLEQH-DLQGNE-----DKNTPTTTPSKE-NVSENEK 54
           +INTE     LE +S  + K T +  Q  + +G++     D       P  + N++E E+
Sbjct: 20  NINTEFIDPDLESESIDIKKETFNYNQTGEEKGSKWRQFIDSFKRVEVPELDPNLTEQER 79

Query: 55  ----DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVY 110
                 +  +K  L  RH                     L  +GP   +I +   G+++Y
Sbjct: 80  IAIITAHTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIY 139

Query: 111 SVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQF 170
           S+  ++ EMA   P++  FT ++ RF+  + G AN + Y   W +   LE+      + +
Sbjct: 140 SMVMAVAEMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNY 199

Query: 171 W-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG 229
           W T       ++++FW+++ I NLF V+ YGE EF  + +KV  ++GFII    +VCG G
Sbjct: 200 WGTPTKYRDGFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGG 259

Query: 230 KTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAAN 288
            TG     +YW +PG +         A A+F G+ S  + AAF+F G+EL+GI   EA N
Sbjct: 260 PTGGYVGAKYWHDPGAF-----VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAEN 314

Query: 289 PRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSGT 347
           PR+ VP A ++V +RIL+FYILSL FIGLLVP +D +L  S N   ++SPF+IAI   G 
Sbjct: 315 PRKAVPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGI 374

Query: 348 KILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTS 407
           + LP + N VIL+ ++S GNS +Y  SR L  LA+ G  PK+ +   +SG P+  +  +S
Sbjct: 375 RGLPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISS 434

Query: 408 LFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFK 467
            FG +AF+  S    + F WLL + G++ FF+W  I   HIRF   L+++  S ++LPF 
Sbjct: 435 FFGLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFV 494

Query: 468 AKFMPYLAYYATIVMIIIIFFQGFTAFAPKFD---VLNFFASYISVFLFFIFWGSFQLWF 524
           +    + +Y+   ++++++  Q + A  P  D     NFF++Y+S+ +  + + + +LW 
Sbjct: 495 SPLGVFGSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWT 554

Query: 525 KCRYVWKL 532
           K    WK+
Sbjct: 555 KN---WKI 559

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  289 bits (740), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 174/555 (31%), Positives = 281/555 (50%), Gaps = 22/555 (3%)

Query: 22  STESLEQHDLQGNEDK-NTPTTTPSKENV-SENEKDEYHEVKRDLSKRHXXXXXXXXXXX 79
           S+ S+E+ D  G   K  TP +  S E + +++   EY+ + + L  RH           
Sbjct: 6   SSASIEKADNGGYMHKVKTPHSRTSLEELETQSAGSEYNTLHKGLQSRHIQLIALGGCIG 65

Query: 80  XXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSP 139
                     L   G    L++++ + T+VY +  SL EM  ++P   S      R++ P
Sbjct: 66  TGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDP 125

Query: 140 ALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIY 199
           +LG A G+ Y +++A+  A ELS    ++ +W   VP+ AWI+IF V++   N   V+ Y
Sbjct: 126 SLGFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYY 185

Query: 200 GEIEFWIAFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEAR 258
           GE EFW A +K+  ILG ++    I   GA      GFRYW+NPGP+   +     +  R
Sbjct: 186 GEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPG--STGR 243

Query: 259 FLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGL 317
           FL    ++I +AF F    EL+GI   EA + R+   KA R+ ++RI+ FY+     IG+
Sbjct: 244 FLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGV 303

Query: 318 LVPYDDVK----LKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIG 373
           ++   D K    L++     +SSPF+  I N+G  +L H+ N  IL +  SAGNS +Y  
Sbjct: 304 ILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYAS 363

Query: 374 SRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVG 433
           +R++  LA+ G  PK   K  + GVP  AV+  +L   LA++   T     FQWL N+  
Sbjct: 364 TRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICT 423

Query: 434 VAGFFSWLLISFAHIRFMQCLQSRGISRNDL----PFKAKFMPYLAYYATIVMIIIIFFQ 489
           ++GF  W  +  A IRF      RGI  N+L    P++    PY+AYY T + +++    
Sbjct: 424 ISGFIGWFAMGIAFIRF-----RRGIVFNNLQSRIPYQGPLQPYIAYYFTFMTVVVCLTN 478

Query: 490 GFTAFAP-KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL--VXXXXXXXXXXXXX 546
           GF  F   +++V++F A+Y+++ ++ + +   +LWF+ R+   +  +             
Sbjct: 479 GFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVITGLVEAEEES 538

Query: 547 XVWQDTTPANLWGKF 561
            +     P NLW KF
Sbjct: 539 KMTPPRIPKNLWEKF 553

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  290 bits (743), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 175/538 (32%), Positives = 284/538 (52%), Gaps = 31/538 (5%)

Query: 4   LDINTEETLEG----KSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYH- 58
           +DI+ E T       K+  +I + +S  Q +LQ      +PT   S ++ +E E+ +   
Sbjct: 35  VDIDIEATASNDNNKKNPQIIYNEKSYSQDELQ----TTSPTIIDSIDDEAEKEQGKERS 90

Query: 59  ----EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQ 114
               E+K+ L  RH                   + L   GP G  I+YL + T VY +  
Sbjct: 91  SSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMN 150

Query: 115 SLGEMATFIPVTASFTIFS-----HRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQ 169
           +LGEM  F+P   S +  S     H+++ P+LG A  + Y++ + +  A E+S    +I+
Sbjct: 151 ALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIE 210

Query: 170 FWTFA--VPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG 227
           +W +A  VP  AWI+IF  ++ I N  PV +YGE EFW A +K+  I G II  F +  G
Sbjct: 211 YWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWG 270

Query: 228 AG--KTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFT-FQGTELVGITAG 284
            G    G +GFRYW+NPG +   I         FL   + +I   F+   G ELV +T+ 
Sbjct: 271 GGPKSDGILGFRYWKNPGSFAHHITGG--GGGNFLDIYTGIIKGGFSVILGPELVCLTSS 328

Query: 285 EAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKS----ENSYVSSSPFII 340
           E A+ R+ + KA ++ V+R++ FYIL    IG++V Y+D  L++      +   SSPF+I
Sbjct: 329 ECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVI 388

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
            I+N+G + +PHI N  IL +  SAGN+ ++  SR L  +A+NG  PK+F +  + GVP 
Sbjct: 389 GIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPY 448

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
            AV  + L   LA++  S+   + F W  N+  ++GF  W+    A+IRF + +    ++
Sbjct: 449 TAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKLT 508

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPK-FDVLNFFASYISVFLFFIFW 517
              +PF+AK   Y  +Y+   + +I    G+  F P+ ++V +F A+YI++ +F + W
Sbjct: 509 HR-IPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLW 565

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  288 bits (737), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 175/553 (31%), Positives = 283/553 (51%), Gaps = 24/553 (4%)

Query: 30  DLQGNEDKNTP------------TTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXX 77
           DL+ N +K+T              T    E+  E  K + + +++ LS RH         
Sbjct: 4   DLKANLEKDTSFYDVKSQGETYSGTLNQLESQLEGTKCDENNLEKGLSSRHIQLIALGGC 63

Query: 78  XXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFL 137
                     + L   GP+   ++++ +  +VY V  +L EM  ++P   +    + R++
Sbjct: 64  IGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELTSRYV 123

Query: 138 SPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVR 197
            P+LG A G+ Y +S+++  A ELS    ++Q+WT  V +  WI+IF VI+   N  PV+
Sbjct: 124 DPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVK 183

Query: 198 IYGEIEFWIAFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAE 256
            YGE EFW A LK+  ILG +I    I   GA     +GFRYW NPGP+   I   N   
Sbjct: 184 FYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHITGGN--T 241

Query: 257 ARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFI 315
            RFL   +++I + F F    EL+G+   EA + R+ + KA R+ ++RI+ FYI S   I
Sbjct: 242 GRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCI 301

Query: 316 GLLVPYDDVK----LKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVY 371
           G ++  DD K    L S+    +SSPF+  I N+G  +L HI N VIL +  S+ NS +Y
Sbjct: 302 GFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMY 361

Query: 372 IGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNV 431
             SR +  LAK G  PK+F +  + GVP  AV  ++    L ++  S+   + F WL N+
Sbjct: 362 ASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNI 421

Query: 432 VGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGF 491
             ++GF  W LI   ++RF + +    +    +PFK+   PY  Y+  + ++++    G+
Sbjct: 422 CTISGFIGWALIGITYLRFRKAIFYNNLYER-VPFKSALQPYFTYFFVVFVVLLCLTNGY 480

Query: 492 TAFAPKF-DVLNFFASYISVFLFFIFWGSFQLWFKCRYV--WKLVXXXXXXXXXXXXXXV 548
             F PK+ +  +F A+YI++ +FF+ +   ++WFK R+   ++ +              +
Sbjct: 481 ATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRWYIPFREIDVITGLADAEEEAKM 540

Query: 549 WQDTTPANLWGKF 561
            Q  TP N+W KF
Sbjct: 541 TQPRTPKNMWEKF 553

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  289 bits (740), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 175/560 (31%), Positives = 286/560 (51%), Gaps = 39/560 (6%)

Query: 1   MSILDINTE-ETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSK------------- 46
           MSI++  T     +G   +V+   E++ Q  +  ++ + + T   S+             
Sbjct: 1   MSIIEEKTRLPASKGGDNVVV---ENISQEPVSYDQSQGSSTEAHSRWGRFKESFKRAEE 57

Query: 47  ----ENVSENE----KDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGS 98
                N++E E    K     +K  L  RH                     L  +GP G 
Sbjct: 58  MELDPNLTEAERIAIKTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGI 117

Query: 99  LIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFA 158
           LI +   GT++YS+  ++GE+A   PV   FT ++ RF+  + G A  ++Y   W +   
Sbjct: 118 LIGWGLTGTMIYSMVMAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLP 177

Query: 159 LELSVVGQIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGF 217
           LE+      + +W T       ++++F+V++ I N+F V+ YGE EF  +F+KV  ++GF
Sbjct: 178 LEIVAASITVNYWGTDPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGF 237

Query: 218 IIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGT 276
           II    ++CG GK    +G +YW NPG +       + A  +F G+ +  + AAF+F G+
Sbjct: 238 IIMAIVLICGGGKDHKYIGAQYWYNPGAF-----VGDTAGQQFQGFCTVFVTAAFSFAGS 292

Query: 277 ELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSS 335
           ELVG+   EA  PR++VP A ++V +RI +FYIL L  IG+LVP D  +L   +S   ++
Sbjct: 293 ELVGLAGSEAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAA 352

Query: 336 SPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTK 395
           SPF+IAI N G K LP + N VIL+ ++S GNS +Y  SR L  LA  G  P +     +
Sbjct: 353 SPFVIAIVNHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDR 412

Query: 396 SGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQ 455
            G P+  +  ++ FG +AF+  S    + F WL+ + G++  F+W  I   HIR+   L 
Sbjct: 413 GGRPLVGIAISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALA 472

Query: 456 SRGISRNDLPFKAK---FMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFL 512
           ++G S ++LPF+A    +  Y  ++  I+M I  F+ G      K +  +FF +Y+S  +
Sbjct: 473 AQGRSTDELPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCI 532

Query: 513 FFIFWGSFQLWFKCRYVWKL 532
           F   +   ++W   +  WKL
Sbjct: 533 FIALYAFHKIW---KRNWKL 549

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  288 bits (736), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 165/531 (31%), Positives = 272/531 (51%), Gaps = 21/531 (3%)

Query: 14  GKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXX 73
           G++ +  K T  + + D++     + P  +      S +     H +K+ L  RH     
Sbjct: 11  GETTVTDKQTGQVYEIDIESYSQISGPKVS------SSDAPQGDHTLKKGLKSRHIQLIA 64

Query: 74  XXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFS 133
                         + L   GP G   +Y  +  ++Y V  +LGEM  ++P   S +  S
Sbjct: 65  LGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVCYLPGDGSSSGGS 124

Query: 134 H-----RFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVIL 188
                 R++ P+LG A G+ Y++ + +  A E +    ++Q+WT AVP  AWI+IF  ++
Sbjct: 125 ISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTTAVPKGAWITIFLGVV 184

Query: 189 TISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVGFRYWRNPGPWGT 247
            + N   V+ YGE EFW A +K+  ILG +   F +  G G     +GFRYW+ PG +  
Sbjct: 185 VLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFRYWQKPGAFAY 244

Query: 248 GIISSNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRILV 306
            I S N    RFL   + +I   F F  G ELV +T+ EA + R+ + KA R+ V+R++ 
Sbjct: 245 HITSGN--TGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKASRRFVYRLIF 302

Query: 307 FYILSLFFIGLLVPYDDVKLKSE----NSYVSSSPFIIAIENSGTKILPHIFNGVILVTI 362
           FY+ S   IG +V Y+D  L +          SSPF+I I+N+G K+LPHI N  IL + 
Sbjct: 303 FYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSA 362

Query: 363 ISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGD 422
            S+GNS ++  SR L  +++ G  PK+  +  + GVP  AV  TSL   +A++  S+   
Sbjct: 363 WSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIAYLNVSSSTA 422

Query: 423 EAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVM 482
           + F W  N+  ++GF  W+ I  A++RF + +  + +    +PFK  F PY  ++  I +
Sbjct: 423 DVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNLYER-VPFKTPFQPYGTWFFIIAV 481

Query: 483 IIIIFFQGFTAFAP-KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
            +I    G+  F P  ++V +F A+Y+++ +F + W   +LW +    W +
Sbjct: 482 SVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWAI 532

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  286 bits (733), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 179/553 (32%), Positives = 282/553 (50%), Gaps = 38/553 (6%)

Query: 5   DINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKE---------------NV 49
           ++  +ETL       +++  S E +D   +E++  P  +  K+               N+
Sbjct: 15  NVQVKETLPD-----VETGASYEHYDNYIDEEEQGPPDSRWKKIKDSFKRAEVPELDPNL 69

Query: 50  SENEK----DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFL 105
           +E EK         ++  L  RH                     L  +GP G LI ++  
Sbjct: 70  TEAEKIAIATARSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIA 129

Query: 106 GTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVG 165
           G+++Y +  S+ E+A   PV   FT ++ RF+  + G AN + Y   W +T  LE+    
Sbjct: 130 GSMIYCMVMSVAELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAAS 189

Query: 166 QIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI 224
             + +W T       ++++FWV++ I N+F VR YGE EF  +  K+  I+GFII    +
Sbjct: 190 ITVNYWHTDKKYRDGFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIIL 249

Query: 225 VCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITA 283
           +CG G        RYW +PG +     + + +  +F G+ S  + AAF+F G+ELVG+ A
Sbjct: 250 ICGGGPGTGYIGARYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAA 304

Query: 284 GEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFIIAI 342
            EA+NPR+ VP A ++V +RI +FY+L L  IG+LVPY D +L   +S   ++SPF+IAI
Sbjct: 305 AEASNPRKDVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAI 364

Query: 343 ENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFA 402
           +N G   LP + N VIL+ ++S GNS VY  SR L  LA  G  PK F+   + G P+  
Sbjct: 365 KNQGISGLPTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVG 424

Query: 403 VVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRN 462
           +  TS FG +AF+  S    E F WL+ + G++  F+W  I   HIRF + L ++G S N
Sbjct: 425 IAVTSAFGLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTN 484

Query: 463 DLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYISVFLFFIFWGS 519
           +L F +    + A +   + II++  Q + A  P        +FF  Y+S+ +    W  
Sbjct: 485 ELAFASPAGVWGAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLG 544

Query: 520 FQLWFKCRYVWKL 532
            ++W K    WKL
Sbjct: 545 HKIWKKN---WKL 554

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  286 bits (731), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 171/556 (30%), Positives = 276/556 (49%), Gaps = 41/556 (7%)

Query: 15  KSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENE--------------------- 53
           K + V++ TES        +   N        E +S+N+                     
Sbjct: 35  KEEDVVQVTESPSSGSRNNHRSDNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKS 94

Query: 54  -----KDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTV 108
                  E H++K+ L  RH                   + L   GP G  I+Y+ +  V
Sbjct: 95  PSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAV 154

Query: 109 VYSVTQSLGEMATFIPVTASFTIFSH-----RFLSPALGAANGYMYWFSWAMTFALELSV 163
           +Y +  +LGEM  F+P   S +  S      R++ P+LG A G+ Y++ + +  A E + 
Sbjct: 155 IYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTA 214

Query: 164 VGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFC 223
              ++++WT AVP   WI+IF  ++ I N   V++YGE EFW A +K+  I+G II  F 
Sbjct: 215 ASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFI 274

Query: 224 IVCGAGKTGP-VGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTF-QGTELVGI 281
           +  G G     +GFRYW++PG +   +   ++    F    + +I  AF F  G ELV +
Sbjct: 275 LFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGN--FTDIYTGIIKGAFAFILGPELVCM 332

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDV----KLKSENSYVSSSP 337
           T+ E A+ R+ + KA R+ V+R++ FY+L    I ++VPY+D      L        SSP
Sbjct: 333 TSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSP 392

Query: 338 FIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSG 397
           F+I I+N+G K+LPHI NG IL +  SA N+ ++  +R L  +A+ G  PK   +  K G
Sbjct: 393 FVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWG 452

Query: 398 VPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSR 457
           VP  AV  + L   LA++  S+   + F W  N+  ++GF  W+    A++RF + +   
Sbjct: 453 VPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYN 512

Query: 458 GISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKF-DVLNFFASYISVFLFFIF 516
           G+  + LPFK    PY  +++ IV+ II    G+  F PK+  V +F A+YI++ +F + 
Sbjct: 513 GL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVL 571

Query: 517 WGSFQLWFKCRYVWKL 532
           W   +L+ +    W L
Sbjct: 572 WFGHKLYTRTWRQWWL 587

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  286 bits (731), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 166/519 (31%), Positives = 267/519 (51%), Gaps = 19/519 (3%)

Query: 23  TESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXX 82
            E LE +DL      N+     +K   +   K E   +K+ +  RH              
Sbjct: 106 AEDLE-NDLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGIGTGL 164

Query: 83  XXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT-FIPVTASFTIFSHRFLSPAL 141
                  L  +GP G +I Y  +G+ +Y + Q+ GEMA  +  +   F  +    + P  
Sbjct: 165 LVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGF 224

Query: 142 GAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGE 201
           G A  ++Y   W     LEL      I++WT  V   A++ IF+V++    +F  R Y E
Sbjct: 225 GFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQIFGARGYAE 284

Query: 202 IEFWIAFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRYWRNPGPW-GTGIISSNIAEARF 259
            EF+    K+  I+GF I    I   GAG  G +G +YW +PG + GT  I       RF
Sbjct: 285 AEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRGTNGIQ------RF 338

Query: 260 LGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLV 319
            G  ++ ++AAF F  TE + +TA E +NPR+ +P A +KV++R++  ++ ++  +G LV
Sbjct: 339 KGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLV 398

Query: 320 PYD-DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLF 378
           P+D D  + +  S   +SP+++AI   G +++PH  N VIL+++ S  NS  Y  SRLL 
Sbjct: 399 PWDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRLLL 458

Query: 379 GLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFF 438
           GLA+ G  PK F    + G P  A+   +LFG +AF   S   D+ F WLL + G++  F
Sbjct: 459 GLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQLF 518

Query: 439 SWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-- 496
           +W+ I  +HIRF + +  +G S  ++ FKA+   Y +YYATI+M++ +  Q + A AP  
Sbjct: 519 TWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVLALIAQFWVAIAPIG 578

Query: 497 ---KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
                D   FF +Y+++ +   F+  ++LW   +  W+L
Sbjct: 579 NNGDLDAEGFFENYLAMPILIAFYFGYKLW---KRDWRL 614

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  285 bits (728), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 162/531 (30%), Positives = 276/531 (51%), Gaps = 27/531 (5%)

Query: 21  KSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHE------------VKRDLSKRH 68
           ++ +  EQ       +  T   +PS     E EKDE  +            +K+ +  RH
Sbjct: 65  RADQDQEQEAEVAQMNDLTSAISPSSRQAHELEKDETTDKIAPHTGHKSDSLKKTIQPRH 124

Query: 69  XXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTA 127
                                L+ +GP G LI Y  +G+++Y + Q+ GEMA  +  +T 
Sbjct: 125 VLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTG 184

Query: 128 SFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVI 187
            +  +    +    G A  ++Y   W     LEL      I++WT +V    ++ IF+V+
Sbjct: 185 GYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVL 244

Query: 188 LTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRYWRNPGPWG 246
           +   N+F  R Y E EF+    K+  + GF I    I V GAG  G +G +YW  PG + 
Sbjct: 245 VITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAF- 303

Query: 247 TGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILV 306
            G+ + +    RF G  ++L+ AAF F G+E + IT  E +NPR+ +P A +++++RIL 
Sbjct: 304 NGVHAID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILF 359

Query: 307 FYILSLFFIGLLVPYD-DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISA 365
            ++ ++  +G LVPY+ D  L S      +SP++IAI + G ++ PH  N VIL++++S 
Sbjct: 360 LFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPHFVNAVILLSVLSM 419

Query: 366 GNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAF 425
            NS+ Y  +RL   L++ G  PK+F+   ++G P+ A+  ++LF  +AF   S   D+ F
Sbjct: 420 ANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVF 479

Query: 426 QWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIII 485
            WLL + G++  F+W  I  +HIRF + ++ +G S  +L FK++   + + Y+ I+MI+I
Sbjct: 480 TWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILI 539

Query: 486 IFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
           +  Q + A AP    K D   FF +Y+++ +  + +  +++W K    WKL
Sbjct: 540 LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNK---DWKL 587

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  283 bits (725), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 159/529 (30%), Positives = 273/529 (51%), Gaps = 14/529 (2%)

Query: 6   INTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKEN--VSENEKDEYHEVKRD 63
           +++ +  E ++   I S  S +      ++D         +EN  ++E    +  E+K+ 
Sbjct: 50  VDSFKRAEQQNNSEITSAASCDGSSENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQT 109

Query: 64  LSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TF 122
           +  RH                     L  +GP G LI Y  +GT +Y + Q+ GE+A ++
Sbjct: 110 IKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSY 169

Query: 123 IPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWIS 182
             ++  F ++    + PA G +  ++Y   W     LEL      I++WT  V    ++ 
Sbjct: 170 SSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNADIFVG 229

Query: 183 IFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRYWRN 241
           IF+V++ + N F  R Y E EF+    K+  ++GF I    I   GAG  G +G RYW  
Sbjct: 230 IFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHT 289

Query: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVV 301
           PG +     + +     F G  ++++ AAF F  TE + +TA E +NPR+ +P A +KV+
Sbjct: 290 PGAF-----AGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVL 344

Query: 302 FRILVFYILSLFFIGLLVPYD-DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILV 360
           +RIL  ++ S+  +G LVPYD D  + S  S   +SP+++A+   G K++PH  N VIL+
Sbjct: 345 YRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPHFINAVILL 404

Query: 361 TIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTG 420
           +++S GNS  Y  SRLL+ LA+ G  PK F    + G P  A+V   +F  ++F   S  
Sbjct: 405 SVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPK 464

Query: 421 GDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATI 480
            ++ F WLL + G++  F+W  I  +HIRF + +  +  S  ++ FKA+   + +YY   
Sbjct: 465 EEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCF 524

Query: 481 VMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
           ++++I+  Q + A AP    K D   FF +Y+++ +  +F+  +++W K
Sbjct: 525 MLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKK 573

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  283 bits (723), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 168/517 (32%), Positives = 273/517 (52%), Gaps = 24/517 (4%)

Query: 25  SLEQHDLQGNED-KNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXX 83
           SL+   L G+ D +  P T P K+       D+  E+K+ +  RH               
Sbjct: 80  SLDHDVLAGDSDIEGKPRTEPEKD-------DDARELKKTIKPRHVVMISLGTGIGTGML 132

Query: 84  XXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT-FIPVTASFTIFSHRFLSPALG 142
                 L  SGP G +I Y  +G+ +Y + Q+ GE+A  +  +T  F  +    + PA G
Sbjct: 133 VGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFG 192

Query: 143 AANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFW-VILTISNLFPVRIYGE 201
            A  ++Y   W     LEL      I++WT  V    ++ IF+ +IL I+ L     Y E
Sbjct: 193 FAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAE 252

Query: 202 IEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFL 260
            EF+    K+  + GF I    ++CG AG  G +G R W NPG +       +    RF 
Sbjct: 253 AEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSF-----RGDKPVDRFK 307

Query: 261 GWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVP 320
           G  S+L+NAAF F  +E +G+TA E +NPR+ +P A +K+++RI+  Y+ S+  +G LVP
Sbjct: 308 GVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVP 367

Query: 321 YD-DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFG 379
           YD D  L S  +   +SP+++AI   G +++PH  N VIL++++S GNS  Y  SR L  
Sbjct: 368 YDSDQLLGSSGAATKASPYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLS 427

Query: 380 LAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFS 439
           L++ G  P       ++G P+ A   ++L G +AF  TS   D+ F WLL + G++  F+
Sbjct: 428 LSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFT 487

Query: 440 WLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP--- 496
           W  I  +H+RF + ++ +G S  ++ FK++   Y + Y+ ++M++I+  Q +TA  P   
Sbjct: 488 WFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGE 547

Query: 497 -KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
            K DV  FF +Y+++ +F + +  F++W K    W+L
Sbjct: 548 GKPDVQAFFENYLAMPIFIVLYFGFKIWKK---DWRL 581

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  282 bits (722), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 163/538 (30%), Positives = 282/538 (52%), Gaps = 27/538 (5%)

Query: 5   DINTEETLEGKSKIVIKST---ESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVK 61
           D + EE +E      + S     S ++ +L+ NE         S +N+     ++   +K
Sbjct: 67  DQSAEERVETAQMNDLASAISPSSRQRQELEKNE---------SSDNIGARTGNKSDSLK 117

Query: 62  RDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA- 120
           + +  RH                     L+ +GP G LI Y  +G+++Y + Q+ GEMA 
Sbjct: 118 KTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEMAL 177

Query: 121 TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAW 180
            +  +T  +  +    +    G A  ++Y   W     LEL      I++WT +V    +
Sbjct: 178 VYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVF 237

Query: 181 ISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRYW 239
           + IF+V++   N+F  R Y E EF+    K+  + GF I    I V GAG  G +G +YW
Sbjct: 238 VIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYW 297

Query: 240 RNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRK 299
            +PG +     +   +  RF G  ++L+ AAF F G+E + IT  E ANPR+ VP A ++
Sbjct: 298 HDPGAF-----NGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAAKQ 352

Query: 300 VVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSGTKILPHIFNGVI 358
           +++RIL  ++ ++  +G LVPY+  +L  S      +SP++IA+ + G +++PH  N VI
Sbjct: 353 MIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFINAVI 412

Query: 359 LVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETS 418
           L++++S  NS+ Y  +R+L  L++ G  P++F    K+G P+ A+  ++LFG +AF   S
Sbjct: 413 LLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCAAS 472

Query: 419 TGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYA 478
              D+ F WLL + G++  F+W  I  +HIRF + ++ +G S  +L F+++   + + YA
Sbjct: 473 PKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYA 532

Query: 479 TIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
            I+MI+I+  Q + A AP    K D   FF +Y+++ +    +  +++W K    WKL
Sbjct: 533 CIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKK---DWKL 587

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  281 bits (719), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 166/534 (31%), Positives = 282/534 (52%), Gaps = 18/534 (3%)

Query: 10  ETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENV---SENEKDEYHEVKRDLSK 66
           ET   + +      +S +       +D  + + T + EN+   S+  +D+     +DLS 
Sbjct: 19  ETQPSRLRSARSRYDSADDRADSKQKDLMSGSETKALENLDSTSQEVEDQDARYNKDLSV 78

Query: 67  RHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVT 126
           RH                     L   GP   +I ++ + T ++++  +LGE+++  PV 
Sbjct: 79  RHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVV 138

Query: 127 ASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWV 186
             F ++  RF+ P+ G A    Y   WA+   LEL      I++W   +   AW++IF+ 
Sbjct: 139 GGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTINSDAWVAIFYT 198

Query: 187 ILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF-RYWRNPGPW 245
           I+ ++NL  V+ +GE EF ++ +K+ AI+GF I    + CG G  G     +YW NPG +
Sbjct: 199 IILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAF 258

Query: 246 GTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRIL 305
                  + A  RF G  S  + AAF++ GTEL+ ++A E+ NPR T+PKA ++  + I 
Sbjct: 259 -----VGHTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLIT 313

Query: 306 VFYILSLFFIGLLVPYDDVKLKSENSYV--SSSPFIIAIENSGTKILPHIFNGVILVTII 363
           V YI+ L  +G LV  DD +L + +S V  ++SP +IAIEN G K LP + N +IL+ ++
Sbjct: 314 VCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVL 373

Query: 364 SAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDE 423
           S  NS VY  SR +  +A+ G  PK+F    + G P++A+V T +FG L+F+  S   +E
Sbjct: 374 SVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEE 433

Query: 424 AFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMI 483
            F WL  + G++  F W  I+ +HIRF + ++ RG + ++LPF +    + +YY  IV+ 
Sbjct: 434 VFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSYYGCIVIF 493

Query: 484 IIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLV 533
           I++    +T+  P      +  +FF +Y+S  +    +   +L+ +    W+L+
Sbjct: 494 IVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRS---WRLL 544

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  280 bits (715), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 171/519 (32%), Positives = 274/519 (52%), Gaps = 17/519 (3%)

Query: 15  KSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXX 74
           KS  + K   ++++ ++Q  E      T   K+ V  N++ +   +K+ L  RH      
Sbjct: 6   KSSSLTKEKVAIDEAEVQLEEGVTLDETI--KQGVLHNDRTK---LKQGLKARHIKMLTL 60

Query: 75  XXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSH 134
                          L  +GPVG LIAY+ +G VV     ++ E+A+F+P T +    S 
Sbjct: 61  VGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSE 120

Query: 135 RFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLF 194
           +F+  A+G   G++  +S  M    ELS    ++ +WT   P   +I+IF V+  ++N++
Sbjct: 121 QFIDEAVGFTFGWISTYSSLMPG--ELSATAVVMTYWTDLSP-AIFITIFGVLFILTNIY 177

Query: 195 PVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIISSNI 254
            +R YGEIE++  +LK+  I   II    I  G  K   +GF YWRNPGP+   ++  + 
Sbjct: 178 TIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGTKQERLGFHYWRNPGPFAEYLVGGD- 236

Query: 255 AEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFF 314
              +F+G+ ++L +  +++ G + + I AGE  N R  +    + V  RI++ Y++++F 
Sbjct: 237 -TGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVFV 295

Query: 315 IGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGS 374
           + L+VPY+D  + + +    SSPF+IA+E +G K+LPHI N +IL +  SAGN  +  GS
Sbjct: 296 LTLIVPYNDKLIATGSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGS 355

Query: 375 RLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGV 434
           R LF LA     PK+F KT+K G+P   V+F S F  LA+M  S      F W   +V  
Sbjct: 356 RNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQELVSS 415

Query: 435 AGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF 494
                W+LIS  HI   + L+++G SR DLP+     PY A+++ I+  I +   GF  F
Sbjct: 416 NTLLRWILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNF 475

Query: 495 AP-KFDVLNFFASYISVFL---FFIFWGSFQLWFKCRYV 529
               FD+ +FF+ Y  + L    F FW  F+   K RY+
Sbjct: 476 IHGNFDIESFFSRYFIIPLAIALFTFWKLFK---KTRYL 511

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  282 bits (721), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 159/518 (30%), Positives = 274/518 (52%), Gaps = 24/518 (4%)

Query: 22  STESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXX 81
           S  S +  +L+ NE         S +N+  N   +   +K+ +  RH             
Sbjct: 87  SPSSRQAQELEKNE---------SSDNIGANTGHKSDSLKKTIQPRHVLMIALGTGIGTG 137

Query: 82  XXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPA 140
                   L+ +GP G LI Y  +G+++Y + Q+ GEMA  +  +T  +  +    +   
Sbjct: 138 LLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDG 197

Query: 141 LGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYG 200
            G A  ++Y   W     LEL      I++WT +V    ++ IF+V++   N+F  R Y 
Sbjct: 198 FGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYA 257

Query: 201 EIEFWIAFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARF 259
           E EF+    K+  + GF I    I V GAG  G +G +YW +PG +     +   A  RF
Sbjct: 258 EAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAF-----NGKHAIDRF 312

Query: 260 LGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLV 319
            G A++L+ AAF F G+E + IT  E +NPR+ +P A +++++RIL  ++ ++  +G LV
Sbjct: 313 KGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIILLGFLV 372

Query: 320 PYD-DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLF 378
           PY+ D  L S      +SP++IA+ + G +++PH  N VIL++++S  NS+ Y  +RL  
Sbjct: 373 PYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARLFL 432

Query: 379 GLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFF 438
            L++ G  PK+F+   ++G P+ A+  ++LF  +AF   S   ++ F WLL + G++  F
Sbjct: 433 TLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLF 492

Query: 439 SWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-- 496
           +W  I  +H+RF + ++ +G S  +L FK++   + + YA I+MI+I+  Q + A AP  
Sbjct: 493 TWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILILIAQFWVAIAPIG 552

Query: 497 --KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
             K D   FF +Y+++ +    +  +++W K    WKL
Sbjct: 553 EGKLDAQAFFENYLAMPILIALYVGYKVWHK---DWKL 587

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  281 bits (718), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 173/500 (34%), Positives = 280/500 (56%), Gaps = 8/500 (1%)

Query: 35  EDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISG 94
           E ++T +      N   + K     +K+DL  RH                   N L ++G
Sbjct: 37  EKESTESVALDDTNEQFDGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAG 96

Query: 95  PVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWA 154
           PV  LI+Y F+G +V+ V   +GEMA +IP+   FT ++ R+  PALG A GY Y   + 
Sbjct: 97  PVSMLISYSFVGVLVFFVMSCIGEMAAYIPLDG-FTSYASRYCDPALGFAVGYAYLVKYF 155

Query: 155 MTFALELSVVGQIIQFW--TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVN 212
           +    +L+    +IQ+W     V    WI+I  V++ + N F V+ +GE EFW++  KV 
Sbjct: 156 ILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVI 215

Query: 213 AILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAF 271
            +LG II  F I+ G   T   +GFRYW++PG +     S +    RF+ + S  +   F
Sbjct: 216 VMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLF 275

Query: 272 TFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDD---VKLKS 328
            + G EL GI A EA NPR+ +PKAI+  ++RI++FYI+++F +G+ V  +D   ++ K+
Sbjct: 276 CYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKT 335

Query: 329 ENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPK 388
           +++  ++SPF++AI NSG + LPHIFN  +L+ + SA NS++Y+ SR L+ LA +   PK
Sbjct: 336 KSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPK 395

Query: 389 LFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHI 448
           +FAKT + G+P  ++    LF  LA+M  S+G  + F + +NVV + G  +W+ I   +I
Sbjct: 396 IFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYI 455

Query: 449 RFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASY 507
            F + ++++GI ++   + A   PY AY++     ++   + FT F   KFD  NF   Y
Sbjct: 456 CFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGY 515

Query: 508 ISVFLFFIFWGSFQLWFKCR 527
           I + LFFI +  ++   K +
Sbjct: 516 IGLPLFFICYFGYKFVKKTK 535

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  283 bits (724), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 162/522 (31%), Positives = 277/522 (53%), Gaps = 20/522 (3%)

Query: 22  STESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXX 81
           ++ES  ++ +  NED  TP   P   +   N+  +  E+K+ +  RH             
Sbjct: 121 NSESDLENMILYNED-GTPKPLPHHHDAQINDNSKSDELKKTIKPRHVLMISLGTGIGTG 179

Query: 82  XXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPA 140
                 + L+ +GP G +I +  +G+ +Y + Q++GE+A  +  +   F  +    +  A
Sbjct: 180 LLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEA 239

Query: 141 LGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFP-VRIY 199
              A  ++Y   W     LEL      I++WT  V    ++ IF++++   NL      Y
Sbjct: 240 FCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDPDIFVIIFYILIIGINLLGGAAGY 299

Query: 200 GEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEAR 258
            E EF     K+  ++GF I    ++CG AG  G +G +YW +PG      +  + +  R
Sbjct: 300 AEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIGAKYWHDPGA-----LRGDTSIQR 354

Query: 259 FLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLL 318
           F G  ++L+NAAF F  +E +G+TA E +NPR+ +P A +K+++RIL  ++ S+  +G L
Sbjct: 355 FKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMIYRILCMFLSSITIVGFL 414

Query: 319 VPYD-DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLL 377
           VPY+ D  L S  S V +SP+++AI   G +++PH  N VIL++++S  NS  Y  SR+L
Sbjct: 415 VPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPHFINAVILISVLSVANSAYYSSSRML 474

Query: 378 FGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGF 437
             LA+ G  PK+++   + G P+  +   ++FG +AF  TS   DE F WLL + G++  
Sbjct: 475 LSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFCATSPKEDEVFVWLLAISGLSQL 534

Query: 438 FSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP- 496
           F+W+ I  +HIRF + +  +G S  +L F+++   Y + YA I+M +I+  Q + A  P 
Sbjct: 535 FTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAAIMMFMILIAQFWVALVPI 594

Query: 497 ------KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
                 K D  NFF +Y+++ +   F+  +++W K    WKL
Sbjct: 595 NADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKK---DWKL 633

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  281 bits (718), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 182/550 (33%), Positives = 287/550 (52%), Gaps = 31/550 (5%)

Query: 6   INTEETLEG-KSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHE----- 59
           IN+E   E  +S +   +T S++ +D   +  K+    T  K++    EK+E        
Sbjct: 24  INSETLHEPVQSSLTPTTTASIDSNDATIDHSKSVSRWTRIKDSFKRAEKEEVDPNLTEA 83

Query: 60  -----------VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTV 108
                      +K  L  RH                     L  +GP G +I +    T+
Sbjct: 84  ERIAINTAKAPLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTM 143

Query: 109 VYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQII 168
           +Y +  +LGE+A   PV+  FT ++ RF+  + G A+ + Y   W  T  LE+      +
Sbjct: 144 IYCMVMALGELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITV 203

Query: 169 QFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG 227
            +W T       ++++FW+++ I NLF VR +GE EF  + +KV  ++GFII    +V G
Sbjct: 204 NYWQTPERYRDGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAG 263

Query: 228 AGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEA 286
            G  G     RYW NPG +    +  N A  +F G  S  + AAF+F G+ELVGITA EA
Sbjct: 264 GGPEGGFVGGRYWHNPGAF----VGDN-AGTQFKGVCSVFVTAAFSFAGSELVGITAAEA 318

Query: 287 ANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFIIAIENS 345
           ANPR++VP+A ++VV+RI++FY+ SL  IGLLVPY D +L   +S   S+SPF+IAI   
Sbjct: 319 ANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFVIAIVTH 378

Query: 346 GTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVF 405
           G + LP + N VIL+ ++S GNS ++ GSR +  L++ G  P++F    + G P+  ++ 
Sbjct: 379 GIRGLPSVINVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIV 438

Query: 406 TSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLP 465
            S FG +AF+  S    E F WL+ + G++  F+W  I   HIRF   L+++G S N+LP
Sbjct: 439 ISTFGLIAFIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELP 498

Query: 466 FKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYISVFLFFIFWGSFQL 522
           F +      + +   +++++   Q + A  P   K     FF SY+S  +   F+   ++
Sbjct: 499 FVSPAGIIGSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKI 558

Query: 523 WFKCRYVWKL 532
           + K    WKL
Sbjct: 559 YKKN---WKL 565

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  282 bits (722), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 159/513 (30%), Positives = 262/513 (51%), Gaps = 17/513 (3%)

Query: 29  HDLQGNEDKNTPTTTPSKENV--SENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXX 86
            DL+  +      TT   E +   + ++D   E+++ +  RH                  
Sbjct: 126 DDLENKQQVELIGTTIQDEELLPGQKKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGN 185

Query: 87  XNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAAN 145
             PL  +GP   +I Y  +GT +Y + Q+ GEMA  +  +T SF  F    + P    A 
Sbjct: 186 AKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAV 245

Query: 146 GYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFW 205
            ++Y   W     LEL      IQ+WT  V    ++ IF+V++ + N F  + Y E EF 
Sbjct: 246 AWVYCIQWLCVCPLELVTASMTIQYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFI 305

Query: 206 IAFLKVNAILGFIIYCFCIVCGA-GKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWAS 264
               KV  I GF I   CI  GA G  G +G +YW +PG +            RF G   
Sbjct: 306 FNTCKVLMICGFFILAICIDTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMD 360

Query: 265 SLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD-D 323
           + + AAF F  TE + +TA E +NPR+ +P A +K+++R+LV ++ ++  IG LVPYD D
Sbjct: 361 TFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSD 420

Query: 324 VKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKN 383
             L S  S   +SP+++AI   G ++  H  N VIL+++IS GNS  Y  SRLL  LA+ 
Sbjct: 421 QLLGSGGSATKASPYVLAISLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQ 480

Query: 384 GTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLI 443
           G+ PK+F    + G P+ A+  +++   +AF  TS    E F WL+ + G++  F+W  I
Sbjct: 481 GSAPKIFDYVDREGRPLIAMCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAI 540

Query: 444 SFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKF----D 499
             +H+RF + ++ +G S  ++ + ++     + YA I+MI+ +  Q + A  P      D
Sbjct: 541 CLSHLRFRRAMKVQGRSLGEMGYLSQTGILGSLYAAIMMILALIAQFWVALVPMGTHTPD 600

Query: 500 VLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
             +FF++Y+++ +  +F+  +++W   +  W+L
Sbjct: 601 ANSFFSNYLAMPILIVFYFGYKIW---KRDWRL 630

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  280 bits (716), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 159/494 (32%), Positives = 266/494 (53%), Gaps = 15/494 (3%)

Query: 47  ENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLG 106
           E+ S     E     +DLS RH                   + L   GP   +I ++ + 
Sbjct: 57  ESTSGTSDAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIIS 116

Query: 107 TVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQ 166
           T ++++  +LGE+++  PV   F ++  RF+ P+ G A    Y   WA+   LEL     
Sbjct: 117 TCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASL 176

Query: 167 IIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVC 226
            I++W   +   AW++IF+ I+ ++NL  V+ +GE EF ++ +K+ AI+GF I    + C
Sbjct: 177 TIRYWNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTC 236

Query: 227 GAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGE 285
           G G  G     +YW NPG +       N +  RF G  S  + AAF++ GTEL+ ++A E
Sbjct: 237 GGGPEGGYIGGKYWSNPGAF-----VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAE 291

Query: 286 AANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL--KSENSYVSSSPFIIAIE 343
           + NPR T+PKA ++  + I V YI+ L  +G LVP DD +L   S +  V++SP +IAIE
Sbjct: 292 SVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIE 351

Query: 344 NSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAV 403
           N G K LP + N +IL+ ++S  NS VY  SR +  +A+ G  PK F+   + G P++A+
Sbjct: 352 NGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAI 411

Query: 404 VFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRND 463
           + T +FG L+F+  S   +  F WL  + G++  F W  I+ +HIRF   ++ RG S ++
Sbjct: 412 LATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDE 471

Query: 464 LPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVL----NFFASYISVFLFFIFWGS 519
           LPF +    + +YY  +++ +++    +TA  P  + +    +FF +Y+S  +  + +  
Sbjct: 472 LPFVSMTGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIG 531

Query: 520 FQLWFKCRYVWKLV 533
            +L+ K    W+L+
Sbjct: 532 HKLYTKS---WRLL 542

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  281 bits (720), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 165/525 (31%), Positives = 272/525 (51%), Gaps = 20/525 (3%)

Query: 17  KIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENE-KDEYHEVKRDLSKRHXXXXXXX 75
           K   K   S  +HDL    +    T  PS++     E   +  E+K  +  RH       
Sbjct: 82  KRADKEQPSTLEHDLTKTFEG---TLEPSEDGTQPAEVAGKSEELKHSIKPRHVIMISLG 138

Query: 76  XXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT-FIPVTASFTIFSH 134
                         L  SGP G +I Y  +G+ +Y + Q+ GEMA  +  +   F  +  
Sbjct: 139 TGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPS 198

Query: 135 RFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLF 194
             + PALG +  ++Y   W     LEL      I++WT  V    ++ IF+V++ + N+ 
Sbjct: 199 FLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIILINVL 258

Query: 195 P-VRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISS 252
                Y E EF+    K+  +LGF I    ++CG AG  G +G RYW +PG +       
Sbjct: 259 GGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDGYIGGRYWHDPGAF-----RG 313

Query: 253 NIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSL 312
             A  RF G  S+L+NAAF F  +E++G+TA E +NPR+ +P A +K+++RI+  Y+ S+
Sbjct: 314 EHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSV 373

Query: 313 FFIGLLVPYD-DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVY 371
             +G LVP++ D  L S    V +SP+++A+   G +++PH  N VIL++++S  NS  Y
Sbjct: 374 VIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFY 433

Query: 372 IGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNV 431
             SRLL GLA+ G  PK+F    + G P   +   +L   ++F  TS   D+ F WLL +
Sbjct: 434 SSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAI 493

Query: 432 VGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGF 491
            G++  F+W  I  +HIRF + +  +G S  ++ FK++   + ++YA I+M++I+  Q +
Sbjct: 494 SGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWGSWYAFIMMMLILIAQFW 553

Query: 492 TAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
            A AP    + DV  FF +Y++  +    +  ++++ K    W+L
Sbjct: 554 VAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTK---DWRL 595

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  281 bits (720), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 154/514 (29%), Positives = 271/514 (52%), Gaps = 14/514 (2%)

Query: 20  IKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXX 79
           I + +S  Q D + N   +  T +  K+   E ++++   +K+ +  RH           
Sbjct: 104 ISTNDSSSQLDNELNPKGSFVTESGIKQPSQEQDQNQ-ENLKKTIKPRHIVMMSLGTGIG 162

Query: 80  XXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT-FIPVTASFTIFSHRFLS 138
                     L  +GP G +I Y  +G+ +Y + Q+ GE+A  +  +   F  +    + 
Sbjct: 163 TGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVD 222

Query: 139 PALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRI 198
           PALG +  ++Y   W     LEL      I++WT  V    ++ IF+V++ + N+F  + 
Sbjct: 223 PALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKG 282

Query: 199 YGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEA 257
           Y E +F+    K+  I+GF I    I CG AG  G +G RYW NPG +       N    
Sbjct: 283 YAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSRYWHNPGAF-----RGNTGIQ 337

Query: 258 RFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGL 317
           RF G  ++ + AAF F  +E + +TA E +NPR+ +P A +K+++RIL  ++ SL  +G 
Sbjct: 338 RFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGF 397

Query: 318 LVPY-DDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRL 376
           LVPY  D  L +  S   +SP++IA+ + G +++PH  N VIL++++S  N   Y  SR+
Sbjct: 398 LVPYTSDQLLGASGSATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRI 457

Query: 377 LFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAG 436
           L  LAK G  PK F    + G P  A++ +S+FG +AF  +S   ++ F WLL + G++ 
Sbjct: 458 LMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQ 517

Query: 437 FFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP 496
            F+W+ I  +HIRF + ++ +G S  ++ +K++   + + YA ++M++ +  Q + A +P
Sbjct: 518 LFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISP 577

Query: 497 -----KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
                K    +FF +Y+++ +    +  +++W K
Sbjct: 578 IGGGGKLSAQSFFENYLAMPILIALYVFYKVWKK 611

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  279 bits (714), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 168/541 (31%), Positives = 280/541 (51%), Gaps = 20/541 (3%)

Query: 1   MSILDINTEETLEGKSKIVIKSTESL-EQHDLQGNEDKNTPTTTPSKENVSENEKDEYHE 59
           MS +   +    E + K V  + + L  + DL+      T       ++ SE E +   +
Sbjct: 2   MSTISYPSYSKEEEEKKTVFDNRQILINELDLE----SLTREKITRSDSSSEVEAEGNGK 57

Query: 60  VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEM 119
           +K+ LS RH                     L   GP G +I+Y+ + TV+Y +  +LGEM
Sbjct: 58  LKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNALGEM 117

Query: 120 ATFIP-----VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFA 174
             ++P        S      R++  +L  A G+ Y++ + +  A E +    ++ +WT +
Sbjct: 118 VCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYWTTS 177

Query: 175 VPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTG-P 233
           VP   WI+IF  I+T+ N   V+ +GE EFW A +K+  ILG I+  F +  G G +   
Sbjct: 178 VPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPSHVR 237

Query: 234 VGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQT 292
           +GF YW++PG +   I   +     FL   + +I  AF F  G ELV +T+ E  + R+ 
Sbjct: 238 LGFHYWKDPGTFAHHITGGSWGS--FLDIYTGIIKGAFAFILGPELVALTSSECNDQRRN 295

Query: 293 VPKAIRKVVFRILVFYILSLFFIGLLVPYDDV----KLKSENSYVSSSPFIIAIENSGTK 348
           + KA ++ ++R++ FYIL    I ++V Y+D      L+      +SSPF+I I+N+G K
Sbjct: 296 IAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGIK 355

Query: 349 ILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSL 408
           +LPHI N  IL +  SAGNS ++  SR L  +A NG+ PK+F K  + GVP ++V  +++
Sbjct: 356 VLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSAM 415

Query: 409 FGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKA 468
              LAF+  S+   + F W  N+  ++GF  W+    A++RF + +    +  + LPFK 
Sbjct: 416 LSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNM-YDRLPFKT 474

Query: 469 KFMPYLAYYATIVMIIIIFFQGFTAFAPKF-DVLNFFASYISVFLFFIFWGSFQLWFKCR 527
              PYL +Y+ +V+ +I    G+  F P+F    +F A+YI++ LF I W   + W + +
Sbjct: 475 FGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWARYK 534

Query: 528 Y 528
           +
Sbjct: 535 H 535

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  281 bits (719), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 155/527 (29%), Positives = 277/527 (52%), Gaps = 14/527 (2%)

Query: 7   NTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSK 66
           N+ ++        I + +S  Q D + N   +  T    K++  E E+ +   +K+ +  
Sbjct: 93  NSPDSSNSNGTTPISTKDSSSQLDNELNRKSSYITVDGIKQSPQEQEQKQ-ENLKKSIKP 151

Query: 67  RHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT-FIPV 125
           RH                     L  +GP G +I Y  +G+ VY + Q+ GE+A  +  +
Sbjct: 152 RHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDL 211

Query: 126 TASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFW 185
              F  +    + PALG +  +++   W     LEL      I++WT +V    ++ IF+
Sbjct: 212 IGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVVIFY 271

Query: 186 VILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGP 244
           V++ + N+F  + Y E +F+    K+  I+GF I    I CG AG  G +G +YWR+PG 
Sbjct: 272 VLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGA 331

Query: 245 WGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRI 304
           +       +    RF G  ++ + AAF F  +E + +TA E +NPR+ +P A +K+++RI
Sbjct: 332 F-----RGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRI 386

Query: 305 LVFYILSLFFIGLLVPY-DDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTII 363
           L  ++ SL  +G LVPY  D  L +  S   +SP++IA+ + G +++PH  N VIL++++
Sbjct: 387 LFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVL 446

Query: 364 SAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDE 423
           S  N   Y  SR+L  LAK G  PK F    + G P  A++ ++LFG +AF  +S   ++
Sbjct: 447 SVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEED 506

Query: 424 AFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMI 483
            F WLL + G++  F+W+ I  +HIRF + ++ +G S  ++ +K++   + + YA ++M+
Sbjct: 507 VFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMV 566

Query: 484 IIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
           + +  Q + A AP     K    +FF +Y+++ ++   +  +++W K
Sbjct: 567 LALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKK 613

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  280 bits (715), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 162/500 (32%), Positives = 269/500 (53%), Gaps = 13/500 (2%)

Query: 34  NEDKNTP-TTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMI 92
           N  K  P +  P KE+ S+      +++K+ +  RH                     L  
Sbjct: 69  NSFKRAPGSNNPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRN 128

Query: 93  SGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWF 151
            GP G +I Y  +G+ +Y + Q+ GE+A  +  ++  F  +    + PALG +  ++Y  
Sbjct: 129 GGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCL 188

Query: 152 SWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKV 211
            W     LEL      I++WT +V    +++IF+V+    N+F  R Y E EF+    KV
Sbjct: 189 QWLCVMPLELVTASITIKYWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKV 248

Query: 212 NAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAA 270
             I GF I    + CG AG  G +G +YW +PG +     S +     F G  S+L+ AA
Sbjct: 249 LMITGFFILGIIVNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAA 303

Query: 271 FTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSE 329
           F F  TE + +TA E ANPR+++P A +KV++RI+V ++ S+  +G LVP++  +L  S 
Sbjct: 304 FAFGATEFIALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSG 363

Query: 330 NSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKL 389
            S   +SP++IAI + G K++PH  N VIL++++S GNS  Y  SRLL  LA+ G  P  
Sbjct: 364 GSATHASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSF 423

Query: 390 FAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIR 449
                + G P  A++ +++FG ++F+  S   +  F WLL + G++  F+W  I  +HIR
Sbjct: 424 LKYVDREGRPTLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIR 483

Query: 450 FMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFA 505
           F + ++ +G S  +L FK++   + +YYAT +M++I+  Q +TA AP    K D   FF 
Sbjct: 484 FRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFE 543

Query: 506 SYISVFLFFIFWGSFQLWFK 525
           +Y+++ +    +  +++W +
Sbjct: 544 NYLAMPILIALYFGYKVWKR 563

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  278 bits (712), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 170/511 (33%), Positives = 276/511 (54%), Gaps = 14/511 (2%)

Query: 32  QGNEDKNTPTTTPSKENVSENEKDEYHE---VKRDLSKRHXXXXXXXXXXXXXXXXXXXN 88
           +G   ++T ++T  +    +   D  HE   +K+DL  RH                   +
Sbjct: 28  EGRGLRHTHSSTDQEAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGS 87

Query: 89  PLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYM 148
            LM +GP   LIAY  +G VV++V   LGEMA +IP+   FT ++ R+  PALG A G+ 
Sbjct: 88  SLMRAGPGSILIAYSIMGWVVFTVMSCLGEMAAYIPLDG-FTSYATRYADPALGFAVGWA 146

Query: 149 YWFSWAMTFALELSVVGQIIQFWTFAVPLP--AWISIFWVILTISNLFPVRIYGEIEFWI 206
           Y F + +    +L+    +IQFW  A  +    WI++   ++ + N   VR +GE EFW+
Sbjct: 147 YLFKYLVLTPNQLTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWL 206

Query: 207 AFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGP---WGTGIISSNIAEARFLGW 262
           +  KV  +L  +I    +  G G T   +GFRYW +PG    +            +F+ +
Sbjct: 207 SSFKVLVMLCVMILLLVLALGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAF 266

Query: 263 ASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD 322
            S  + A F + GTEL GI A E  +PR+ VP+AI+  ++RI+VFY++++F +G+ V Y+
Sbjct: 267 LSVFVYALFAYLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYN 326

Query: 323 D---VKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFG 379
           D   ++  S     ++SP+++AIEN+   +LP++FN  +L  + SA NS++Y+GSR L+G
Sbjct: 327 DPLLMQASSAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYG 386

Query: 380 LAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFS 439
           LA +G  PKLFA+T K GVP  A+   +LF  LA+M  S     AF + +NV  + G  S
Sbjct: 387 LAIDGKAPKLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMS 446

Query: 440 WLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPK-F 498
           W+ I   +I F +  +++GI ++ L + A   PY  + A I  I +   + F AF  K  
Sbjct: 447 WVSILITYICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEV 506

Query: 499 DVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529
           DV  F   YI + ++   +  +++  K +++
Sbjct: 507 DVPTFITGYIGLPIYIFCFIGYKIVHKTKWI 537

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  280 bits (717), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 154/510 (30%), Positives = 269/510 (52%), Gaps = 14/510 (2%)

Query: 22  STESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXX 81
           + +S  Q D + N   +  T    K+   E E+ +   +K+ +  RH             
Sbjct: 108 TNDSSSQLDNELNRKSSYITVDGIKQAPQEQEQKQ-ENLKKSIKPRHTVMMSLGTGIGTG 166

Query: 82  XXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT-FIPVTASFTIFSHRFLSPA 140
                   L  +GP G +I Y  +G+ VY + Q+ GE+A  +  +   F  +    + PA
Sbjct: 167 LLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPA 226

Query: 141 LGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYG 200
           LG +  +++   W     LEL      I++WT  V    ++ IF+V++ + N+F  + Y 
Sbjct: 227 LGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYA 286

Query: 201 EIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARF 259
           E +F+    K+  I+GF I    I CG AG  G +G +YWR+PG +       +    RF
Sbjct: 287 EADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPGAF-----RGDTPIQRF 341

Query: 260 LGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLV 319
            G  ++ + AAF F  +E + +TA E +NPR+ +P A +K+++RIL  ++ SL  +G LV
Sbjct: 342 KGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLV 401

Query: 320 PY-DDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLF 378
           PY  D  L +  S   +SP++IA+ + G +++PH  N VIL++++S  NS  Y  SR+L 
Sbjct: 402 PYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILM 461

Query: 379 GLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFF 438
            LAK G  PK F    + G P  A++ ++LFG +AF  +S   ++ F WLL + G++  F
Sbjct: 462 SLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLF 521

Query: 439 SWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-- 496
           +W+ I  +HIRF + ++ +G S  ++ +K++   + + YA ++M++ +  Q + A AP  
Sbjct: 522 TWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMMLALIAQFWVAIAPIG 581

Query: 497 ---KFDVLNFFASYISVFLFFIFWGSFQLW 523
              K    +FF +Y+++ +    +  F++W
Sbjct: 582 GGGKLSAQSFFENYLAMPILIALYIFFKVW 611

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  279 bits (714), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 169/533 (31%), Positives = 277/533 (51%), Gaps = 23/533 (4%)

Query: 12  LEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXX 71
           +E  SK    S+    + DL  + D      +PS E       +E H++K+ L  RH   
Sbjct: 70  MEKISKNHSASSNGTIREDLIMDVDVEK---SPSVEG-----DNEPHKLKQGLQSRHVQL 121

Query: 72  XXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTI 131
                           + L   GP G  I+Y+ +  V+Y +  +LGEM  F+P   S + 
Sbjct: 122 IALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSA 181

Query: 132 FSH-----RFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWV 186
            S      R++  +LG A G+ Y++ + +  A E +    ++++WT AVP   WI+IF  
Sbjct: 182 GSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLC 241

Query: 187 ILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPW 245
           ++ + NL  V++YGE EFW A +K+  I+G II  F +  G G     +GFRYW++PG +
Sbjct: 242 VVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAF 301

Query: 246 GTGIISSNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRI 304
              +   ++    F    + +I  AF F  G ELV +T+ E A+ R+ + KA R+ V+R+
Sbjct: 302 AHHLTGGSLGN--FTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFVWRL 359

Query: 305 LVFYILSLFFIGLLVPYDDVKLKSENSY----VSSSPFIIAIENSGTKILPHIFNGVILV 360
           + FY+L    I ++VPY+D  L +  +       SSPF+I I+N+G K+LPHI NG IL 
Sbjct: 360 IFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILS 419

Query: 361 TIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTG 420
           +  SA N+ ++  +R L  +A+ G  PK   +  + GVP  AV  + L   LA++  S+ 
Sbjct: 420 SAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNVSSS 479

Query: 421 GDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATI 480
             + F W  N+  ++GF  W+    A++RF + +   G+  + LPFK    PY  + + I
Sbjct: 480 TADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-FDRLPFKTWGQPYTVWASLI 538

Query: 481 VMIIIIFFQGFTAFAPKF-DVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
           V+ II    G+  F PK+  + +F A+YI++ +F + W   +L+ +    W L
Sbjct: 539 VVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRTWSQWWL 591

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  278 bits (711), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 162/520 (31%), Positives = 267/520 (51%), Gaps = 19/520 (3%)

Query: 21  KSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHE---VKRDLSKRHXXXXXXXXX 77
           K  +++E  D++  +  ++ T +  K    + + D +     +++ L  RH         
Sbjct: 36  KYNKTIEFVDVESQQSTSSATIS-EKLGDGDGDADPFANEGSLQQGLKSRHIQMIALGGA 94

Query: 78  XXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-----VTASFTIF 132
                     + L + GP G  I+Y+ + +VVY +    GEM  ++P      + S    
Sbjct: 95  IGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEMVCYLPGNGNDASGSAAHL 154

Query: 133 SHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISN 192
             R++  +LG A  + Y++ + +  A E +    ++++WT AVP   WI IF  I+ I N
Sbjct: 155 VARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTVAVPKGVWILIFLGIVVILN 214

Query: 193 LFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT-GPVGFRYWRNPGPWGTGIIS 251
             PV+ YGE EFW A +K+  I+G II  F +  G G     +GFRYW+ PG +   I+ 
Sbjct: 215 FGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEHIMK 274

Query: 252 SNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYIL 310
                 RFL   S +I   F F  G ELV +T+ E  + R+ + KA R+ ++R++ FY+L
Sbjct: 275 GGFG--RFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIWRLMFFYVL 332

Query: 311 SLFFIGLLVPYDD----VKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAG 366
               I ++V Y+D      L S      SSPF+I I+N+G ++LPHI N  IL +  SAG
Sbjct: 333 GTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWSAG 392

Query: 367 NSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQ 426
           N+ ++  +R L  +A+NG  P++F K  + GVP  A+  +     LAF+  S+   + F 
Sbjct: 393 NAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADVFN 452

Query: 427 WLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIII 486
           W  N+  ++GF  W+    A+IRF + +   G+  + LPFK    PY  YY+  V+ +I 
Sbjct: 453 WFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRLPFKTWGQPYAVYYSLFVISLIT 511

Query: 487 FFQGFTAFAPK-FDVLNFFASYISVFLFFIFWGSFQLWFK 525
              G+  F PK +   +F A+YI++ +F + W   +LW +
Sbjct: 512 LTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTR 551

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  278 bits (710), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 164/538 (30%), Positives = 278/538 (51%), Gaps = 23/538 (4%)

Query: 2   SILDINTEETLEGKSKIVIKSTESLEQH-DLQGNEDKNTPTTTPSKENVSENEKDEYHE- 59
           +++  N  +  E  SK++    E+L+   D     D N       K  ++  + D++++ 
Sbjct: 20  NVIVTNENQINESHSKLI----ENLKDFVDSFKKIDDNNNQYEIEKNEINNIKSDQFNDK 75

Query: 60  ----VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQS 115
               +++ +  RH                     L  +GP G LI Y+ + + +Y + Q+
Sbjct: 76  LNNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQA 135

Query: 116 LGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFA 174
            GEMA  ++ +   F  +    +  A   A  ++Y   W     LEL      I++W   
Sbjct: 136 CGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEK 195

Query: 175 VPLPAWISIFWVILTISNLFP-VRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTG 232
           V    +++IF++++   NLF   R Y E EF+    K+  I GF I    ++CG AG +G
Sbjct: 196 VDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSG 255

Query: 233 PVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQT 292
            +G  YW NPG +       +    RF G  S+L+ AAF+F  TE + ITA E +NPR+ 
Sbjct: 256 YIGVSYWNNPGAF-----RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310

Query: 293 VPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSGTKILP 351
           +P A +KV++R L  Y+ S+  +G LVPY+  +L  S++S   +SP++IA+ + G +I P
Sbjct: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAP 370

Query: 352 HIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGA 411
           H  N VIL++++S  NS+ Y  SR+L  LAK G  PK+F    + G P+F ++  SL   
Sbjct: 371 HFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLAT 430

Query: 412 LAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFM 471
           +AF  +S    E F WLL + G++  F+W  I  +HIRF + ++ +G S N+L +K++  
Sbjct: 431 IAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVG 490

Query: 472 PYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
            + + YA  VM +I+  Q + A  P      ++ NFF  Y+++ +  +F+  ++ W K
Sbjct: 491 VWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  278 bits (711), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 162/491 (32%), Positives = 264/491 (53%), Gaps = 19/491 (3%)

Query: 51  ENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVY 110
           +N K E   +K+ +  RH                     L   GP GS I +L +G  VY
Sbjct: 83  QNAKHE--NLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVY 140

Query: 111 SVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQ 169
            V Q+ GE+A  +  +   F  +    + PALG A  ++Y   W   F LEL      I+
Sbjct: 141 CVIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIK 200

Query: 170 FW--TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG 227
           FW  + +V    +++IF+V++ + N F  R Y E EF+    KV  ++GF I    I  G
Sbjct: 201 FWPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTG 260

Query: 228 A-GKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEA 286
           A G +G +G +YWR+PG  G            F G  ++L+NAAF+   +E V +TA E 
Sbjct: 261 AVGTSGYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQ 315

Query: 287 ANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLK-SENSYVSSSPFIIAIENS 345
           ANPR+++P A +K++++I V ++ S+  IG LVP D  +L  S +S +  SP++IA+   
Sbjct: 316 ANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMH 375

Query: 346 GTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVF 405
           G  ++P   N VIL++++S GNS  Y  SRLL  LA+    PK+F    ++G P+ A++ 
Sbjct: 376 GVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMII 435

Query: 406 TSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLP 465
           + LFG + F+  S   +E F+WLL + G++  F+W  I  +HIRF + L  +G S ++L 
Sbjct: 436 SILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELG 495

Query: 466 FKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQ 521
           FKA+     +Y + I+M++ +  Q + +  P    + D  +FF  Y+++ +F +F+  ++
Sbjct: 496 FKAQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYK 555

Query: 522 LWFKCRYVWKL 532
           +W K    W+L
Sbjct: 556 IWNK---DWRL 563

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  278 bits (710), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 175/497 (35%), Positives = 271/497 (54%), Gaps = 18/497 (3%)

Query: 47  ENVSENEK----DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAY 102
           +++S+ EK      +  +K  L  RH                     L  +GP G LI +
Sbjct: 64  DDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGW 123

Query: 103 LFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELS 162
              GT++Y +  ++GE++   P++  FT ++ RF+  + G AN + Y   W     LE+ 
Sbjct: 124 GLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIV 183

Query: 163 VVGQIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYC 221
                + +W T       ++++FWV++ I NLF V+ YGE EF  + +KV  ++GFII  
Sbjct: 184 AASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMG 243

Query: 222 FCIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVG 280
             + CG G  G     +Y+ +PG +       + A ARF G  S  + AAF+F G+EL+G
Sbjct: 244 IVLNCGGGPEGGYIGGKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAGSELIG 298

Query: 281 ITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFI 339
           I A E+A PR++VPKA ++V +RI +FY+LSL  +GLLVPY D +L   +S   ++SPF+
Sbjct: 299 IAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFV 358

Query: 340 IAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVP 399
           IAI + G + LP + N VIL+ ++S GNS VY  SR L  LA+    PK+F    +SG P
Sbjct: 359 IAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRP 418

Query: 400 VFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGI 459
           +F + FTS FG +AF+  S    E F WLL + G++  F+W  I F HIRF   L ++G 
Sbjct: 419 LFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGR 478

Query: 460 SRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYISVFLFFIF 516
           S ++LPFKA    Y + +   +++++   Q + A  P   K     FF SY+S  +   F
Sbjct: 479 STDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAF 538

Query: 517 WGSFQLWFKCRYVWKLV 533
           +   +L+ +    WKL+
Sbjct: 539 YFGHKLYARN---WKLL 552

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  279 bits (714), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 152/523 (29%), Positives = 275/523 (52%), Gaps = 16/523 (3%)

Query: 11  TLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXX 70
            L G + I  K + S   ++L     K++  T    +  S+ ++ +   +K+ +  RH  
Sbjct: 99  NLNGSTPISTKDSSSRLDNELN---PKSSYITVDGIKQSSQEQEPKQENLKKSIKPRHTV 155

Query: 71  XXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT-FIPVTASF 129
                              L  +GP G +I Y  +G+ VY + Q+ GE+A  +  +   F
Sbjct: 156 MMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGF 215

Query: 130 TIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILT 189
             +    + PA+G +  +++   W     LEL      I++WT  V    ++ IF+V++ 
Sbjct: 216 NTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVIIFYVLIL 275

Query: 190 ISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTG 248
           + N+F  + Y E +F+    K+  I GF I    I CG AG  G +G RYWR+PG +   
Sbjct: 276 VINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAF--- 332

Query: 249 IISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFY 308
               + +  RF G  ++ + AAF F  +E + +TA E +NPR+ +P A +K+++RIL  +
Sbjct: 333 --RGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVF 390

Query: 309 ILSLFFIGLLVPY-DDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGN 367
           + SL  +G LVPY  D  L +  S   +SP++IA+ + G +++PH  N VIL++++S  N
Sbjct: 391 LASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVAN 450

Query: 368 SNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQW 427
           S  Y  SR+L  LAK G  PK F    + G P  A++ +++FG +AF  +S   ++ F W
Sbjct: 451 SAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTW 510

Query: 428 LLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIF 487
           LL + G++  F+W+ I  +HIRF + ++ +G S  ++ +K++   + + YA ++M++ + 
Sbjct: 511 LLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLALI 570

Query: 488 FQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
            Q + A +P     K    +FF +Y+++ +    +  +++W +
Sbjct: 571 GQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKR 613

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  278 bits (712), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 166/518 (32%), Positives = 273/518 (52%), Gaps = 25/518 (4%)

Query: 28  QHDLQGNEDKNTPTTTPSKENVSENEK-------DEYH------EVKRDLSKRHXXXXXX 74
            H+    + +N  TT  S   +S+ +K       DE         +K+ +  RH      
Sbjct: 80  NHNSAAEDLENELTTCVSPATLSDYKKSGDSGSVDELEGKTKEEHLKKSIKPRHVVMISL 139

Query: 75  XXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFS 133
                          L  +GP G  I Y  +G+ +Y + Q+ GEMA T+  +   F  + 
Sbjct: 140 GTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVTYSNLVGGFNAYP 199

Query: 134 HRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNL 193
              +SP LG A  ++YW  WA    LEL      I++WT  V    ++ IF+ ++ + N+
Sbjct: 200 SFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKYWTTKVNPDVFVVIFYFLIIVINV 259

Query: 194 FPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISS 252
           F  R Y E EF+    KV  I GF I    I CG AG  G +G +YW +PG +       
Sbjct: 260 FGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIGGKYWHDPGAF-----RG 314

Query: 253 NIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSL 312
           + A  RF G A++L+ AAF F G+E + +TA E +NPR+ +P A +K+++RI++ ++ S+
Sbjct: 315 DKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPAAAKKILYRIIIIFLGSI 374

Query: 313 FFIGLLVPYD-DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVY 371
             +G LVP++ D  + S++S   +SP++IAI + G +++PH  N VIL++++S GNS  Y
Sbjct: 375 IMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVRVVPHFVNAVILLSVLSVGNSAFY 434

Query: 372 IGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNV 431
             SR+L  L++ G  PK F    + G P  A+V  +LF  +AF   S+  ++ F WLL +
Sbjct: 435 SSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAFCAASSKEEDVFTWLLAI 494

Query: 432 VGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGF 491
            G++  F+W  I  +HIRF + +  +G S  ++ FK++   + +YYA  +M +++  Q +
Sbjct: 495 SGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMMFLVLIAQFW 554

Query: 492 TAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
              AP    K D  +FF SY+++ +   F+  +  W K
Sbjct: 555 VGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKK 592

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  275 bits (704), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 165/508 (32%), Positives = 265/508 (52%), Gaps = 23/508 (4%)

Query: 20  IKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXX 79
           +K  ++L+     GN D         + +  E   +    ++R   +RH           
Sbjct: 11  VKRVDTLDT----GNSDTQQNGEV-YELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAIG 65

Query: 80  XXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSP 139
                     L   GP   LIA++F G+++  V  SL EMA+F P+  SF+ ++ R++ P
Sbjct: 66  TGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDP 125

Query: 140 ALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIY 199
           ALG A G+ Y+  +A+  A ELS +G ++Q+W   + +  +I +F V+L   N   ++ Y
Sbjct: 126 ALGFATGWNYFLKYAIALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFMNIKFY 185

Query: 200 GEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPG--PW---GTGIISSN 253
           GE+EFW A LK   ++   +    + CG G +   +GFRYWR     P+   GT      
Sbjct: 186 GEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREYAFVPYLVKGT------ 239

Query: 254 IAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLF 313
               RFLGW + +I + + + G+E +G+  GEA NP++T+P A R V+FRI  FYI+ + 
Sbjct: 240 --TGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVL 297

Query: 314 FIGLLV-PYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYI 372
            +GL++ P+D     ++ S  S SPF+IA  N+G K LP   N ++++ I SA N+ +Y+
Sbjct: 298 ILGLIISPHDKTLANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYV 357

Query: 373 GSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVV 432
            SR  +GLAK+G  PK+F    + GVP    +   L   L+FM  S      F +L + V
Sbjct: 358 CSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSV 417

Query: 433 GVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFT 492
            V G  +WL +  ++I + +      + R+ +PF+  F PY AY     + +IIFF G++
Sbjct: 418 TVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYS 477

Query: 493 AFAPKFDVLNFFASYISVFLFF---IFW 517
           AF   F   +F  SYI + +F    +FW
Sbjct: 478 AFIAGFKYKSFIVSYIGIAVFIGNTLFW 505

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  278 bits (710), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 151/496 (30%), Positives = 265/496 (53%), Gaps = 16/496 (3%)

Query: 45  SKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLF 104
           +K  +S+ + +   ++K+ +  RH                     L  +GP G +I Y  
Sbjct: 84  AKVEISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAI 143

Query: 105 LGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSV 163
           + + +Y + Q++GEMA  ++ +   F  +    + PAL  +  ++Y   W     LEL  
Sbjct: 144 MASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVT 203

Query: 164 VGQIIQFWTFAVPLPAWISIFWVILTISNLFP-VRIYGEIEFWIAFLKVNAILGFIIYCF 222
               IQ+WT  V    ++ IF++++   N+F   R Y E EF     K+  ++GF I   
Sbjct: 204 ASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGI 263

Query: 223 CIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281
            I+CG AG  G +G +YWR+PG +       +    RF G  S+L+ AAF+F  TE + I
Sbjct: 264 VIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAI 318

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFII 340
           TA E +NPR+ +P A +KV++R L+ Y+ S+  +GLLVPYD  +L  S ++   +SP+++
Sbjct: 319 TASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVL 378

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           A+   G +++PH  N VIL+++ S  +S  Y  SR+L  LA+ G  PK+F    ++G P 
Sbjct: 379 AVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPS 438

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
              +  ++   +AF   S+   E F WLL + G++  F+W LI  +HIRF + ++ +G S
Sbjct: 439 LGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRS 498

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIF 516
            +++ +K++   + + YA ++MI+I+  Q +    P      DV  FF  Y+++ +F + 
Sbjct: 499 IDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVL 558

Query: 517 WGSFQLWFKCRYVWKL 532
           +  +++W   +  W+L
Sbjct: 559 YLGYKIW---KRDWRL 571

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  277 bits (709), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 260/473 (54%), Gaps = 17/473 (3%)

Query: 60  VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEM 119
           +KR L  RH                     L I GP   +IA++  G++VYSV Q+LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 120 ATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPL-P 178
           A  +PV+ S+  +  RF+ P+ G A  Y Y     +T  LEL      + +W        
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYAD 208

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT--GPVGF 236
           A++++F++++   NLF V+ YGE EF  + +KV AI+GFII    +VCG G +  G +G 
Sbjct: 209 AFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGA 268

Query: 237 RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKA 296
           RYW NPG +  G          F G+A+  + +AF+F G+E+  + A E  NPR+ +P+A
Sbjct: 269 RYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRA 318

Query: 297 IRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSGTKILPHIFN 355
            ++V +RI +FY++SL  IG LVPY D  L  + +   S+SPF+IAI  +G K LP + N
Sbjct: 319 AKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVN 378

Query: 356 GVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFM 415
            VIL+ ++S GN  VY  SR +  LA  G  P+ F    + G P+  ++  ++FG L+F+
Sbjct: 379 VVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFL 438

Query: 416 ETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLA 475
             S+   E F W+L + G+  FF W  I   H+RF + L  +G S ++L +KA+   + +
Sbjct: 439 SASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGS 498

Query: 476 YYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
            Y   ++ I++ FQ + A  P     +  +FF++Y+S+ +   F+   +L+ +
Sbjct: 499 LYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTR 551

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  279 bits (713), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 158/521 (30%), Positives = 272/521 (52%), Gaps = 19/521 (3%)

Query: 21  KSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDE----YHEVKRDLSKRHXXXXXXXX 76
           +  +++    +  N+  ++  T   + ++ ++   +     H +K+ L  RH        
Sbjct: 119 EKDDAIRMEKISKNQSASSNGTVREELDLEKSPSADGDAGPHRLKQGLQSRHVQLIALGG 178

Query: 77  XXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSH-- 134
                      + L   GP G  I+Y+ +  V+Y +  +LGEM  F+P   S +  S   
Sbjct: 179 AIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSSAN 238

Query: 135 ---RFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTIS 191
              R++  +LG A G+ Y++ + +  A E +    ++++WT AVP   WI+IF  ++ + 
Sbjct: 239 LVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVLL 298

Query: 192 NLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVGFRYWRNPGPWGTGII 250
           N   V++YGE EFW A +K+  I+G II  F +  G G K   +GFRYW++PG +   + 
Sbjct: 299 NFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGSFAHHLA 358

Query: 251 SSNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYI 309
             ++    F    + +I  AF F  G ELV +T+ E A+ R+ + KA R+ V+R++ FY+
Sbjct: 359 GGSLGN--FTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYV 416

Query: 310 LSLFFIGLLVPYDDVKL----KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISA 365
           L    I ++VPY+D  L            SSP++I I+N+G K+LPHI NG IL +  SA
Sbjct: 417 LGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPHIINGCILTSAWSA 476

Query: 366 GNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAF 425
            N+ ++  +R L  +A+ G  PK   K  + GVP  AV  + L   LA++  S+   + F
Sbjct: 477 ANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLNVSSSTADVF 536

Query: 426 QWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIII 485
            W  N+  ++GF  W+    A++RF + +   G+  + LPFK    PY  +++  V+ II
Sbjct: 537 NWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKTWGQPYTVWFSLTVVSII 595

Query: 486 IFFQGFTAFAPKF-DVLNFFASYISVFLFFIFWGSFQLWFK 525
               G+  F PK+ +V +F A+YI++ +F + W   +L+ +
Sbjct: 596 TITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTR 636

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  276 bits (706), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 166/533 (31%), Positives = 280/533 (52%), Gaps = 21/533 (3%)

Query: 3   ILDINTEETLEGKSKIVIKSTESLEQ---HDLQGNEDKNTPTTTPSKENVSE---NEKDE 56
           IL+ ++  +L  + + +  ++  LE+    D   N D +      ++  +SE   NE   
Sbjct: 39  ILEYDSNSSLRIEKETLTFNSSKLEECKIEDKISNFDLSQIGYNGNETIISEELINEDGR 98

Query: 57  YHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSL 116
            +++K+ L+ RH                     L   GP G + +YL + T+VY +   L
Sbjct: 99  KNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYPIMNVL 158

Query: 117 GEMATFIPVTASFTIFS-----HRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW 171
           GEM  ++P   S +  S      R+L  +L  A G+ Y++ + M  A E +    ++++W
Sbjct: 159 GEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASGVVEYW 218

Query: 172 TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT 231
           T  VP PAWI +F +I+   N+ PVR+YGE EFW A  K+  I+G II  F +  G G  
Sbjct: 219 TKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFILFWGGGPN 278

Query: 232 -GPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANP 289
              +GFRYW  PG +   I  +N +   FL     +I  AF+F  G ELV + + E ++P
Sbjct: 279 HDRLGFRYWITPGSFANTI--TNGSFGNFLDVYKGIILGAFSFILGPELVVLPSSECSDP 336

Query: 290 RQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDD----VKLKSENSYVSSSPFIIAIENS 345
           R+ + KA ++ ++R++ FYIL    I ++V Y+D      L  +     SSPF+I I+N+
Sbjct: 337 RRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSPFVIGIQNA 396

Query: 346 GTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVF 405
           G  +LPHI N  IL++  S+GN+ ++  SR L  +A N   PK   K  + GVP  AV+ 
Sbjct: 397 GIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFGVPYVAVIV 456

Query: 406 TSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLP 465
           + +   +A++  S    + F+W  N+  ++GF  W+++S  ++RF + ++  G+ ++ LP
Sbjct: 457 SIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYHGM-KDRLP 515

Query: 466 FKAKFMPYLAYYATIVMIIIIFFQGFTAFAPK-FDVLNFFASYISVFLFFIFW 517
           +     PYL  Y+ I  III    GF    P+ ++V +F A+Y+++ +F + W
Sbjct: 516 YTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMIW 568

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  275 bits (704), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 174/537 (32%), Positives = 269/537 (50%), Gaps = 26/537 (4%)

Query: 5   DINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDL 64
            I++ +  +G    V +   +      + N D  T   +   E  S N      + K+ +
Sbjct: 29  SISSNDLSDGDRGFVNRKLHNFCNSFKRANSD--TFDASQDLEGASINSVRSNSKFKQSM 86

Query: 65  SKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP 124
             RH                     L   GP G LI Y  +  V Y + Q+ GEMA   P
Sbjct: 87  KSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQAAGEMAVAYP 146

Query: 125 -VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISI 183
            +  +F ++S  F+S + G A  ++Y   W     LEL      I++W  ++   A+I+I
Sbjct: 147 TLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYWNSSINPDAFIAI 206

Query: 184 FWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF-RYWRNP 242
           F+ ++   + F    YGE EF  +  KV+ I GFII    I CG   TG      YWRNP
Sbjct: 207 FYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTGGYIGGEYWRNP 266

Query: 243 GPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVF 302
           G +  G   S I    F G A  L+ A F++ G EL  +T  E ANPR+ VP A +K ++
Sbjct: 267 GAFAGG---SPIG--HFKGIAYVLVTAYFSYGGMELFALTVNEQANPRKAVPSATKKCIY 321

Query: 303 RILVFYILSLFFIGLLVPY--DDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILV 360
           RIL+ Y+L++  IG LVPY  D++   S  S   +SP++IA+ + G K++PHI N VIL+
Sbjct: 322 RILIIYMLTMILIGFLVPYNSDELMGSSGKSATHASPYVIAVASHGVKVVPHIINAVILI 381

Query: 361 TIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTG 420
           +++S GNS +Y   RLL  LA+ G  PK+F+   ++G P+ A+V  S+FG L+F+  S  
Sbjct: 382 SVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCSIFGLLSFVAASDK 441

Query: 421 GDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATI 480
            ++ F WL  + G++  F+W  I  +H+RF   ++ +G S ++L +K+K   + + YA  
Sbjct: 442 EEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYKSKTGYWGSIYAIF 501

Query: 481 VMIIIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
             II+   Q + A AP     K D   FF SY+          +F +W  C   +K+
Sbjct: 502 FNIIVFVAQFWVALAPIGNGGKADAEAFFQSYL----------AFPIWISCYVGYKI 548

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  275 bits (704), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 161/536 (30%), Positives = 280/536 (52%), Gaps = 36/536 (6%)

Query: 24  ESLEQHDLQGNEDKN--------TPTTTPSKENVSENEKDEYHE------------VKRD 63
           +S ++ D QG +D++        T   +PS  N    EK++  +            +K+ 
Sbjct: 61  DSFKRAD-QGGQDESEAVQMNDLTSAISPSSRNAQGLEKNDSTDKINPPAGNKSGSLKKT 119

Query: 64  LSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TF 122
           +  RH                     L+ +GP G LI Y  +G+++Y + Q+ GE+A  +
Sbjct: 120 IQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGELALVY 179

Query: 123 IPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWIS 182
             +T  +  +    +    G A  ++Y   W     LEL      I++WT +V    ++ 
Sbjct: 180 SNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVI 239

Query: 183 IFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRYWRN 241
           IF+V++   N+F  R Y E EF+    K+  + GF I    I V GAG  G +G +YW +
Sbjct: 240 IFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWHD 299

Query: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVV 301
           PG +     +   +  RF G  ++L+ AAF F G+E + IT  E +NPR+ +P A ++++
Sbjct: 300 PGAF-----NGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMI 354

Query: 302 FRILVFYILSLFFIGLLVPYD-DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILV 360
           +RIL  ++ ++  +G LVPY+ D  L S      +SP++IAI + G +++PH  N VIL+
Sbjct: 355 YRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPHFVNAVILL 414

Query: 361 TIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTG 420
           +++S  NS+ Y  +RL   L++ G  PK F+   ++G P+ A+  ++LF  +AF   S  
Sbjct: 415 SVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPK 474

Query: 421 GDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATI 480
            ++ F WLL + G++  F+W  I F+HIRF + ++ +G S  +L FK++   + + YA I
Sbjct: 475 EEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMYACI 534

Query: 481 VMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
           +M++I+  Q + A AP    K D   FF +Y+++ +    +  +++W K    WKL
Sbjct: 535 MMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTK---DWKL 587

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  275 bits (703), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 158/497 (31%), Positives = 266/497 (53%), Gaps = 15/497 (3%)

Query: 46  KENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFL 105
           +++ S +  +E  ++K+ L  RH                   + L   GP G  I+Y+ +
Sbjct: 91  EKSPSADGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIII 150

Query: 106 GTVVYSVTQSLGEMATFIPVTASFTIFSH-----RFLSPALGAANGYMYWFSWAMTFALE 160
             V+Y +  +LGEM  F+P   S +  S      R++  +LG A G+ Y++ + +  A E
Sbjct: 151 SAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAE 210

Query: 161 LSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIY 220
            +    ++++WT AVP   WI++F +++ + N   V++YGE EFW A +K+  I+G II 
Sbjct: 211 CTAASGVVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIIL 270

Query: 221 CFCIVCGAG-KTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTF-QGTEL 278
            F +  G G K   +GFRYW++PG +   +   ++    F    + +I  AF F  G EL
Sbjct: 271 SFILFWGGGPKHDRLGFRYWQHPGAFAHHLTGGSLGN--FTDIYTGIIKGAFAFILGPEL 328

Query: 279 VGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDV----KLKSENSYVS 334
           V +T+ E A+ R+ + KA R+ V+R++ FY+L    I ++VPY+D      L        
Sbjct: 329 VCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAG 388

Query: 335 SSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTT 394
           SSPF+I I+N+G K+LPHI NG IL +  SA N+ ++  +R L  +A+ G  PK   K  
Sbjct: 389 SSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKIN 448

Query: 395 KSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCL 454
           + GVP  AV  + L   LA++  S+   + F W  N+  ++GF  W+    A++RF + +
Sbjct: 449 RWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAI 508

Query: 455 QSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKF-DVLNFFASYISVFLF 513
              G+  + LPFK    PY  +++ IV+ II    G+  F PK+  V +F A+Y+++ +F
Sbjct: 509 FYNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIF 567

Query: 514 FIFWGSFQLWFKCRYVW 530
            + W   +L+ +  + W
Sbjct: 568 LVLWLGHKLYTRTWHQW 584

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  274 bits (701), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 173/550 (31%), Positives = 279/550 (50%), Gaps = 40/550 (7%)

Query: 11  TLEGKSKIVIKSTESLEQHDL--------QGNEDKNTPTTTPSK---------------- 46
           +LE K   V    E LE  D+         G    + PT++ S+                
Sbjct: 2   SLEDKKNFVYAQEEPLEGRDVGHSSYETGSGEITDSKPTSSGSRWQDFVDGFKRVELGDL 61

Query: 47  -ENVSENEK----DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIA 101
             N+++ EK         ++R L  RH                   + L   GP   LI 
Sbjct: 62  DPNLTQAEKVAIATARSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIG 121

Query: 102 YLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALEL 161
           +  +G ++YSV  ++GE+A   PV   FT +  RF+  + G A  Y+Y   W +   LE+
Sbjct: 122 WGLIGLMIYSVVMAMGELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEI 181

Query: 162 SVVGQIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIY 220
                 + +W T A     ++++F+V++ I N+F V+ YGE EF  + +KV  ++GFII 
Sbjct: 182 VAASITVNYWGTPAKYRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIIL 241

Query: 221 CFCIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELV 279
              ++CG G  G     +YW NPG +     + + A  RF    S  + AAF+F GTELV
Sbjct: 242 GIVLICGGGPVGGYVGGKYWHNPGAF-----NGDNAGQRFKAVCSVFVTAAFSFAGTELV 296

Query: 280 GITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPF 338
           G+ A E  NPR+ +P+A ++V +RI +FYI+SL  IGLLVPY    L   +S   ++SPF
Sbjct: 297 GLAAAETENPRKALPRAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPF 356

Query: 339 IIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGV 398
           ++AI+  G   LP + N VIL++++S GNS+VY  SR L  LA  G  P++F+   + G 
Sbjct: 357 VLAIKTHGISGLPSVINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGR 416

Query: 399 PVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRG 458
           P+  ++ T  FG L F+  S    + F WL+ + G++  F+W  I   H+RF + L ++G
Sbjct: 417 PLVGILATCTFGLLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQG 476

Query: 459 ISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLN---FFASYISVFLFFI 515
            S ++L F +    + +Y+  I++ ++   Q + A  P     N   FF +Y+SV +   
Sbjct: 477 RSTDELAFTSYVGVWGSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLF 536

Query: 516 FWGSFQLWFK 525
           F+ + +L+ +
Sbjct: 537 FYLAHKLYTR 546

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  273 bits (699), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 157/486 (32%), Positives = 261/486 (53%), Gaps = 14/486 (2%)

Query: 47  ENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLG 106
           E    N KD   ++ +DLS RH                   + L   GP   +IA+  + 
Sbjct: 53  EKAIYNTKDS--KLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIIS 110

Query: 107 TVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQ 166
           T ++++  SLGE++   PV   F ++  RF+ P+ G A  + Y   WA+   LEL     
Sbjct: 111 TCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASI 170

Query: 167 IIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVC 226
            I++W  ++   AW+SIF+V +  +N+  V+ +GE EF ++ +K+ AI+GF I    ++C
Sbjct: 171 TIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLIC 230

Query: 227 GAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGE 285
           G G +G     +YW +PG +       +    RF G ++  I AAF++ G ELVG++A E
Sbjct: 231 GGGPSGGFIGGKYWNDPGAF-----VGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAE 285

Query: 286 AANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYV--SSSPFIIAIE 343
           + NPR T+PKA ++  + I + Y++ L  IG LVP +D  L +  S V  ++SP +IAI+
Sbjct: 286 SRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQ 345

Query: 344 NSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAV 403
           N G K LP + N +IL+ ++S  NS VY  SR +  +A+ G  P+  A   K G P++A+
Sbjct: 346 NGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAI 405

Query: 404 VFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRND 463
             T L G L+F+  S   DE F WL  + G++  F W  I+ AH+RF   ++ +  S  +
Sbjct: 406 AITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEE 465

Query: 464 LPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPK----FDVLNFFASYISVFLFFIFWGS 519
           LP+ +    + ++Y  IV+ +++    +T+  P      D  +FF SY+S+ +F   +  
Sbjct: 466 LPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLG 525

Query: 520 FQLWFK 525
            ++W +
Sbjct: 526 HKIWKR 531

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  274 bits (700), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 158/474 (33%), Positives = 252/474 (53%), Gaps = 14/474 (2%)

Query: 59  EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118
            ++R +  RH                     L   GP G +I Y  +  V Y + Q+ GE
Sbjct: 78  RLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQAAGE 137

Query: 119 MATFIP-VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPL 177
           MA   P +  +F  +S  F+S   G A+ ++Y   W   F LEL      I++WT +V  
Sbjct: 138 MAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWTDSVNA 197

Query: 178 PAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGF 236
             +I+IF+V +   + F  R YGE EF     KV  I GF+I    I CG AG +G +G 
Sbjct: 198 DVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSGYIGA 257

Query: 237 RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKA 296
           RYW +PG +  G  +S     +F G+   L+   F++ GTEL  +T  E ++PR+ +  A
Sbjct: 258 RYWHDPGAFAVGDPAS-----KFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRAIHSA 312

Query: 297 IRKVVFRILVFYILSLFFIGLLVPY--DDVKLKSENSYVSSSPFIIAIENSGTKILPHIF 354
            ++ ++RILV Y+L++  IG LVP+  D++      S   +SP+++A+   G K++PHI 
Sbjct: 313 TKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGVKVVPHIV 372

Query: 355 NGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAF 414
           N VIL+ ++S GNS +Y G R+L  LA+ G  PK  A   ++G P+ A++  S+ G LAF
Sbjct: 373 NAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVIGLLAF 432

Query: 415 METSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYL 474
           +  S   ++ F WL  + G++  F+W  I  +HIRF Q ++  G S + L +K+    + 
Sbjct: 433 VAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSITGLWG 492

Query: 475 AYYATIVMIIIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLW 523
           + Y     I++   Q + A AP     K DVL+FF SY++  L+F+F+  + ++
Sbjct: 493 SIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMVY 546

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  273 bits (699), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 166/472 (35%), Positives = 258/472 (54%), Gaps = 14/472 (2%)

Query: 48  NVSENEKDEYHE----VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYL 103
           N+SE ++  +      ++  L  RH                     L  +GP G LI + 
Sbjct: 65  NMSELDQIAFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWG 124

Query: 104 FLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSV 163
             GT++YS+  +LGE+A   PV+  FT ++ RF+  + G AN   Y   W +   LE+  
Sbjct: 125 LTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVA 184

Query: 164 VGQIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCF 222
               + +W T       ++++FW+ + I NLF V+ YGE EF  + +KV  ++GFII   
Sbjct: 185 ASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGI 244

Query: 223 CIVCGAGKT-GPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281
            + CG G   G +G RYW +P     G    + A ARF G  S  + AAF+F G+ELVG+
Sbjct: 245 ILNCGGGPVKGYIGGRYWHHP----YGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGL 300

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFII 340
            + E ANPR++VPKA ++V +RI +FY+L+L  +GLLVPY + +L   +S   ++SPF+I
Sbjct: 301 ASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPFVI 360

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           AI   G + LP + N VIL+ ++S GNS +Y  SR L  LA+    PK F    +SG P+
Sbjct: 361 AITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPL 420

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
           ++++ TS FG +AF+  S    E F WLL + G++  F+W  I   HIRF + L ++G  
Sbjct: 421 YSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRG 480

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYIS 509
            ++L F +    Y +Y+   ++I++   Q + A  P   K +   FF +Y+S
Sbjct: 481 TDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLS 532

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  273 bits (698), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 163/480 (33%), Positives = 263/480 (54%), Gaps = 14/480 (2%)

Query: 60  VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEM 119
           ++R L  RH                     L  +GP G LI +  + T++  +  SLGEM
Sbjct: 84  LQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEM 143

Query: 120 ATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW-TFAVPLP 178
           A   PV+  +T ++ RF+  + G AN   Y     +   LE+      + +W   +    
Sbjct: 144 AVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQYRA 203

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFR 237
           A++++FW+ +   N+F V+ YGE EF  + +KV  ++GFII    +VCG G T   +G +
Sbjct: 204 AFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGSK 263

Query: 238 YWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAI 297
           +W NPG +       + A  +F G  S  + AAF+F  TELVG+ A E  +PR++VPKA 
Sbjct: 264 FWSNPGAF-----VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVPKAA 318

Query: 298 RKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSGTKILPHIFNG 356
           ++V +RI +FYILSL  +GLLVPY D +L  S     ++SPF++A++N G K LP + N 
Sbjct: 319 KQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSVINV 378

Query: 357 VILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFME 416
           VIL  ++S GNS+V+  SR L  L++ G  P +F    + G P+ +++F+S FG L F+ 
Sbjct: 379 VILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLCFLA 438

Query: 417 TSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAY 476
            S    E F W+L++ G++  F WL IS  HIRF + L ++  S ++L F +    + +Y
Sbjct: 439 VSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIWGSY 498

Query: 477 YATIVMIIIIFFQGFTAFAP---KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLV 533
           Y+  ++I+++  Q + A  P   K    NFF +Y+S+ +    +   +++ K    WKL+
Sbjct: 499 YSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKN---WKLL 555

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  273 bits (697), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 153/490 (31%), Positives = 264/490 (53%), Gaps = 18/490 (3%)

Query: 51  ENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVY 110
           +N+ +E  ++K+ +  RH                     L  +GP G +I Y  + T +Y
Sbjct: 92  DNQINE--KLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIY 149

Query: 111 SVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQ 169
            V Q++GEMA  ++ +   F+ +    + P L  A  ++Y   W     LEL      IQ
Sbjct: 150 CVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQ 209

Query: 170 FWTFAVPLPAWISIFWVILTISNLFP-VRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG- 227
           +WT  V    ++ IF++++   N+F   R Y E EF+    K+  + GF I    ++CG 
Sbjct: 210 YWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGG 269

Query: 228 AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAA 287
           AG +G +G RYW +PG +       +    RF G  S+L+ AAF F GTE + ITA E A
Sbjct: 270 AGNSGFIGARYWHSPGAF-----RGDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQA 324

Query: 288 NPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSG 346
           NPR+ +P A +KV++R L+ Y+ S+  +G LVPY+  +L  S      +SP++IA+ + G
Sbjct: 325 NPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASHG 384

Query: 347 TKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFT 406
            +++PH  N VIL+++ S  +S  Y  SRLL  LA+ G  PK+F    K G P    V  
Sbjct: 385 IRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVG 444

Query: 407 SLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPF 466
           ++   ++F   S+   + F WLL++ G++  F+W +IS +HIRF + ++ +G S +++ F
Sbjct: 445 AIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGF 504

Query: 467 KAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQL 522
           K++   + + YA ++MI+++  Q +    P      D ++FF +Y+++ +F + +  +++
Sbjct: 505 KSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKI 564

Query: 523 WFKCRYVWKL 532
           W +    W+L
Sbjct: 565 WNR---DWRL 571

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  272 bits (696), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 164/493 (33%), Positives = 260/493 (52%), Gaps = 20/493 (4%)

Query: 48  NVSENEK----DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYL 103
           N+SE EK         + R L  RH                     L  +GP G LI + 
Sbjct: 67  NLSEAEKLAIRTAAAPLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWG 126

Query: 104 FLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSV 163
              T++  +  SLGE+A   PV+  +  ++ RF+  + G AN + Y     +   LE+  
Sbjct: 127 LTATMILIMCLSLGELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVA 186

Query: 164 VGQIIQFWTFAVPLP-AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCF 222
               + +W        A++++FWV++   NLF VR +GE E   + +KV  I+GFII   
Sbjct: 187 ASVTVGYWDTDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGV 246

Query: 223 CIVCGAGKTGPV-GFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281
            ++ G G    V G +YW +PGP+       N    +F G  S  + AAF+F G+EL+G+
Sbjct: 247 VLISGGGPDHEVIGGKYWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGL 301

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFII 340
            A E   PR+++PKA ++V +RI +FYILSL  +GLLVP ++  L +      + SPF+I
Sbjct: 302 AAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVI 361

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           A++    ++LP I N VIL  +IS GNS+VY  SR +  LA++G  PK+F    + G P+
Sbjct: 362 AMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPL 421

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
           FA+ FTSLFG L F+  +    E F WLL + G++ FF+WL I+ AH+RF   L+++G +
Sbjct: 422 FAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRT 481

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP--------KFDVLNFFASYISVFL 512
            N+L F +      + YA  ++ +++  Q + A  P        K   + FF  Y+S  +
Sbjct: 482 TNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAV 541

Query: 513 FFIFWGSFQLWFK 525
             + + + ++W +
Sbjct: 542 AIVMYLAHKIWSR 554

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  271 bits (693), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 169/536 (31%), Positives = 279/536 (52%), Gaps = 30/536 (5%)

Query: 7   NTEETLEGKSKIVIKSTES------LEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEV 60
           + +  LEGKS     ST+S      L++ D  G E  N  T+T S  +V+         +
Sbjct: 23  DEKSILEGKS-----STQSSLLDLTLKKCD-NGIEVVNDATSTVSNASVTN------VNL 70

Query: 61  KRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA 120
            ++LS RH                     L   GP   +I ++ + T +++V  +LGEMA
Sbjct: 71  NKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGEMA 130

Query: 121 TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAW 180
              PV   F ++  RF+ P++G A    Y   W +   LEL      I++W   +   AW
Sbjct: 131 AAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDTINSDAW 190

Query: 181 ISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF-RYW 239
           ++IF+ ++  +N+  V+ +GE EF ++ +K+ AI+GF I    + CG G  G     +YW
Sbjct: 191 VAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLGGKYW 250

Query: 240 RNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRK 299
            NPG +       + +  +F G  S  + AAF++ G E+  ++A E+ +PR+T+PKA ++
Sbjct: 251 HNPGSF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKR 305

Query: 300 VVFRILVFYILSLFFIGLLVPYDDVKLKSENSYV--SSSPFIIAIENSGTKILPHIFNGV 357
             + I   YI  L  IG LVPYD+ +L S +S V  +SSP +IAIEN G K LP + N +
Sbjct: 306 TFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLPSLMNAI 365

Query: 358 ILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMET 417
           IL++IIS  NS VY  SR +  +A  G  P++     K G PV A++FT  FG L+F+  
Sbjct: 366 ILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAA 425

Query: 418 STGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYY 477
           S    E F WL  + G++  F W+ I+ +HIRF Q ++ +  S ++LP+ ++   + ++Y
Sbjct: 426 SDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWY 485

Query: 478 ATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529
             IV+ +++    +T+  P      D  +FF  Y+S  +    +   +L ++ + +
Sbjct: 486 GVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQI 541

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  271 bits (692), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 161/481 (33%), Positives = 263/481 (54%), Gaps = 20/481 (4%)

Query: 60  VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEM 119
           +KR L  RH                     L I GP   ++A++  G++VYSV Q++GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 120 ATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPL-P 178
              +PV+ S+  +  RF+ P+ G A  Y Y     +T  LE+      + +W        
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG--KTGPVGF 236
            ++++F+V + + N   V+ YGE EF  + +KV AI+GFII    +VCG G   TG +G 
Sbjct: 204 GFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGT 263

Query: 237 RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKA 296
           +YW NPG +  G          F G+A+  + +AF+F G+E+  + A E+ NPR+ +PKA
Sbjct: 264 KYWHNPGGFAHG----------FKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKA 313

Query: 297 IRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSGTKILPHIFN 355
            ++V +RI +FY++SL  IG LVPY +  L  S +   S+SPF+IAI+ +G   LP + N
Sbjct: 314 AKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSVIN 373

Query: 356 GVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFM 415
            VILV ++S GN+ V+  SR    LA  G  PK FA   + G P+  ++ + +FG L+F+
Sbjct: 374 VVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFL 433

Query: 416 ETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLA 475
            +S      F+W+L V G+  FF+W  I   H+RF Q L+++G S ++L FKA+   + +
Sbjct: 434 SSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGS 493

Query: 476 YYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
            Y   ++ +++ FQ + A  P        +FF  Y+S+ +  +F+   +++ +    W+L
Sbjct: 494 IYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRN---WRL 550

Query: 533 V 533
           V
Sbjct: 551 V 551

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  271 bits (693), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 160/510 (31%), Positives = 265/510 (51%), Gaps = 14/510 (2%)

Query: 25  SLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXX 84
            ++   LQG  D           N  E     + E K+ +  RH                
Sbjct: 58  QVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLV 117

Query: 85  XXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASFTIFSHRFLSPALGA 143
                L ++GP   +IAY  +  V Y + Q+ GEMA   P +  SF  ++  F+S   G 
Sbjct: 118 SNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGF 177

Query: 144 ANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIE 203
           A  +++   W     LEL      I++W  ++    ++ IF+V L   + F V+ YGE E
Sbjct: 178 ATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETE 237

Query: 204 FWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGW 262
           F     K+  I GFII+   + CG AGK G +G +YW +PG +     SSN A +RF G 
Sbjct: 238 FIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFA----SSNGA-SRFKGI 292

Query: 263 ASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD 322
             +L+NA F++ G EL  ++  +  NPR++ P A +  V+RI+V Y+L++  IG +VP++
Sbjct: 293 CYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHN 352

Query: 323 DVKL--KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGL 380
             +L   S  + + +SP+++A    G K++PHI N VIL+ +IS  NS++Y G RLL  L
Sbjct: 353 SSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSL 412

Query: 381 AKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSW 440
           A+ G  P+  +   + G P+ A++ ++L G + F  TS   +E F WL  + G++  F+W
Sbjct: 413 AQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTW 472

Query: 441 LLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---- 496
             I F+HIRF + ++ +  S + L +KA    + +Y+     I++   Q + A +P    
Sbjct: 473 TSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSG 532

Query: 497 -KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
            K D  +FFASY+++ ++ +F+  +  W+K
Sbjct: 533 GKCDANSFFASYLAMPIWLVFYFGYMCWYK 562

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  270 bits (689), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 167/528 (31%), Positives = 277/528 (52%), Gaps = 27/528 (5%)

Query: 7   NTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSK 66
           N++E ++ K    I   +  E+HD+   E+         K  V  N++ +   +K+ L +
Sbjct: 10  NSQEKVKPK----IYEEDVDEEHDIVSVEET-------VKRGVLHNDRTK---LKQGLKE 55

Query: 67  RHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVT 126
           RH                     L  +GPVG LIAYLF+G VV     ++ E+A+F+P T
Sbjct: 56  RHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPAT 115

Query: 127 ASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWV 186
            +    + +F+  ++G   G++  +S  M    ELS    I+++WT   P   +I++F +
Sbjct: 116 GATIRHAEQFIDESVGFTFGWISTYSSLM--PGELSATAVIMRYWTDVSP-AVFITVFGI 172

Query: 187 ILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGK-TGPVGFRYWRNPGPW 245
           +  ++N++ +R YGE+E+   +LK+  I   II    I  G  K    +GF YWR PGP+
Sbjct: 173 LFVVTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWREPGPF 232

Query: 246 GTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRIL 305
              ++  +I   +F+G+ +++ +  +++ G + + I AGE  N R  +    + V  RI+
Sbjct: 233 ANYLVGGHIG--KFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRII 290

Query: 306 VFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISA 365
           V Y++++F + L+VPY+D  + +      SSPF+IA+  +G K+LPHI N +IL +  SA
Sbjct: 291 VLYLVTVFILTLIVPYNDKLIATGTGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSA 350

Query: 366 GNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAF 425
           GN  +  GSR LF LA     PK+F +T+K G+P   V+F S F  LA+M  S      F
Sbjct: 351 GNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVF 410

Query: 426 QWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIII 485
            W   +V       W+LIS  HI   + L+++G SR+DLP+     P+ A+++ I+  I 
Sbjct: 411 GWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIF 470

Query: 486 IFFQGFTAF-APKFDVLNFFASYISVFL---FFIFWGSFQLWFKCRYV 529
           +   GF  F    FD+ +FF  Y  + L    F FW   +L+ K +Y+
Sbjct: 471 LLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFW---KLFKKTKYL 515

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  270 bits (691), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 162/524 (30%), Positives = 269/524 (51%), Gaps = 21/524 (4%)

Query: 20  IKSTESLEQHDLQ----GNEDKNTP-----TTTPSKENVSENEKDEYHEVKRDLSKRHXX 70
           I +  +LE+ D       + D   P     TTT     +S  +      + ++LS RH  
Sbjct: 26  IDANFALEEKDSTLSPLASLDSKVPHEKIQTTTDFASVISHEDDINNVNLNKNLSIRHLL 85

Query: 71  XXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFT 130
                              L   GP   +I ++ + T +++V  +LGEMA   PV   F 
Sbjct: 86  TLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGGFN 145

Query: 131 IFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTI 190
           ++  RF+ P++G A    Y   W +   LEL      I++W   +   AW++IF+ ++ +
Sbjct: 146 VYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNETINSDAWVAIFYCVIAL 205

Query: 191 SNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF-RYWRNPGPWGTGI 249
           +N+  V+ +GE EF ++ +K+ AI+GF I    + CG G  G     +YW +PG +    
Sbjct: 206 ANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSF---- 261

Query: 250 ISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYI 309
           +  N +  +F G  S  + AAF++ G E+  ++A E+ +PR T+PKA ++  + I   Y+
Sbjct: 262 VGHN-SGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASYV 320

Query: 310 LSLFFIGLLVPYDDVKLKSENSYV--SSSPFIIAIENSGTKILPHIFNGVILVTIISAGN 367
             L  IG LVPYDD +L S  S V  +SSP +IAIEN G K LP + N +IL++IIS  N
Sbjct: 321 TILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLMNAIILISIISVAN 380

Query: 368 SNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQW 427
           S VY  SR +  +A  G  P++  +    G P+ A++FT  FG L+F+  S    + F W
Sbjct: 381 SAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTW 440

Query: 428 LLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIF 487
           L  + G++  F W+ I+ +HIRF Q +  +  S ++LPF ++   + ++Y TIV+ +++ 
Sbjct: 441 LSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVLV 500

Query: 488 FQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCR 527
              +T+  P      D  +FF  Y+S  +    +   +L+ + R
Sbjct: 501 ASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKR 544

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  271 bits (694), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 264/508 (51%), Gaps = 19/508 (3%)

Query: 32  QGNEDKNTPTTTPSKENVSE-------NEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXX 84
           Q  E+  T + +PS  N+ +        + ++   +K+ +  RH                
Sbjct: 95  QALENGITTSVSPSAPNLRKLNQLRTPTDANDNKALKQTIRPRHVVMISLGTGIGTGLLV 154

Query: 85  XXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGA 143
                L  +GP G +I Y  +G+++Y + Q+ GEMA  +  +   + ++    +    G 
Sbjct: 155 GNGTALKNAGPAGLVIGYSIMGSIIYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGF 214

Query: 144 ANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIE 203
           A  ++Y   W     LEL      I++WT +V    +++IF+ ++ I N+F  + Y E E
Sbjct: 215 AIAWVYCIQWLTVCPLELVTASLTIKYWTTSVNSDIFVAIFYALIIIINVFGAKGYAEAE 274

Query: 204 FWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGW 262
           F+    KV  ++GF I    I  G AG  G +G  YW  PG +       + +   F G 
Sbjct: 275 FFCNCCKVLMMIGFFILSITITAGGAGNDGYLGGLYWHTPGAF-----RGDSSIDHFKGI 329

Query: 263 ASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD 322
             +L+ AAF + GTE + +TA E +NPR  +P A +KV++RI+  Y++S+  IG LVP+D
Sbjct: 330 CGTLVTAAFAYGGTEFLALTAAEQSNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFD 389

Query: 323 DVKL-KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLA 381
             +L  S+ S  S+SP+++A    G +++PH  N VIL++++S GNS  Y  SRLL  LA
Sbjct: 390 STRLLGSDGSATSASPYVLAASLHGVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLA 449

Query: 382 KNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWL 441
           + G  PK F    + G P  A++ ++LFG +AF   S    E F WLL + G++  F+W 
Sbjct: 450 RQGYAPKWFDYIDREGRPARAMLMSALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWC 509

Query: 442 LISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----K 497
            I  +HIRF   ++ +G S  ++ + A+   + ++YA  +M +I   Q + A AP    +
Sbjct: 510 AICLSHIRFRTAMKVQGRSLGEVGYLAQTGVWGSWYALFMMFLIYIAQFWVAIAPIGSGE 569

Query: 498 FDVLNFFASYISVFLFFIFWGSFQLWFK 525
               NFF +Y+++ +  + +  +++++K
Sbjct: 570 LSAQNFFENYLAMPILIVLYLGYKIYYK 597

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  269 bits (687), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 173/524 (33%), Positives = 280/524 (53%), Gaps = 20/524 (3%)

Query: 11  TLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXX 70
           ++  + K  +K+T    + D++  + ++T  T   K+ V  N++ +   +K+ L +RH  
Sbjct: 2   SISSQDKEKVKATAY--EADVEDCDIRSTDETL--KQGVLHNDRTK---LKQGLKERHIK 54

Query: 71  XXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFT 130
                              L  +GPVG LIAYLF+G VV     ++ E+A+F+P T +  
Sbjct: 55  MLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATI 114

Query: 131 IFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTI 190
             + +F+  ++G   G++  +S  M    ELS    I+++WT   P   +I+IF V+  +
Sbjct: 115 RHAEQFIDESVGFTFGWISTYSSLMPG--ELSATAVIMRYWTDISP-AVFITIFGVLFVV 171

Query: 191 SNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTGI 249
           +N++ +R YGE+E+   +LK+  I   II    I  G  K    +GF YWR+PGP+   I
Sbjct: 172 TNIYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFAEYI 231

Query: 250 ISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYI 309
           +  +I   +F+G+ S+L +  +++ G + + I AGE  N R  +    + V  RI+V Y+
Sbjct: 232 VGGSIG--KFVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFLRIIVLYL 289

Query: 310 LSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSN 369
           +++F + L+VPY+D  + S      SSPF+IA+  +G K+LPHI N ++L +  SAGN  
Sbjct: 290 VTVFVLTLIVPYNDALIASGTGTAKSSPFVIAMNRAGIKVLPHIVNALVLTSAWSAGNLA 349

Query: 370 VYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLL 429
           +  GSR LF LA     PK+F KT+K G+P   V+F S F  LA+M  S      F W  
Sbjct: 350 IIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSSTVFGWFQ 409

Query: 430 NVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQ 489
            +V       W+LIS  HI   + L+++G SR+DLP+     PY A+++ I+  I +   
Sbjct: 410 ELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMSFIFLLTG 469

Query: 490 GFTAF-APKFDVLNFFASYISVFL---FFIFWGSFQLWFKCRYV 529
           GF  F    FD+ +FF  Y  + L    F FW   +L+ K RY+
Sbjct: 470 GFYNFIHGHFDIESFFTRYFIIPLAIGLFTFW---KLFKKTRYL 510

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  269 bits (688), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 169/508 (33%), Positives = 248/508 (48%), Gaps = 16/508 (3%)

Query: 20  IKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHE---VKRDLSKRHXXXXXXXX 76
           + S   L+    +  E +  P      E  S N +D +     VKR L  RH        
Sbjct: 13  VVSNRGLKDAYNEVTEMEVDPKNNEYAEEQSLNREDTFDPDSGVKRQLKDRHISLLALGG 72

Query: 77  XXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRF 136
                      N L I GP+  L+ +  +G + + + +S+GEM T  P    FT  + RF
Sbjct: 73  IIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESIGEMITLYPSGGGFTTLTRRF 132

Query: 137 LSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPV 196
            S AL A  GY Y   +    A E + +  I+QFW   VPL  +I IFW    +  L  V
Sbjct: 133 HSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVPLYGYILIFWAAFQVFQLLGV 192

Query: 197 RIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPV-GFRYWRNPGPWGTGIISSNIA 255
             +GE E+W+A+ K+  +L + I+    + G  K  P  GF+YW +PG    G       
Sbjct: 193 GAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFGFQYWNDPGALSNG------- 245

Query: 256 EARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFI 315
              F G A+  +  +  + GTE V + A E+ NPR+ VP AIR+  +RIL+ Y+    F 
Sbjct: 246 ---FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPIAIRQTFWRILIVYLGISIFY 302

Query: 316 GLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSR 375
           G+ VPY+D  L      V  SP  IAI  +G     H+ N  IL+T ISA N ++YIGSR
Sbjct: 303 GVTVPYNDENLNFATK-VLKSPIAIAISRAGWPAGVHLVNAFILITCISAINGSLYIGSR 361

Query: 376 LLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVA 435
            L  LA  G  PKL A T + GVP+ A+   +  G ++ M  S    +A+ +++N+ GV 
Sbjct: 362 TLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLMNVSVTAVDAYNYIVNLSGVG 421

Query: 436 GFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFA 495
            F  W +IS  H+RF +  + +G +R++LP+KAK  P     + I  I +   QG++ F 
Sbjct: 422 VFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFPIVSIIANIFLGLVQGWSYFK 481

Query: 496 PKFDVLNFFASYISVFLFFIFWGSFQLW 523
           P FD  NF  +YI +    I +     W
Sbjct: 482 P-FDAKNFVDAYILIPAGIILYLGVSYW 508

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  271 bits (693), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 162/504 (32%), Positives = 264/504 (52%), Gaps = 17/504 (3%)

Query: 36  DKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGP 95
           D    ++        +NEK E  ++K+ +  RH                     L  +GP
Sbjct: 98  DDAISSSISETNKGHQNEKSE--DLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGP 155

Query: 96  VGSLIAYLFLGTVVYSVTQSLGEMAT-FIPVTASFTIFSHRFLSPALGAANGYMYWFSWA 154
              +I Y  +GT +Y + Q+ GE+A  +  +   F  +    + PALG +  ++Y   W 
Sbjct: 156 AALVIGYAIMGTCLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWL 215

Query: 155 MTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAI 214
               LEL      I++WT  V    ++ IF+V++   N F  R Y E EF+    KV  +
Sbjct: 216 CVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMM 275

Query: 215 LGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTF 273
            GF I    I  G AG  G +G +YW +PG +     + + +  RF G   + + AAF F
Sbjct: 276 TGFFILGIIITAGGAGNDGYLGAKYWHDPGAF-----NGDKSIDRFKGVMDTFVTAAFAF 330

Query: 274 QGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD-DVKLKSENSY 332
             TE + +TA E +NPR+ +P A +KV++RI+  ++ S+  IG LVPY+ D  L S  S 
Sbjct: 331 GATEFIALTAAEQSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSG 390

Query: 333 VSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAK 392
           + +SP++IA+ + G +++PH  N VIL++++S GNS  Y  SRLL  LA+ G  PK F  
Sbjct: 391 IKASPYVIAVSSHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDY 450

Query: 393 TTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQ 452
             + G P  A++ ++LFG +AF  TS    E F WLL + G++  F+W+ I  +HIRF +
Sbjct: 451 VDREGRPFRAMLMSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRR 510

Query: 453 CLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYI 508
            +Q +G S  ++ + ++   Y + YA I++ + +  Q + A AP    K D  NFF +Y+
Sbjct: 511 AMQVQGRSLGEVGYLSQSGVYGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYL 570

Query: 509 SVFLFFIFWGSFQLWFKCRYVWKL 532
           ++ +   F+  +++W   +  WKL
Sbjct: 571 AMPILIAFYFGYRVW---KRDWKL 591

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  270 bits (691), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 163/501 (32%), Positives = 256/501 (51%), Gaps = 18/501 (3%)

Query: 36  DKNTPTTTPSKENVSENEKD-----EYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPL 90
           + +T  T    EN S+ E D        ++K+ +  RH                     L
Sbjct: 62  EGSTTHTKQINENTSDLEGDVNSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGL 121

Query: 91  MISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASFTIFSHRFLSPALGAANGYMY 149
              GP   +I Y  +  V Y + Q+ GEMA   P + A+F  +S  F+S   G A  ++Y
Sbjct: 122 HYGGPAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVY 181

Query: 150 WFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFL 209
            F W     LEL      I+FW   +    +I IF+V L   + F V+ YGE EF     
Sbjct: 182 CFQWLTVLPLELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCC 241

Query: 210 KVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLIN 268
           K+  I GFII    I CG AG  G +G +YWRNPG +     + + +  RF      L+ 
Sbjct: 242 KILMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAF-----AGDTSAGRFKNVCYILVT 296

Query: 269 AAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLK- 327
           A F+F G EL  ++  E ANPR+T P A ++ ++RILV Y+L++  IG  VPY+D +L  
Sbjct: 297 AYFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMG 356

Query: 328 SENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGP 387
           +  S   +SP+++A    G K++PHI N VIL+++IS  NS++Y G RL+  LA+ G GP
Sbjct: 357 AGGSATHASPYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGP 416

Query: 388 KLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAH 447
           K      + G P+ A++  S+FG + F+  S+  +  F WL  + G++  F+W  I  +H
Sbjct: 417 KFLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSH 476

Query: 448 IRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVLN 502
           +RF Q ++ +G S ++L +KA    + + Y     I++   Q + A AP     K    +
Sbjct: 477 LRFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAES 536

Query: 503 FFASYISVFLFFIFWGSFQLW 523
           FF SY++  ++  F+  + ++
Sbjct: 537 FFQSYLAFPIWIAFYLGYMIY 557

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  270 bits (689), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 167/538 (31%), Positives = 278/538 (51%), Gaps = 22/538 (4%)

Query: 5   DINTEETLEGKSKIVIKSTESLEQHDLQ---GNEDK-----NTPTTTPSKENVSENEKD- 55
           D+ +   L G          S+++ D +   G+E K     N+    P +EN  E+ +D 
Sbjct: 24  DVKSGNVLTGSDTTEFFEKASVQKSDFEYFEGDETKFRRFVNSFKKAPGRENDQESLQDN 83

Query: 56  -EYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQ 114
            ++ ++K+ +  RH                     L   GP G  + +  +GT VY V Q
Sbjct: 84  NKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVIQ 143

Query: 115 SLGEMATFIP-VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTF 173
           + GEMA   P ++  F  +    + P  G A  ++Y   W   F LEL      I++WT 
Sbjct: 144 AAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKYWTT 203

Query: 174 AVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGA-GKTG 232
           A+    ++++F++++ + N F  R Y E EF+    KV  I+GF I    +  GA G  G
Sbjct: 204 AINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAGNDG 263

Query: 233 PVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQT 292
            +G +YWR PG +G      + A   F G  S+L+NAAF+   +E V +TA E ANPR++
Sbjct: 264 YIGAKYWREPGSFG-----GHTAIDHFKGVVSTLVNAAFSLGCSEFVALTAAEQANPRKS 318

Query: 293 VPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSGTKILP 351
           VP A +K+++++ V ++ S+  IG LVP +  +L  S +S V  SP++IA+ + G +++P
Sbjct: 319 VPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIAVASHGVRVVP 378

Query: 352 HIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGA 411
           H  N VIL++++S GNS  Y  SRLL  LA+ G  P +F    + G P+ A++ +   G 
Sbjct: 379 HFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVSITMGC 438

Query: 412 LAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFM 471
           L F+  S   +  F WLL + G++  F+W  I  +HIRF + L  +G   + L FKA+  
Sbjct: 439 LCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGFKAQTG 498

Query: 472 PYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
            + +YY+ ++MI+    Q +T   P    K +  +FF  Y++  +F   +  ++++ K
Sbjct: 499 VWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYFGYKIYNK 556

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  269 bits (688), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 163/513 (31%), Positives = 266/513 (51%), Gaps = 28/513 (5%)

Query: 28  QHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXX 87
           +H   G+ D       P +            ++K+ +S RH                   
Sbjct: 58  EHGRGGDVDAEGQPVAPRET-----------KLKQTISSRHLFMISLGTGIGTGMLVGNG 106

Query: 88  NPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANG 146
             L   GP G  I Y  +G+ +Y + Q+ GEMA ++  ++ +F  +    + PALG +  
Sbjct: 107 KALHNGGPAGLAIGYAIMGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVA 166

Query: 147 YMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWI 206
           ++Y   W     LEL      I++WT AV    ++ IF+V+  + NLF  R Y E EF+ 
Sbjct: 167 WVYCLQWLCVLPLELVTATITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFF 226

Query: 207 AFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGP-WGTGIISSNIAEARFLGWAS 264
              KV  I GF I    + CG AG  G +G +YW +PG  +GT  I        F G  +
Sbjct: 227 NTCKVLMITGFFILGIIVNCGGAGNDGYLGGKYWHDPGALYGTKPIH------HFKGIIA 280

Query: 265 SLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD-D 323
           +++ AAF F  TE + +TA E ANPR+ +P A +K+V+R+L+ ++  +  +G LVPY+ D
Sbjct: 281 TMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSD 340

Query: 324 VKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKN 383
             + S  S   +SP++IAI + G K++PH  N VIL++++S GNS  Y  SRLL  L++ 
Sbjct: 341 ELMGSGGSATHASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQ 400

Query: 384 GTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLI 443
              P       + G P+ A++ + +FG +AF+  S   +  F WLL + G++  F+W+ I
Sbjct: 401 HYAPSWLNYIDREGRPIRAMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICI 460

Query: 444 SFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFD 499
             +HIRF + L  +G S  +L +K++     +YYAT++M  ++  Q + A AP    K D
Sbjct: 461 CVSHIRFRKALVVQGKSLGELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLD 520

Query: 500 VLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
             NFF +Y+++ +    +  +++W   +  WKL
Sbjct: 521 ANNFFENYLAMPILIALYFGYRVW---KRDWKL 550

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  269 bits (688), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 162/525 (30%), Positives = 270/525 (51%), Gaps = 20/525 (3%)

Query: 9   EETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRH 68
           E + E +S +V +  +S  + + Q  ED N        E+ + + +   H +K+ +  RH
Sbjct: 42  EHSEESRSGLVHRFVDSFRRAESQRLEDDN------DLEDGTRSMRSNNH-LKKSMKSRH 94

Query: 69  XXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTA 127
                                L ++GP   +I Y+ +  V Y + Q+ GEM    P +  
Sbjct: 95  VVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPG 154

Query: 128 SFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVI 187
           +F  ++  F+S + G A  +++   W     LEL      I++W   +    +I+IF+V 
Sbjct: 155 NFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDTINADVFIAIFYVF 214

Query: 188 LTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWG 246
           L   + F V+ YGE EF     K+  I GFII    I CG AG  G +G  YWRNPG + 
Sbjct: 215 LLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFA 274

Query: 247 TGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILV 306
            G      +  RF G    L+ A F+F G EL  ++  E ANPR++ P A ++ ++RIL+
Sbjct: 275 DGS-----SATRFKGICFILVTAYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILI 329

Query: 307 FYILSLFFIGLLVPYDDVKLK-SENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISA 365
            Y+L++  IG  VP+D+ +L  S +S   +SP+++A    G K++PHI N VIL+++IS 
Sbjct: 330 IYLLTMILIGFNVPHDNDQLMGSGSSATHASPYVLAASIHGVKVIPHIINAVILISVISV 389

Query: 366 GNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAF 425
            NS +Y   RL+  LA+ G  PK      + G P+ A+V  S  G + F+  S+  ++AF
Sbjct: 390 ANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAF 449

Query: 426 QWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIII 485
            WL  + G++  F+W  I  +HIRF + ++ +G S +++ +K+    + +YY  I  I++
Sbjct: 450 TWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILV 509

Query: 486 IFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
              Q + A +P     K DV +FF SY++  L+   +  + ++ K
Sbjct: 510 FMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLGYMIYNK 554

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  268 bits (686), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 174/496 (35%), Positives = 273/496 (55%), Gaps = 20/496 (4%)

Query: 48  NVSENEK----DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYL 103
           N++E EK         +KR L  RH                     L  +GP G LI + 
Sbjct: 61  NLTEAEKIAIATANSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWA 120

Query: 104 FLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSV 163
             GT++Y +  ++GE+A   PV+  FT ++ RF+  + G AN + Y   W +   LE+  
Sbjct: 121 LTGTMIYCMVMAMGELAVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVA 180

Query: 164 VGQIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCF 222
               + +W T       ++++F+V++   N+F V+ YGE EF  +F+KV  ++GFII   
Sbjct: 181 ASITVNYWGTDPKYRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGI 240

Query: 223 CIVCGAGKTGPVGFRY-WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281
            +VCG G  G       W NPG +       N A  RF G  S  + AAF+F G+ELVG+
Sbjct: 241 ILVCGGGPVGGYIGGANWHNPGAF-----VGNTAGKRFKGVCSVFVTAAFSFAGSELVGL 295

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFII 340
            + E ANPR+++P+A ++V +RI +FYI+SL  IGLLVPY+D +L   +S   ++SPF++
Sbjct: 296 ASAETANPRKSLPRAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVL 355

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           AI+N G K LP + N VIL+ ++S GNS V+  SR L  LA+ G  PK+F    + G P+
Sbjct: 356 AIKNHGIKGLPSVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPL 415

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
             + FTS FG L+F+  S    E F WLL + G++  F+W+ I   H+RF + L ++G S
Sbjct: 416 VGIGFTSFFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRS 475

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYISVFLFFIFW 517
            ++L F +    + + Y T+++++I+  Q + A  P     D  +FF SY+S+ +  + +
Sbjct: 476 TDELSFVSPAGVWGSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMY 535

Query: 518 GSFQLWFKC-RYVWKL 532
               +  KC +  WKL
Sbjct: 536 ----IGHKCYKRNWKL 547

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  268 bits (685), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 155/525 (29%), Positives = 273/525 (52%), Gaps = 22/525 (4%)

Query: 15  KSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXX 74
           +  ++I++T S    ++ G       T+ P+  N+   E  +   + +DL+ RH      
Sbjct: 51  EDNVMIQTTSSGATKNING-------TSNPNDSNMLSKEDIDGSNLNKDLNIRHLLTLAV 103

Query: 75  XXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSH 134
                          L   GP   +I ++ + T +++V  SLGE+A   PV   F+++  
Sbjct: 104 GGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINSLGELAAAYPVVGGFSVYMT 163

Query: 135 RFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLF 194
           RF+ P++  +    Y   W +   LEL      I++W   +   AW+SIF+ ++ + N+ 
Sbjct: 164 RFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYWNDKINSDAWVSIFYTVIGLLNML 223

Query: 195 PVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF-RYWRNPGPWGTGIISSN 253
            V+ +GE EF ++F+K+ AI+GF I    + CG G  G     +YW +PG +       +
Sbjct: 224 DVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGGYIGGKYWHDPGAF-----VGH 278

Query: 254 IAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLF 313
            A ++F G  S  + AAF++ G E++ ++A E+ +PR+T+P A ++  + I   Y+  L 
Sbjct: 279 TAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKTIPVAAKRTFWLITASYVTILT 338

Query: 314 FIGLLVPYDDVKLKSENSYV--SSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVY 371
            IG LVPYDD +L + +S V  +SSP +IAIEN G K LP + N +IL+ ++S  NS VY
Sbjct: 339 LIGCLVPYDDPRLLNGSSSVDVASSPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVY 398

Query: 372 IGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNV 431
             SR +  +A  G  PK   +  K G P+ A + T  FG ++F+  S    E F WL  +
Sbjct: 399 ACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFGLISFVAASDKQAEVFTWLSAL 458

Query: 432 VGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGF 491
            G++  F W+ I+ +HIRF + +  +G S  ++P+ ++   Y ++Y  I++ +++    +
Sbjct: 459 SGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFW 518

Query: 492 TAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
           T+  P    + +   FF  Y+S+ +    +   + +FK    W+L
Sbjct: 519 TSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKN---WRL 560

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  266 bits (680), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 165/489 (33%), Positives = 248/489 (50%), Gaps = 16/489 (3%)

Query: 23  TESLEQH-DLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXX 81
           T S++Q  DL   E K         E  S NE D +  VKR L  RH             
Sbjct: 4   TNSIQQREDLDKLEPKIAEVELQRLETDSLNEFDPHSGVKRALKNRHISLLALGGIIGPG 63

Query: 82  XXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPAL 141
                 N L   GP+  L+ +  +G V +S+ +S+GE+ T  P    F   + RF S  L
Sbjct: 64  CLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGL 123

Query: 142 GAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGE 201
            A +GY Y   +    A E + +  I+QFW   VP+  +  IFW    +  L  V  +GE
Sbjct: 124 SAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGE 183

Query: 202 IEFWIAFLKVNAILGFIIYCFCIVCGA--GKTGPVGFRYWRNPGPWGTGIISSNIAEARF 259
            E+W+A+ K+  ++ F I+    + G   GK  P+GF+YW+NPG    G          F
Sbjct: 184 CEYWLAWFKILGLVAFYIFSIVYMSGGIPGKP-PIGFQYWKNPGALSHG----------F 232

Query: 260 LGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLV 319
            G A   +  +  + GTE V + A E+ NPR+ VP A+R+  +RIL+ Y+   FF G+ V
Sbjct: 233 RGIAVVFVFCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTV 292

Query: 320 PYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFG 379
           PY+D  L ++   + S P  IA+  +G     H+ N  IL+T ISA NS++YIGSR L  
Sbjct: 293 PYNDPTLGAQTKSLKS-PISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSH 351

Query: 380 LAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFS 439
           LA  G  P++ A T K GVPV A++  +  G ++ M  S G   A+ +++N+ GV  F  
Sbjct: 352 LAHEGLAPRILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIV 411

Query: 440 WLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFD 499
           W  IS  H+RF +   ++G S ++LP++A F P+   ++    I +   QG+T+  P F 
Sbjct: 412 WSAISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTSLVP-FV 470

Query: 500 VLNFFASYI 508
             +F  +YI
Sbjct: 471 AKDFVDAYI 479

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  268 bits (685), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 159/518 (30%), Positives = 263/518 (50%), Gaps = 14/518 (2%)

Query: 14  GKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXX 73
           G  K++ +  +S ++ +      K     T   E+  E+   +  ++K+ +  RH     
Sbjct: 46  GSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSD-SKLKKSMKSRHVVMMS 104

Query: 74  XXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASFTIF 132
                           L   GP   +I Y+ +  V Y + Q+ GEMA   P + A+F  +
Sbjct: 105 LGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNAY 164

Query: 133 SHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISN 192
           S  F+S + G A  ++Y F W     LEL      IQFW   +    +I IF+V L   +
Sbjct: 165 SSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFWNDKINPDIYILIFYVFLVFIH 224

Query: 193 LFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIIS 251
            F V+ YGE EF     K+  I GFII    I CG AG  G +G  YW NPG +     +
Sbjct: 225 FFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----A 279

Query: 252 SNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILS 311
            + +  RF      L+ A F+F G EL  ++  E +NPR++ P A ++ ++RI+V Y+L+
Sbjct: 280 GDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLT 339

Query: 312 LFFIGLLVPYDDVKLK-SENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNV 370
           +  IG  VPY+D +L  +  S   +SP+++A    G KI+PHI N VIL++++S  NS++
Sbjct: 340 MILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSL 399

Query: 371 YIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLN 430
           Y G RL+  LA+ G  PK      + G P+ A++   +FG +AF+  S+  +  F WL  
Sbjct: 400 YAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAA 459

Query: 431 VVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQG 490
           + G++  F+W  I  +H+RF Q ++ +G S ++L +KA    + + Y     I++   Q 
Sbjct: 460 IAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQF 519

Query: 491 FTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLW 523
           + A AP     K D  +FF +Y++  ++  F+  + ++
Sbjct: 520 WVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVY 557

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  267 bits (682), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 153/483 (31%), Positives = 255/483 (52%), Gaps = 20/483 (4%)

Query: 51  ENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVY 110
           + E     ++K+ +  RH                     L  +GP G +I Y     ++Y
Sbjct: 55  DEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLY 114

Query: 111 SVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQ 169
            + Q+ GE+   +  +T ++T +S   + PALG +  ++Y   W   F L+L      I+
Sbjct: 115 CIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIK 174

Query: 170 FWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-A 228
           +WT   P   +++I + ++   NLF  + Y E EF     KV  ++GF+I    I CG A
Sbjct: 175 YWTDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGA 233

Query: 229 GKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAAN 288
           G  G +G RYW  PG + TG          F G       AAF + G E++ +TA E  N
Sbjct: 234 GNDGYIGARYWHTPGAFSTG----------FKGVCYVFCYAAFAYGGIEVMVLTASEQEN 283

Query: 289 PRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTK 348
           PR+++P A +KV++RIL+ Y+L+   +  LVPYD  +L S  S   +SPF+IAI + G  
Sbjct: 284 PRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRASPFVIAIASHGIS 343

Query: 349 ILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSL 408
           ++PHI N VILV ++S GNS++Y   RLL  L++ G  PK+F    + G P+   +    
Sbjct: 344 VVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMF 403

Query: 409 FGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKA 468
            G LAF+  S   ++ F WLL + G++  F W+ I  +H+RF   ++++G S  ++ +K+
Sbjct: 404 VGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKS 463

Query: 469 KFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVLNFFASYISV-FLFFIFWGSFQL 522
           +   + +++A IV + ++  Q + A AP     K    +FF SY++   L FI++G +++
Sbjct: 464 QTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFG-YKI 522

Query: 523 WFK 525
           ++K
Sbjct: 523 YYK 525

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  267 bits (683), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 159/526 (30%), Positives = 270/526 (51%), Gaps = 15/526 (2%)

Query: 15  KSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXX 74
            S + +  + S     L+G+  +       + E  S  E      + +DLS RH      
Sbjct: 43  NSPVRVNVSSSGNDDILKGDTKEYPRDVKATPEAASYVEDINNTNLNKDLSVRHLLTLAV 102

Query: 75  XXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSH 134
                          L   GP   +I ++ + T +++V  SLGE+A   PV   F ++  
Sbjct: 103 GGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINSLGELAAAFPVVGGFNVYIT 162

Query: 135 RFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLF 194
           RF+ P+   A    Y   W +   LEL      I++W   +   AW++IF+  + ++N+ 
Sbjct: 163 RFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYTAIALANML 222

Query: 195 PVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF-RYWRNPGPWGTGIISSN 253
            V+ +GE EF ++ +K+ AI+GF I    + CG G  G     +YW NPG +       +
Sbjct: 223 DVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGYIGGKYWHNPGAF-----VGH 277

Query: 254 IAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLF 313
            A ++F G  S  + AAF++ G E+  ++A E+ NP++T+PKA ++  + I V Y+  L 
Sbjct: 278 SAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILT 337

Query: 314 FIGLLVPYDDVKLKSENSYV--SSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVY 371
            IG LVPY+D +L + +S V  ++SP +IAIEN G K LP + N +IL+ I+S  NS VY
Sbjct: 338 LIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVY 397

Query: 372 IGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNV 431
             SR +  +A  G  PK  +K  K G P+ A++ T  FG L+F+  S   +E F WL  +
Sbjct: 398 ACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSAL 457

Query: 432 VGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGF 491
            G++  F W+ I+ + IRF   ++++G S +++PF ++   + A+Y  IV+ +++    +
Sbjct: 458 SGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFW 517

Query: 492 TAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLV 533
           T+  P         +FF  Y+S+ +    +   +LW   +  W+L+
Sbjct: 518 TSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLW---KRDWRLL 560

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  266 bits (681), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 154/504 (30%), Positives = 257/504 (50%), Gaps = 26/504 (5%)

Query: 30  DLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNP 89
           DL+G +  N    T                +K ++  RH                     
Sbjct: 51  DLEGKDADNGLNKTQ-------------QTLKHNIKTRHLTMISLGTGIGTGLLVASGKA 97

Query: 90  LMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYM 148
           L   GP G +I Y+   T++Y V Q+  E+   +  +  ++  +    +    G A   +
Sbjct: 98  LHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALV 157

Query: 149 YWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAF 208
           Y   WA    LEL      +++WT +V    +++IF+V L   + F  R Y E EF    
Sbjct: 158 YGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNS 217

Query: 209 LKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLIN 268
           LKV  + GFII    +  GA + G +G +YW +PG +G      + A  RF G  S  + 
Sbjct: 218 LKVLLMAGFIIMAISLTAGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQ 272

Query: 269 AAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKS 328
           AAF + G+E + +TA E ANPR++VPKA ++ ++R++V ++L +  IG LVP++  +L S
Sbjct: 273 AAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLS 332

Query: 329 EN--SYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTG 386
               S   +SPF+IA    G +++PHI N +IL ++IS GNS +Y   R+L  LA++G  
Sbjct: 333 AEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMC 392

Query: 387 PKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFA 446
           PK+F    + G P+  ++F SLFG +AF+  S   +  F WL  + G++  F+W  I+ +
Sbjct: 393 PKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVS 452

Query: 447 HIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVL 501
           H+RF + ++ +G S  +L ++A      +YYA    +I++  Q + A AP     + DV 
Sbjct: 453 HVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVE 512

Query: 502 NFFASYISVFLFFIFWGSFQLWFK 525
            FF +Y++  +  +F+  ++LW +
Sbjct: 513 FFFQNYLAFPVLVVFYLGYKLWKR 536

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  268 bits (686), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 155/484 (32%), Positives = 263/484 (54%), Gaps = 16/484 (3%)

Query: 53  EKDEYH----EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTV 108
           +KDE      ++ +DLS RH                   + L   GP   +I ++ + T 
Sbjct: 130 DKDEETLLATDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTA 189

Query: 109 VYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQII 168
           +++V  SLGE+A   PV   F+++  +F+ P+   A    Y   W +   LEL      I
Sbjct: 190 LFTVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITI 249

Query: 169 QFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGA 228
           ++W  ++   AW+SIF+V + ++N+  V+ +GE EF ++ +K+ AI+GF I    + CG 
Sbjct: 250 RYWNSSINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGG 309

Query: 229 GKTGP-VGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAA 287
           G +   +G +YW +PG +  G  S     ++F G  S  + AAF+F G E+  ++A E+ 
Sbjct: 310 GPSHEYIGGKYWHDPGAF-VGTTSG----SKFKGLCSVFVTAAFSFSGIEMTAVSAAESR 364

Query: 288 NPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYV--SSSPFIIAIENS 345
           NPR+T+PKA ++  + I   Y+  L  +G LVPY+D +L + +S V  +SSP +IAIEN 
Sbjct: 365 NPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENG 424

Query: 346 GTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVF 405
               LP + N +IL+ I+S  NS+VY  SR +  ++K  T PK+FAK  + G P+ A+ F
Sbjct: 425 HIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICF 484

Query: 406 TSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLP 465
              FG L+F+  S    E F WL  + G++  F W+ I+  HIRF Q +  + IS ++LP
Sbjct: 485 VLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELP 544

Query: 466 FKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQ 521
           F ++   + + Y  +++ +++    +T+  P    K +  +FF  Y+S  +    + + +
Sbjct: 545 FLSQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHK 604

Query: 522 LWFK 525
           ++FK
Sbjct: 605 VYFK 608

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  266 bits (681), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 154/516 (29%), Positives = 265/516 (51%), Gaps = 35/516 (6%)

Query: 32  QGNEDKNTPTTT----PSKENVSENEKDEY----------HEVKRDLSKRHXXXXXXXXX 77
            G+E  +TP+T      +K N+ +   D +            +K+ L  RH         
Sbjct: 31  DGSEKTSTPSTVVNHRGTKRNIIQRMVDSFKPPLDGSFHSDNLKKSLKARHLIMIAIGGS 90

Query: 78  XXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFL 137
                       L + GP+  +I +   GT +      LGE+    PV  +F  +  RFL
Sbjct: 91  IGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFL 150

Query: 138 SPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVR 197
            P++      +Y   W     LE+      +++W  +VP  AW++IF+  + + NL  VR
Sbjct: 151 EPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWGSSVPPVAWVAIFYAFIALVNLLGVR 210

Query: 198 IYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVGFRYWRNPGPWGTGIISSNIAE 256
            +GE EF  + +KV  I+GFII C  ++CG G K   VG +YW +PGP   G        
Sbjct: 211 GFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKHEFVGAKYWSDPGPLANG-------- 262

Query: 257 ARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIG 316
             F G A+  + A+++  GTE+  + +GE  +P++ +P AI++V +RI+ F+++SL  +G
Sbjct: 263 --FKGVAAVFVIASYSLGGTEMACLASGET-DPKE-LPSAIKQVFWRIVFFFLVSLTLVG 318

Query: 317 LLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRL 376
            LVPY +  L   +S V +SPF+IAI   G K LP + N VILV+++S GNS ++  SR 
Sbjct: 319 FLVPYTNENLMGGSS-VDNSPFVIAIRLHGIKALPSVVNAVILVSLLSVGNSCIFASSRT 377

Query: 377 LFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAG 436
           L  +A  G  P++F    ++G P+  ++    FG LAF+  S+  D+ F WL+ + G+A 
Sbjct: 378 LCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGLLAFLVKSSSSDDVFTWLMAIAGLAT 437

Query: 437 FFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF-- 494
              WL I+ +HIRF   ++++G+S ++L F +    Y + Y+  + ++I+  Q + +   
Sbjct: 438 CVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVGVYGSVYSATINVLILVAQFYVSLWP 497

Query: 495 -----APKFDVLNFFASYISVFLFFIFWGSFQLWFK 525
                +P     NFF +Y+   +  + +   +++++
Sbjct: 498 VGGWSSPSTRTENFFQNYLCSLILLLLFAGHKIYYR 533

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  265 bits (678), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 150/481 (31%), Positives = 263/481 (54%), Gaps = 14/481 (2%)

Query: 59  EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118
            + ++LS RH                     L   GP   ++ ++ + T +++V  SLGE
Sbjct: 42  NLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINSLGE 101

Query: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178
           +A   P+   F ++  RF+ P++G A    Y   W +   LEL      I++W   +   
Sbjct: 102 LAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDKINSD 161

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVG-FR 237
           AW++IF+V + ++N+  V+ +GE EF ++ +K+ AI+GF I    +  G G +G    F+
Sbjct: 162 AWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGYLGFK 221

Query: 238 YWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAI 297
           YW NPG +  G  +S     +F G  S  + AAF+F G E++ ++A E+ NPR+ +PKA 
Sbjct: 222 YWNNPGAFVGGTNAS-----KFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIPKAA 276

Query: 298 RKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYV--SSSPFIIAIENSGTKILPHIFN 355
           ++  + +   Y++ L  +G LVPY+D +L +  + V  ++SP +IAIEN G K LP + N
Sbjct: 277 KRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLPSLMN 336

Query: 356 GVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFM 415
            +IL+ I+S  NS VY  SR +  +A  G  PK+ +K  K G P+ A++ T +FG L+F+
Sbjct: 337 AIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLLSFI 396

Query: 416 ETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLA 475
             S   +E F WL  + G++  F W+ I+++ IRF + +Q +  S ++LP+ ++   + A
Sbjct: 397 AASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTGIWGA 456

Query: 476 YYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWK 531
           +Y  +V+ ++I    +T+  P      D  +FF S++S+ +  + +   +L+F     W+
Sbjct: 457 WYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFARN--WR 514

Query: 532 L 532
           L
Sbjct: 515 L 515

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  266 bits (679), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 162/512 (31%), Positives = 257/512 (50%), Gaps = 28/512 (5%)

Query: 21  KSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXX 80
           +  ++    DL+  E  +T TT                ++++ +  RH            
Sbjct: 40  RREDTSRSGDLEDGEINSTDTT----------------KLQQRMRTRHVVMMSLGTGIGT 83

Query: 81  XXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASFTIFSHRFLSP 139
                    L   GP G LI YL +  V Y +  + GEMA   P +  +F  +S  F+S 
Sbjct: 84  GLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISK 143

Query: 140 ALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIY 199
             G A  +++   W   F LEL     +I++W  +V    ++ IF++ +   + F  R Y
Sbjct: 144 PFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGY 203

Query: 200 GEIEFWIAFLKVNAILGFIIYCFCIVCGA-GKTGPVGFRYWRNPGPWGTGIISSNIAEAR 258
           GE EF     KV  I+GF+I    I  GA G TG +G RYWRNPG + +G     +    
Sbjct: 204 GETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLK--- 260

Query: 259 FLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLL 318
             G A  L+ A F+F G EL  ++  E  NP+  +P A +K V+RIL+ Y+L++  IG L
Sbjct: 261 --GTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFL 318

Query: 319 VPYDDVKLKSENSY-VSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLL 377
           VP+D  +L    S  V  SP+++AIE  G K+LPHI N VIL+++IS GNS +Y   RLL
Sbjct: 319 VPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLL 378

Query: 378 FGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGF 437
             LA+ G  PK      + G P+ +++  ++FG +AF   S   ++ F WL  + G++  
Sbjct: 379 CALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSEL 438

Query: 438 FSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP- 496
           F+W  I  +H RF Q ++ +G S   L ++A    + + YA    +++   Q + A  P 
Sbjct: 439 FTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPI 498

Query: 497 ---KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
              K DVL+FF +Y++  L+ I +  + ++ +
Sbjct: 499 AKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSR 530

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  266 bits (680), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 161/478 (33%), Positives = 255/478 (53%), Gaps = 11/478 (2%)

Query: 54  KDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVT 113
           K     ++  L  RH                     L  +GP G LI +   GT+++++ 
Sbjct: 82  KTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMV 141

Query: 114 QSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTF 173
            +LGE+A   PV+  FT ++ RF+  + G A  + Y   W +   LE+      + +W  
Sbjct: 142 MALGELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWET 201

Query: 174 AVPL-PAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTG 232
            V     ++++FW+++ I N+F VR YGE EF  + +KV A++GFII    +VCG G  G
Sbjct: 202 PVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVG 261

Query: 233 PVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQ 291
                RYW NPG +       + +  +F G+ S  + AAF+F G+EL+G+   EA NPR+
Sbjct: 262 GYVGARYWHNPGAF-----VGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRK 316

Query: 292 TVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSGTKIL 350
            VP A ++V +RIL+FYI+ L  IG LVPY+D +L  S +   S+SPF+IAI   G   L
Sbjct: 317 AVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGL 376

Query: 351 PHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFG 410
           P + N VIL++++S GNS +Y  SR L  L++ G  PK+ +   + G P+  +  +S FG
Sbjct: 377 PSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFG 436

Query: 411 ALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAK- 469
            +AF+  S   +E F WLL + G++ FF+W  I   HIRF   L+++G   ++LPF +  
Sbjct: 437 LIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPA 496

Query: 470 --FMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFK 525
                Y   +  I+M+I  F+              FF++Y++  +   F+ + +LW K
Sbjct: 497 GVIGSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKK 554

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  265 bits (676), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 179/507 (35%), Positives = 265/507 (52%), Gaps = 29/507 (5%)

Query: 21  KSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXX 80
           K   + EQ+    +E+ ++    PS E ++ +     H + R LS RH            
Sbjct: 9   KDKVTPEQYISIADENYSSDLEQPSLEGLTTDNNVREH-LNRSLSPRHVNMIAIAGVIGT 67

Query: 81  XXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPA 140
                    L + GP   LI Y  +G +VY+   SLGEM+T++P++ SF  F+ +F S +
Sbjct: 68  GLYLGTGRALHLGGPASLLINYSIIGLIVYATLLSLGEMSTYMPISGSFCSFAKKFGSES 127

Query: 141 LGAANGYMYWFSWAMTFALELSVVGQIIQFW-TFAVPLPAWIS--IFWVILTISNLFPVR 197
              A    YWF+ A++ A +L+ +  ++ +W T     P WI+  IFWV L   N+  V+
Sbjct: 128 FAFALMCNYWFNDAVSVASDLTALQLVLDYWKTSESGFPYWIASLIFWVFLLFLNVIHVK 187

Query: 198 IYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYW-RNPGPWGTGIISSNIA 255
           IYGE E+W+A LKV AI+ F I       G  +    +GFR W R   P+  G       
Sbjct: 188 IYGEAEYWLAMLKVIAIIIFFILSIVANVGHNEQHEYIGFRNWTRGDAPFVNG------- 240

Query: 256 EARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFI 315
              F G+A+  ++A+F + GTE + +T+GE  NP +  PK I+ V +RIL+FYI ++FFI
Sbjct: 241 ---FRGFATLFVSASFAYGGTESITLTSGETKNPVRNTPKVIKTVFWRILIFYIFTVFFI 297

Query: 316 GLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSR 375
           G+ VPYD   L SE S V +SPF I  +  G+K      N VIL +++SA N  ++ GSR
Sbjct: 298 GMNVPYDYPNL-SEKS-VMTSPFTIVFQMVGSKAAGSFMNAVILTSVVSACNHALFAGSR 355

Query: 376 LLFGLAKNGT-GPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGV 434
           +LF L   G   PKL  +T    VP  AV+ T   G L F  +  G    + WL N+VGV
Sbjct: 356 ILFNLGLEGYFFPKLVTRTNWYQVPYVAVLVTWAVGGLCFGSSFIGAGTLWIWLQNLVGV 415

Query: 435 AGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFM----PYLAYYATIVMIIIIFFQG 490
           +   +WL I    IRF      RG+SR     + KF+    PY  Y+  I +  II  QG
Sbjct: 416 SNQIAWLSIGVISIRF-----RRGLSRQGKTHELKFVNWTYPYGPYFVIISVSFIILVQG 470

Query: 491 FTAFAPKFDVLNFFASYISVFLFFIFW 517
           +++ +P  DV +FF+ Y+ +F+F   W
Sbjct: 471 WSSSSP-MDVTSFFSYYVELFIFLACW 496

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  266 bits (679), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 170/495 (34%), Positives = 265/495 (53%), Gaps = 18/495 (3%)

Query: 48  NVSENEK----DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYL 103
           N+SE EK         +K  L  RH                     L   GP   LI + 
Sbjct: 70  NLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWG 129

Query: 104 FLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSV 163
             GT++Y++  +LGE+A   P++  FT ++ RF+  + G AN + Y   W +   LE+  
Sbjct: 130 STGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVS 189

Query: 164 VGQIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCF 222
               + FW T       ++++FW+ + I N+F V+ YGE EF  +F+KV  ++GFII   
Sbjct: 190 ASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGI 249

Query: 223 CIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281
            + CG G TG     +YW +PG +     + +   A+F G  S  + AAF+F G+ELVG+
Sbjct: 250 ILNCGGGPTGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGL 304

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFII 340
            A E+  PR++VPKA ++V +RI +FYILSL  IGLLVPY+D  L   +S   ++SPF+I
Sbjct: 305 AASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVI 364

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           AI+  G K LP + N VIL+ ++S GNS +Y  SR +  LA+    P++F+   + G P+
Sbjct: 365 AIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPL 424

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
             +  TS FG +AF+  S    E F WLL + G++  F+W  I   HIRF + L ++G  
Sbjct: 425 VGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRG 484

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFD---VLNFFASYISVFLFFIFW 517
            ++L FK+    + +Y+   ++II+   Q + A  P  D      FF +Y+S  L  + +
Sbjct: 485 LDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMY 544

Query: 518 GSFQLWFKCRYVWKL 532
              +++   +  WKL
Sbjct: 545 IGHKIY---KRNWKL 556

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  266 bits (681), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 155/498 (31%), Positives = 253/498 (50%), Gaps = 12/498 (2%)

Query: 35  EDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISG 94
            D      T + ++    ++DE  ++K+ +  RH                    PL  +G
Sbjct: 125 RDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAG 184

Query: 95  PVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSW 153
           P   +I Y  +GT +Y + Q+ GE+A  +  V  SF  F    + P    A  ++Y   W
Sbjct: 185 PAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQW 244

Query: 154 AMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNA 213
                LEL      I++WT  V    ++ IF+V++ + N F  + Y E EF+    KV  
Sbjct: 245 LCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMM 304

Query: 214 ILGFIIYCFCIVCGA-GKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFT 272
           ++GF I   CI  GA G  G +G +YW +PG +            RF G   + + AAF 
Sbjct: 305 MIGFFIMAICINTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDTFVTAAFA 359

Query: 273 FQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD-DVKLKSENS 331
           F  TE + +TA E +NPR+ +P A +KV +RIL+ ++ S+  IG LVPY+ D  + S + 
Sbjct: 360 FGATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSG 419

Query: 332 YVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFA 391
             S+SP+++A    G  ++ H  N VIL++++S  NS  Y  SRLL GLA+ G  PK F 
Sbjct: 420 GNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFD 479

Query: 392 KTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFM 451
              ++G P+ +++  ++   +AF  TS    + F WLL + G++  F+W  I  +HIRF 
Sbjct: 480 YVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFR 539

Query: 452 QCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASY 507
           + +Q +G S  +L F+A+     +YYA I++ + +  Q + A  P      D  NFF +Y
Sbjct: 540 RGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNY 599

Query: 508 ISVFLFFIFWGSFQLWFK 525
           +++ +    +  F+LW +
Sbjct: 600 LAMPILLALYVGFKLWRR 617

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  264 bits (675), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 153/531 (28%), Positives = 267/531 (50%), Gaps = 16/531 (3%)

Query: 10  ETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHX 69
           E++  +   V    +S ++ + QG   +        +   + +      ++K+ +  RH 
Sbjct: 26  ESVHSQHGFVRNFMDSFKRAEPQGQTIREEKLENGLETVRTNDYNATQKKMKQTMKSRHI 85

Query: 70  XXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTAS 128
                               L   GP G +I Y+   T++Y V Q+  E+  ++  +  +
Sbjct: 86  TMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQACCELGVSYATLPGN 145

Query: 129 FTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVIL 188
           +  +    +      A  ++Y   WA+   LEL      I++W  ++    +++IF+  +
Sbjct: 146 YNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSINPDVFVAIFYCFI 205

Query: 189 TISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTG 248
              + F  + Y E EF     KV  ++GFII    + CGA K+G +G +YW  PG +   
Sbjct: 206 VFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKSGYIGGKYWHTPGAF--- 262

Query: 249 IISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFY 308
                 A   F G  S  + +AF + G+E + +TA E  NPR++VPKA ++ ++R+L+ +
Sbjct: 263 --VGEKAIDHFKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPKATKRWLYRVLIVF 320

Query: 309 ILSLFFIGLLVPYDDVKLKSENSYVSS--SPFIIAIENSGTKILPHIFNGVILVTIISAG 366
           +  +  +G LVPYD   L       +S  SPF+IA  + G K++PHI N VIL+++IS G
Sbjct: 321 LTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHIINAVILISVISVG 380

Query: 367 NSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQ 426
           NS  Y   R+L  LA+ G GPK+F    + G P+  ++F ++FG ++F+  S   +  F 
Sbjct: 381 NSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLISFVAASDNEETVFT 440

Query: 427 WLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIII 486
           WL  +V ++  F+W  IS +HIRF   ++++G S  +L +KA    + ++YA    II++
Sbjct: 441 WLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYWGSWYAIAFNIIVL 500

Query: 487 FFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
             Q + A AP     K DV NFF +Y++  +   F+  ++LW++    WKL
Sbjct: 501 AAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRD---WKL 548

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  264 bits (675), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 159/491 (32%), Positives = 265/491 (53%), Gaps = 17/491 (3%)

Query: 50  SENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVV 109
           +E  +    ++K+ ++ RH                     L   GP G +I Y  +G+ +
Sbjct: 80  AEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCL 139

Query: 110 YSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQII 168
           Y + Q+ GE+A ++  ++ +F  +    +  A G +  ++Y   W     LEL      I
Sbjct: 140 YCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITI 199

Query: 169 QFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG- 227
           ++WT +V    +++IF+V++ + N+F  R Y E EF+    KV  I+GF I    + CG 
Sbjct: 200 KYWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGG 259

Query: 228 AGKTGPVGFRYWRNPGP-WGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEA 286
           AG  G +G RYW NPG  +GT  I        F G  S+++ AAF F  TE + +TA E 
Sbjct: 260 AGNDGYIGGRYWNNPGAFYGTKPIH------HFKGIISTMVTAAFAFGATEFIALTAAEQ 313

Query: 287 ANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENS 345
           ANPR+ +P A +KVV+RIL+ ++  +  IG LVP++  +L  S +S   +SP++IA+ + 
Sbjct: 314 ANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASH 373

Query: 346 GTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVF 405
           G +++PH  N VIL++++S GNS  Y  SRLL  LA     P       +SG P+ A++ 
Sbjct: 374 GVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLV 433

Query: 406 TSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLP 465
           + +FG ++F+  S   +  F WLL + G++  F+W+ I  +HIRF + L  +G    +L 
Sbjct: 434 SCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELG 493

Query: 466 FKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQ 521
           +K++     +YYAT +M  I+  Q + A AP    K D  +FF +Y+++ LF + +  F+
Sbjct: 494 YKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFK 553

Query: 522 LWFKCRYVWKL 532
           +W   +  W+L
Sbjct: 554 IW---KRDWRL 561

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  265 bits (678), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 159/560 (28%), Positives = 283/560 (50%), Gaps = 39/560 (6%)

Query: 2   SILDINTEETLEGKSKIV-------------IKSTESLEQHDLQGNED-KNTPTTTPSKE 47
           ++ D +++    GK KI+             I S    E  D   N D +N  TTT S  
Sbjct: 53  AVNDSDSDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTNRDIENELTTTLSPL 112

Query: 48  NVSEN--------EKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSL 99
           + +++        EKD++  +++ +  RH                   + L  +GP G +
Sbjct: 113 SATKDPQFAPHAEEKDDH--LQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLV 170

Query: 100 IAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFA 158
           I Y  +G+ +Y + Q+ GEMA  +  +  +F  +    +  A G +  ++Y   W     
Sbjct: 171 IGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMP 230

Query: 159 LELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFI 218
           LEL      IQ+WT  V    ++ IF+V++   N+F  + Y E EF+    KV  + GF 
Sbjct: 231 LELVTASMTIQYWTTTVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFF 290

Query: 219 IYCFCI-VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTE 277
           I    I   GAG  G +G +YW NPG +       + +  RF    S+   AAF F  +E
Sbjct: 291 ILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASE 345

Query: 278 LVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVS-SS 336
            + I A E +NPR+ +P A + +++RIL  ++ S+  +G LVPY+  +L    S  + +S
Sbjct: 346 FIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKAS 405

Query: 337 PFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKS 396
           P++IA+ + G +++PH  N VIL++++S  NS  Y   R+L+ L++ G  P  F    + 
Sbjct: 406 PYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDRE 465

Query: 397 GVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQS 456
           G P  A++ ++LF  +AF   S+  ++ F WLL + G++  F+W+ I  +HIRF + ++ 
Sbjct: 466 GRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKV 525

Query: 457 RGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFL 512
           +G S +++ FK++   + + YA I+M + +  + + + AP      D  NFF +Y+++ +
Sbjct: 526 QGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPI 585

Query: 513 FFIFWGSFQLWFKCRYVWKL 532
             + +  +++   C+  WKL
Sbjct: 586 LIVLYFGYKI---CKRDWKL 602

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  264 bits (674), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 169/495 (34%), Positives = 268/495 (54%), Gaps = 18/495 (3%)

Query: 48  NVSENEK----DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYL 103
           N+++ EK         +K  L  RH                     L  +GP G LI + 
Sbjct: 71  NLTDAEKIAIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWT 130

Query: 104 FLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSV 163
             GT++YS+  ++GE+A   PV+  FT ++ RF+  + G A  + Y   W +T  LE+  
Sbjct: 131 VTGTMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVS 190

Query: 164 VGQIIQFWTF-AVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCF 222
               + +W   A     ++++FWV   I NLF V+ YGE EF  A +KV  I+GFII   
Sbjct: 191 ASITVNYWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAV 250

Query: 223 CIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281
            ++CG G  G     +YW +PG +       + A  +F G+ +  I A+F+F G+E+VG+
Sbjct: 251 ILICGGGPVGGYIGAKYWHHPGAF-----VGDTAGQKFKGFCTVFITASFSFGGSEVVGV 305

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFII 340
              E+ NPR++VP A ++V +RI +FY+L L  IG+LVPY+D +L   +S   ++SPF+I
Sbjct: 306 AGSESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVI 365

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           A+ N G + LP + N VIL++++S GNS++Y+ SR L  LA+ G  PK+ A   ++G P+
Sbjct: 366 AVVNQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPL 425

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
            A+   S FG +AF+  S+   E F WLL + G++  FSW  I   HIRF + L ++G S
Sbjct: 426 VAIGIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRS 485

Query: 461 RNDLPFKAKF---MPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFW 517
            ++LPF +       Y   +  ++M+I  F+ G        +  +FF +Y+S  +   F+
Sbjct: 486 TDELPFVSTVGIAGSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFY 545

Query: 518 GSFQLWFKCRYVWKL 532
              ++W K    WKL
Sbjct: 546 IFHKIWKKN---WKL 557

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  263 bits (673), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 158/508 (31%), Positives = 265/508 (52%), Gaps = 25/508 (4%)

Query: 38  NTPT-------TTPSKENV------SENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXX 84
           NTP+        +P ++N+      S  ++D    + +DLS RH                
Sbjct: 43  NTPSPFNEKSKDSPIEDNIDITSQSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFV 102

Query: 85  XXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAA 144
                L   GP   +I ++ + T +++V  SLGE+A   PV   F ++  RF+ P+   A
Sbjct: 103 NSGAALASGGPASLVIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFA 162

Query: 145 NGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEF 204
               Y   W +   LEL      I++W   +   AW++IF+ ++T++N+  V+ +GE EF
Sbjct: 163 VNLNYLAQWLVLLPLELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEF 222

Query: 205 WIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWA 263
            ++ +K+ AI+GF I    + CG G  G     +YW NPG +       + +  +F G  
Sbjct: 223 VLSMVKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAF-----VGHTSGTKFKGLC 277

Query: 264 SSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDD 323
           S  + AAF++ G E+  ++A E+ +PR+T+PKA ++  + I   Y+  L  +G LVPYDD
Sbjct: 278 SVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDD 337

Query: 324 VKLKSENSYV--SSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLA 381
            +L S  S V  ++SP +IAIEN G K L  + N +IL++IIS  NS VY  SR +  +A
Sbjct: 338 PRLMSGTSSVDAAASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMA 397

Query: 382 KNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWL 441
             G  PK   K  K G P+ A + T  FG L+F+  S   +E F WL  + G++  F W+
Sbjct: 398 HIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWM 457

Query: 442 LISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----K 497
            I+ +HIRF Q +  +  S +++P+ ++   + + Y  +V+ +++    +T+  P     
Sbjct: 458 AINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDS 517

Query: 498 FDVLNFFASYISVFLFFIFWGSFQLWFK 525
            DV +FF  Y+S+ +  + +   +L+FK
Sbjct: 518 ADVQSFFEGYLSLPILIVCYIGHKLYFK 545

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  261 bits (666), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 158/492 (32%), Positives = 261/492 (53%), Gaps = 12/492 (2%)

Query: 22  STESLEQHDLQGNEDKNT--PTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXX 79
           S E ++    + N D+      +  +K+ V  N++     +K+ L +RH           
Sbjct: 11  SQEKVKSKICETNVDEQELECGSETAKQGVLYNDRTR---LKQGLKERHIKMLTLVGVFG 67

Query: 80  XXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSP 139
                     L   GPVG LIAYLF+G VV     ++ E+A+F+P T +    + +F+  
Sbjct: 68  TGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDE 127

Query: 140 ALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIY 199
           ++G   G++  +S  M    ELS    I+++WT   P   +I++F V+   +N++ +R Y
Sbjct: 128 SVGFTFGWISTYSSLMPG--ELSATAVIMKYWTDVSP-AVFITVFGVLFVATNIYTIRFY 184

Query: 200 GEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTGIISSNIAEAR 258
           GEIE+   +LK+  I   II    I  G  K    +GF YWR+PGP+   +++ +I   +
Sbjct: 185 GEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFANYLVAGHIG--K 242

Query: 259 FLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLL 318
           F+G+ +++ +  +++ G + + I AGE  N R  +    + V  RI+V Y++++F + L+
Sbjct: 243 FVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKNVFLRIIVLYLVTVFVLTLI 302

Query: 319 VPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLF 378
           VPY+D  + +      SSPF+IA+  +G K+LPHI N +IL +  SAGN  +  GSR LF
Sbjct: 303 VPYNDKLIATGTGTAKSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLF 362

Query: 379 GLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFF 438
            LA     P++F KT+K G+P   V+F S F  LA+M  S      F W   +V      
Sbjct: 363 CLATKNQAPQIFLKTSKRGIPYVGVIFISSFLPLAYMSCSESSATVFGWFQELVSSNTLL 422

Query: 439 SWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-K 497
            W+LIS  HI   + L+++G SR+DLP   +  P+ A+++ I+ +I +F  GF  F    
Sbjct: 423 RWILISANHIHMDRALKAQGYSRSDLPCSTRIAPFAAWFSGIMSVIFLFTGGFYNFMHGH 482

Query: 498 FDVLNFFASYIS 509
           FD+ +F    +S
Sbjct: 483 FDIESFLLDTLS 494

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  263 bits (673), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 165/495 (33%), Positives = 265/495 (53%), Gaps = 18/495 (3%)

Query: 48  NVSENEKDEY----HEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYL 103
           N++E EK  +      +K  L  RH                     L   GP   LI + 
Sbjct: 70  NLTEAEKVAFVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWG 129

Query: 104 FLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSV 163
             GT++YS+  +LGE+A   P++  FT ++ RF+  + G AN + Y   W +   LE+  
Sbjct: 130 STGTMIYSMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVS 189

Query: 164 VGQIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCF 222
               + FW T       ++++FW+++ I N+F V+ YGE EF  +F+KV  ++GFII   
Sbjct: 190 ASITVNFWGTDPKYRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGI 249

Query: 223 CIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281
            + CG G  G     +YW +PG +     + +   A+F G  S  + +AF+F G+ELVG+
Sbjct: 250 ILNCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGL 304

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFII 340
            A E+ +PR++VPKA ++V +RI +FYILSL  +GLLVPY+D  L   +S   ++SPF+I
Sbjct: 305 AASESVDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVI 364

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           AI+  G K LP + N VIL+ ++S GNS +Y  SR +  LA+    P++FA   + G P+
Sbjct: 365 AIKTHGIKGLPTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPL 424

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
             +  TS FG +AF+  S    + F WLL + G++  F+W  I   HIRF + L ++G  
Sbjct: 425 VGIAVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRD 484

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYISVFLFFIFW 517
            ++L FK+    + +Y+   +++I+   Q + A  P         FF +Y+S  L    +
Sbjct: 485 LDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMY 544

Query: 518 GSFQLWFKCRYVWKL 532
              +++   +  WKL
Sbjct: 545 LGHKIY---KRNWKL 556

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  264 bits (675), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 177/539 (32%), Positives = 276/539 (51%), Gaps = 43/539 (7%)

Query: 7   NTEETLEGKSKIVIKSTESLEQHDLQGNEDKN------TPTTTPS--------------- 45
           N +E  + K   ++ S++ L Q ++Q +          T TT PS               
Sbjct: 22  NMQEKTDQKETYIVGSSD-LTQENIQSSITHTISNPSFTSTTQPSTTRWQKFKDSFKKAE 80

Query: 46  ----KENVSENEKDEYHEVK----RDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVG 97
                 N++E E+      K      L  R                      L   GP G
Sbjct: 81  DVELDPNLTEAERIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAG 140

Query: 98  SLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTF 157
            +I +    T++YS+  +LGE+A   PV   FT ++ RF+  + G AN + Y   W +  
Sbjct: 141 LIIGWGLTSTMIYSMVMALGELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVL 200

Query: 158 ALELSVVGQIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILG 216
            LE+      + +W T       ++++FW+++ I N+F V+ +GE EF  + +KV  ++G
Sbjct: 201 PLEIVSASITVNYWGTPTRYRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIG 260

Query: 217 FIIYCFCIVCGAGKTGPVGF-RYWRNPGPW-GTGIISSNIAEARFLGWASSLINAAFTFQ 274
           FII    +VCG G  G     +YW +PG + G G      + A+F G  S  + AAF+F 
Sbjct: 261 FIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHG------SGAQFKGVCSVFVTAAFSFA 314

Query: 275 GTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-V 333
           G+EL+GITA EAANPR+++P A ++VV+RI++FY+ +L  IGLLVPY+D +L   +S   
Sbjct: 315 GSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDA 374

Query: 334 SSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKT 393
           ++SPF+IAI   G K LP + N VIL+ ++S GNS ++  SR +  L+  G  PK+F   
Sbjct: 375 AASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYI 434

Query: 394 TKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQC 453
            +SG P+  +  TS FG LAF+  S    E F WLL + G++  F+W  I   HIRF   
Sbjct: 435 DRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMA 494

Query: 454 LQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYIS 509
           L+++G   N+L F +      +Y+   +++++   Q + A  P   K D   FF SY+S
Sbjct: 495 LKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLS 553

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  264 bits (674), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 153/494 (30%), Positives = 264/494 (53%), Gaps = 16/494 (3%)

Query: 38  NTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVG 97
           N   + PS E V + E     E+KRD+++RH                   + L  +GP G
Sbjct: 100 NYHGSIPSDEVVIKKE-----ELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAG 154

Query: 98  SLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMT 156
            LI Y  +GT VY V Q+ GE+  T+  +   F  +    ++P+   + G++Y   W   
Sbjct: 155 LLIGYALMGTCVYCVIQAAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCM 214

Query: 157 FALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILG 216
             LEL      I++WT  V    ++ IF++++ + N F  + Y E +F+   +K+  I G
Sbjct: 215 TPLELVTASLTIKYWTTKVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISG 274

Query: 217 FIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQG 275
           F I    + CG AG  G +G +YW NPG +         A   F G +S  + +AF F G
Sbjct: 275 FFILGIVVACGGAGHDGYLGGKYWHNPGAF-----RGEKAIDHFKGVSSVFVTSAFAFGG 329

Query: 276 TELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSS 335
           +E V ++A E ANPR+++P A + +++RI+  Y+ S+  +G LVP+D  +L+  +    +
Sbjct: 330 SEFVALSASEQANPRKSIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKT 389

Query: 336 SPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTK 395
           SP+++AI   G K++PH+ N VIL+ ++S  NS  +  SRLL  L++ G  PK F    +
Sbjct: 390 SPYVVAIAMHGVKVVPHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDR 449

Query: 396 SGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQ 455
            G PV A++ ++LFG + F  TS    + F WLL + G++  F++  I  +HIR    ++
Sbjct: 450 KGRPVRAMLISALFGVICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMK 509

Query: 456 SRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVF 511
            +G S  +L F+++   Y ++YA +++++ +  + + A AP    K D  +FF +Y++  
Sbjct: 510 VQGRSLGELGFRSQVGTYGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAP 569

Query: 512 LFFIFWGSFQLWFK 525
           +  +F+  + +W K
Sbjct: 570 IGIVFYFGYMIWKK 583

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  263 bits (672), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 160/527 (30%), Positives = 264/527 (50%), Gaps = 24/527 (4%)

Query: 10  ETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEK-----DEYHEVKRDL 64
           E    +++++ + T+S ++       + +T    P  EN S+ E          ++K+ +
Sbjct: 42  EQKPKRNRLIHRFTDSFKR------AEGSTTKIKPINENTSDLEDGIQSFTSDSKLKKSM 95

Query: 65  SKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP 124
             RH                     L   GP   +I Y+ +  + Y + Q+ GEMA   P
Sbjct: 96  KSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGEMAVTYP 155

Query: 125 -VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISI 183
            + A+F  +S  F+S   G A  ++Y F W     LEL      IQFW   +    +I I
Sbjct: 156 TLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDKINPDIYILI 215

Query: 184 FWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNP 242
           F+V L   + F V+ YGE EF     K+  I GFI+    I CG AG  G +G  YW  P
Sbjct: 216 FYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKP 275

Query: 243 GPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVF 302
           G +     + + + ARF      L+ A F+F G EL  ++  E  NPR++ P A ++ ++
Sbjct: 276 GAF-----AGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIY 330

Query: 303 RILVFYILSLFFIGLLVPY-DDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVT 361
           RI+V Y+L++  IG  VPY DD  L +  S   +SP+++A    G +I+PHI N VIL++
Sbjct: 331 RIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIHGVRIVPHIINAVILIS 390

Query: 362 IISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGG 421
           ++S  NS++Y G RL+  LA+ G  PK      + G P+ A++   + G +AF+  S+  
Sbjct: 391 VVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKE 450

Query: 422 DEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIV 481
           +  F WL  + G++  F+W  I  +H+RF Q ++ +G S N+L +KA    + + Y +  
Sbjct: 451 EIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFF 510

Query: 482 MIIIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLW 523
            I++   Q + A AP     K +   FF SY++  ++ IF+  + ++
Sbjct: 511 NILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIY 557

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  263 bits (673), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 159/517 (30%), Positives = 264/517 (51%), Gaps = 17/517 (3%)

Query: 15  KSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXX 74
           ++ +V +  +S ++ D Q     +    + ++  +SE+       +K+ +  RH      
Sbjct: 62  RTGLVHRFMDSFKRADGQRAGFDDNDLESGTRSFISESH------LKKSMKSRHVVMMTL 115

Query: 75  XXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASFTIFS 133
                        + L  SGP   ++AY  +  V Y + Q+ GEMA   P +  +F  + 
Sbjct: 116 GTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQAAGEMAVTYPTLPGNFNSYM 175

Query: 134 HRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNL 193
             F+S   G A  +++   W     LEL      I++W   +    ++ IF+V L   + 
Sbjct: 176 SLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWNDKINSDVFVVIFYVFLLFIHF 235

Query: 194 FPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISS 252
           F V+ YGE EF     K+  I GFII+   + CG AG  G +G +YW +PG +     +S
Sbjct: 236 FGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHDPGAF-----TS 290

Query: 253 NIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSL 312
           +    RF G    L+ A F++ GTEL  ++  E  NPR++ P+A ++ ++RI+V Y+L++
Sbjct: 291 HTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKSTPQAAKQSIYRIVVIYLLTM 350

Query: 313 FFIGLLVPYDDVKLK-SENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVY 371
             IG  VP+D+ +L  S  S   +SP+++A    G +I+PH  N VIL+++IS  NS++Y
Sbjct: 351 ILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVPHFINAVILISVISVANSSLY 410

Query: 372 IGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNV 431
              RLL  LA+ G  PK      + G P+ A+   SLFG + F   S   ++ F WL  +
Sbjct: 411 ASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGVIGFAAASNQEEQVFTWLAAI 470

Query: 432 VGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGF 491
            G++  F+W  I  +H+RF Q ++ +G   N+L +KA    + + Y     I++ F Q +
Sbjct: 471 AGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSGVWGSVYGVFFNILVFFAQFW 530

Query: 492 TAFAP---KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
            A AP   K   L+FF SY++  +FF F+  + LW K
Sbjct: 531 VALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWNK 567

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  263 bits (671), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 152/511 (29%), Positives = 259/511 (50%), Gaps = 22/511 (4%)

Query: 20  IKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXX 79
           + S +  EQ  L+ + D    T T   +           ++K+ +  RH           
Sbjct: 45  VNSFKRAEQPPLKQDSDLEEDTDTIVTDT----------QLKKTMKSRHVVMMSLGTGIG 94

Query: 80  XXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASFTIFSHRFLS 138
                     L  +GP   +IAY  +  V Y + Q+ GEMA   P +  +F  +   F+S
Sbjct: 95  TGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFIS 154

Query: 139 PALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRI 198
              G A  ++++  W     LEL      +Q+W  ++    ++ IF+V L   + F V+ 
Sbjct: 155 KPFGFATVWLFFIQWLTVLPLELITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKA 214

Query: 199 YGEIEFWIAFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEA 257
           YGE EF     K+  + GFII+   + V GAG +G +G +YW +PG +     +S+    
Sbjct: 215 YGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNAG 269

Query: 258 RFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGL 317
           RF G    L+ A F++ G EL  ++  E  NPR++ P A ++ ++RI+V Y+L++  +G 
Sbjct: 270 RFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGF 329

Query: 318 LVPYDDVKLK-SENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRL 376
            VP +  +L  S  S   +SP+++A    G K++PHI N VIL+++IS GNS +Y   RL
Sbjct: 330 NVPSNSNELMGSGGSVTHASPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRL 389

Query: 377 LFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAG 436
           +  LA+ G  PK      + G P+FA++  S+FG + F+  S+  ++ F WL  + G+A 
Sbjct: 390 MCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAE 449

Query: 437 FFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP 496
            F+W  I  +HIRF Q ++ +  S +++ +K+ F  Y +Y+     +++   Q + A AP
Sbjct: 450 LFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAP 509

Query: 497 ----KFDVLNFFASYISVFLFFIFWGSFQLW 523
               +     FF SY++  +FF F+  + +W
Sbjct: 510 PMYTEMSADTFFESYLAFPIFFAFYFGYMIW 540

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  261 bits (667), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 162/472 (34%), Positives = 254/472 (53%), Gaps = 15/472 (3%)

Query: 48  NVSENEK----DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYL 103
           N++E EK         +K  L  RH                     L   GP   LI + 
Sbjct: 70  NLTEAEKVAIVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWG 129

Query: 104 FLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSV 163
             GT++Y++  +LGE+A   P++  FT ++ RF+  + G AN + Y   W +   LE+  
Sbjct: 130 STGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVS 189

Query: 164 VGQIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCF 222
               + FW T       ++++FWV++ I N+F V+ YGE EF  +F+KV  ++GFII   
Sbjct: 190 ASITVNFWGTDPKYRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGI 249

Query: 223 CIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281
            + CG G  G     +YW +PG +     + +   A+F G  S  + +AF+F G+ELVG+
Sbjct: 250 ILNCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGL 304

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFII 340
            A E+  PR++VPKA ++V +RI +FYILSL  IGLLVPY+D  L   +S   ++SPF+I
Sbjct: 305 AASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVI 364

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           AI+  G K LP + N VIL+ ++S GNS +Y  SR +  LA+    P++FA   + G P+
Sbjct: 365 AIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPL 424

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
             +  TS FG +AF+  S    + F WLL + G++  F+W  I   HIRF + L ++G  
Sbjct: 425 VGIGVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRD 484

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYIS 509
            ++L FK+    + +Y+   +++I+   Q + A  P         FF +Y+S
Sbjct: 485 LDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLS 536

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  262 bits (670), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 157/525 (29%), Positives = 266/525 (50%), Gaps = 23/525 (4%)

Query: 7   NTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSK 66
           N + T E +S +V +  +S +         +   +T    E+ ++   D  H +K+ +  
Sbjct: 32  NLDATEESRSGLVHRFVDSFK---------RAQDSTENDLEDGTKPLGDASH-LKKAMKS 81

Query: 67  RHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-V 125
           RH                   + L   GP   +I Y+ +  V Y + Q+ GEMA   P +
Sbjct: 82  RHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTL 141

Query: 126 TASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFW 185
             +F  ++  F+S   G A  ++++  W   F LEL      I++W   +    +I IF+
Sbjct: 142 PGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKINADVFIVIFY 201

Query: 186 VILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGP 244
           V L   + F V+ YGE EF     KV  I GFII    I CG AGK G +G +YWR+PG 
Sbjct: 202 VFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGS 261

Query: 245 WGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRI 304
           +  G      +  +F G    L+ A F++ G EL  ++  E  NPR++ P+A ++ ++RI
Sbjct: 262 FAEGD-----SVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRI 316

Query: 305 LVFYILSLFFIGLLVPYDDVKLK-SENSYVSSSPFIIAIENSGTKILPHIFNGVILVTII 363
           L+ Y+L++  IG  VP+++ +L  S  S   +SP+++A    G K++PH  N VIL+++I
Sbjct: 317 LIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFINAVILISVI 376

Query: 364 SAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDE 423
           S  NS +Y   RL+  LA+ G  PK      + G P+ A++  ++FG + F+  S+  +E
Sbjct: 377 SVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSKEEE 436

Query: 424 AFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMI 483
            F WL  + G++  F+W  I  +H+RF QC++  G S  ++ F+A    + + Y     +
Sbjct: 437 VFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNM 496

Query: 484 IIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLW 523
           ++   Q + A AP     K D  +FF SY++  ++  F+  + L+
Sbjct: 497 LVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLY 541

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  261 bits (668), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 166/507 (32%), Positives = 251/507 (49%), Gaps = 37/507 (7%)

Query: 7   NTEETLEGKSK----IVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKR 62
           N E+T +G +K    ++IK+ +  E+ D+    D NT                    VKR
Sbjct: 12  NVEKTDKGDAKSPSALIIKAVDISEEPDVS-KFDPNT-------------------GVKR 51

Query: 63  DLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATF 122
            L  RH                   N L   GP+  L+ +  +G + ++V +S+GE+ T 
Sbjct: 52  ALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESIGEIITL 111

Query: 123 IPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWIS 182
            P    FT  + RF   AL A  GY Y   +    A E + +  I+QFW   VPL  +I 
Sbjct: 112 YPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYIL 171

Query: 183 IFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPV-GFRYWRN 241
           IFW    I  L  V ++GE E+W+++ K+  ++ + I+    + G  K  P  GF YW +
Sbjct: 172 IFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFGFHYWNS 231

Query: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVV 301
           PG    G          F G A   +  +  + GTE V + A E+ NP + VP A+R+ +
Sbjct: 232 PGSLSHG----------FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAVPLAVRQTL 281

Query: 302 FRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVT 361
           +R+L+ YI    F G  VP+DD  L S  + V  SP  IAI  +G     H+ N  ILVT
Sbjct: 282 WRVLIVYIGIAVFYGATVPFDDPNL-SATTKVLKSPISIAISRAGWAGGAHLVNAFILVT 340

Query: 362 IISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGG 421
            ISA N ++YIGSR L  LA  G  PK+ A T + GVP+ A+   +  G ++ M  S G 
Sbjct: 341 CISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGA 400

Query: 422 DEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIV 481
            +A+ +++N+ GV  F  W +IS+ H+R  +   ++G S  +LP+KA   P+   ++ I 
Sbjct: 401 SDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTPIFSLIA 460

Query: 482 MIIIIFFQGFTAFAPKFDVLNFFASYI 508
            + +   QG+T+F P FD  NF  +YI
Sbjct: 461 NVFLALIQGWTSFVP-FDAGNFVDAYI 486

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  262 bits (669), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 158/522 (30%), Positives = 259/522 (49%), Gaps = 31/522 (5%)

Query: 13  EGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXX 72
           +   K  IK   S E+  +    D      + +KE+ S N       +K  L  RH    
Sbjct: 20  DKNDKNNIKDGVSFEKPIIYSEVD----IESGAKESSSRN-------LKHGLQSRHIQLI 68

Query: 73  XXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTAS---- 128
                          + L   GP   +I+Y+ + T+VY +    GEM  ++P        
Sbjct: 69  ALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGNDDDDES 128

Query: 129 ---FTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFW 185
                    +++  +LG A  + Y++ + +  A E +    I+++WT  +P    I +F 
Sbjct: 129 VGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSKIPKAVLIFLFL 188

Query: 186 VILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP----VGFRYWRN 241
            ++ + N  PV+ YGE EFW A +K+  I G II  F I CG          VGF YW+N
Sbjct: 189 GVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFVGFHYWKN 248

Query: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKV 300
           P  +   +  +N +   FL   ++LI  AF F  G ELV +T+ E  + R+ + KA R+ 
Sbjct: 249 PSSFRDYV--TNGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNIAKASRRF 306

Query: 301 VFRILVFYILSLFFIGLLVPYDDVKLKS----ENSYVSSSPFIIAIENSGTKILPHIFNG 356
           V+R++ FYI     I ++VPY+D  L +          SSPF+I I+N+G  ILPHI N 
Sbjct: 307 VYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAGITILPHIINF 366

Query: 357 VILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFME 416
            IL + +SAGN+ ++  +R L  + KNG+ P++F++  + GVP  A+  + +   LAF+ 
Sbjct: 367 CILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMIACLAFLN 426

Query: 417 TSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAY 476
            S    + FQW  N+  ++GF  W     A++RF + +   G+  + LPFK K   YL +
Sbjct: 427 CSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRLPFKTKGQVYLTW 485

Query: 477 YATIVMIIIIFFQGFTAFAPKF-DVLNFFASYISVFLFFIFW 517
           Y+ + + I+I   G+    PKF +  +F A+YI++ +F + +
Sbjct: 486 YSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLY 527

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  260 bits (664), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 158/468 (33%), Positives = 239/468 (51%), Gaps = 13/468 (2%)

Query: 42  TTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIA 101
           T   +++   +E D    VKR L  RH                   N L   GP+  L+ 
Sbjct: 14  TVKIRDDRDVSEFDPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLG 73

Query: 102 YLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALEL 161
           ++ +G + ++V +S+GEM T  P    FT  + RF S AL A  GY Y   +    A E 
Sbjct: 74  FVIIGIIAFAVMESIGEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEY 133

Query: 162 SVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYC 221
           + +  I+QFW   VPL A+  IFW++  I  L  V ++GE E+W++ LK+  ++ + I+ 
Sbjct: 134 NTLSSILQFWGPQVPLYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFS 193

Query: 222 FCIVCGAGKTGPV-GFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVG 280
              + G  +  P  GF YW++PG    G          F G A   +  +  + GTE V 
Sbjct: 194 IIYMSGGVRNKPAFGFHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVA 243

Query: 281 ITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFII 340
           +TA E+ NP ++VP A+R+ ++RI+V YI    F G  VP++D  L S N+ V  SP  I
Sbjct: 244 LTATESKNPTKSVPYAVRQTLWRIVVVYIGIAIFYGSTVPFNDPNL-SVNTKVLKSPIAI 302

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           AI  +G     H+ N  IL + ISA N ++YIGSR L  LA  G  PK  A T K GVP+
Sbjct: 303 AISRAGWAGGSHLVNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPI 362

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
            A+   +  G ++ M  S G   A+ +++N+ GV  F  W +IS+ H+R  +   ++G  
Sbjct: 363 PAITIFNALGLISLMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRL 422

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYI 508
             +LP+KA F P+   ++ I  I +   QG+T+  P F    F  +YI
Sbjct: 423 LEELPYKALFYPWTPIFSLISNIFLALIQGWTSLVP-FKAPEFVDAYI 469

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  262 bits (670), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 160/539 (29%), Positives = 277/539 (51%), Gaps = 26/539 (4%)

Query: 5   DINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTT----TPSKENVSENEKDEYHEV 60
           D    E  + +S+  +K  ++  +  LQ NE K   ++     P  +N SE E  E + +
Sbjct: 33  DFAITEKQDEESEQQVKPQKTGNKSKLQ-NECKKILSSFKRQLPPSQN-SELESQEKNNL 90

Query: 61  KRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA 120
            + +  RH                     L  +GP G ++ Y     ++Y + Q+ GE+ 
Sbjct: 91  TKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCIIQAAGELG 150

Query: 121 -TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPA 179
             +  +T ++T +    + P+LG A   +Y   W     L+L      +++WT +V    
Sbjct: 151 LCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-SVNSDI 209

Query: 180 WISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRY 238
           ++++ ++ + I NLF  R Y E EF     K+  ++GF+I    I CG AG    +G  Y
Sbjct: 210 FVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGAGDRKYIGTEY 269

Query: 239 WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIR 298
           W NPGP+  G          F G  +    AAF++ G E++ ++A E  NP +++P A +
Sbjct: 270 WHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACK 319

Query: 299 KVVFRILVFYILSLFFIGLLVPYD-DVKLKSENSYVS-SSPFIIAIENSGTKILPHIFNG 356
           KVV+RIL+ Y+L+   +  LVPY+ D  L S++S  S +SPF+IA+ + G K++PH  N 
Sbjct: 320 KVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKVVPHFINA 379

Query: 357 VILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFME 416
           VIL+++IS  NS++Y G RLL  LA+ G  PK  A   + G P+   + +  FG + F+ 
Sbjct: 380 VILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFGCIGFVA 439

Query: 417 TSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAY 476
           TS   +E F WLL +  ++  F W+ +S +HIRF   +  +G S N++ +KA+   + ++
Sbjct: 440 TSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSW 499

Query: 477 YATIVMIIIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVW 530
            A ++ +  +  Q + A AP     K +V  FF +Y+++ +  + +   +++FK    W
Sbjct: 500 LAVLIAVFFLVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYFKSWSFW 558

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  262 bits (670), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 159/551 (28%), Positives = 270/551 (49%), Gaps = 34/551 (6%)

Query: 2   SILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTT-------------PSKEN 48
           S+ D    E  +    I  K  E  EQ       D+                   PS +N
Sbjct: 20  SLHDRGNAEKKKRDFTITEKQNEEPEQQGSPQKTDRKPKLRNEFRKFFDSFKRQLPSDQN 79

Query: 49  VSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTV 108
            SE E  E + +++ +  RH                     L  +GP G ++ Y     +
Sbjct: 80  -SELESQEKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIM 138

Query: 109 VYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQI 167
           +Y + Q+ GE+   +  +T ++T +S   + P+LG A   +Y   W     L+L      
Sbjct: 139 LYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMT 198

Query: 168 IQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG 227
           +++WT  V    ++++ ++ + I NLF  R Y E EF     K+  + GF+I    I CG
Sbjct: 199 VKYWT-NVNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCG 257

Query: 228 -AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEA 286
            AG    +G  YW NPGP+  G          F G  +    AAF++ G E++ ++A E 
Sbjct: 258 GAGDRRYIGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQ 307

Query: 287 ANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPY--DDVKLKSENSYVSSSPFIIAIEN 344
            NP +++P A +KVV+RIL+ Y+L+   IG LVPY  D++     +S   +SPF+IA+ +
Sbjct: 308 ENPTESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSS 367

Query: 345 SGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVV 404
            G K++PH  N VIL+++IS  NS++Y G RLL  LA+ G  PK  A   ++G P+   +
Sbjct: 368 HGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFL 427

Query: 405 FTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDL 464
            +  FG + F+ TS   ++ F WLL +  ++  F W+ +  +HIRF   +  +G S +++
Sbjct: 428 VSLAFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEV 487

Query: 465 PFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGS 519
            +KA+   + ++ A ++ +  +  Q + A AP     K DV  FF +Y+++ +  + +  
Sbjct: 488 GYKAQTGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFG 547

Query: 520 FQLWFKCRYVW 530
            +++FK    W
Sbjct: 548 HKMYFKSWRFW 558

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  261 bits (668), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 164/541 (30%), Positives = 276/541 (51%), Gaps = 32/541 (5%)

Query: 7   NTEETLEGKSKIVIKSTESLEQHD-----LQGNEDKNTPTTTPSKENVSENEKDEYHEVK 61
            ++E    KS +  +  +S ++ D     + GN +       PS+  + E        +K
Sbjct: 51  QSDEEYAAKSSVWHRFKDSFKRADHINTNIHGNAELEL---NPSQSLLPEKGAS----LK 103

Query: 62  RDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT 121
           RD+  RH                     L   GP G  I Y  +G+ +YS+ Q+ GE+A 
Sbjct: 104 RDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAV 163

Query: 122 FIP-VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAW 180
             P +T +F  +    + PA+  A   +Y   W   F LE+      I++W  ++    W
Sbjct: 164 AYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSINPNVW 223

Query: 181 ISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYW 239
             IF+V++   N+     Y E +F+    K+    GF I    I CG AG +  +G +YW
Sbjct: 224 CVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYW 283

Query: 240 RNPGPWG--TGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAI 297
            +PG +   TGI       +RF    S+L+ AAF F  +E V +TA E ANPR+ +P A 
Sbjct: 284 NDPGAFNGDTGI-------SRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAA 336

Query: 298 RKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSGTKILPHIFNG 356
           ++V++RI+  Y+ S+  +G LVPY+  +L  S +S V SSP++IA+ + G K++P   N 
Sbjct: 337 KQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFINA 396

Query: 357 VILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFME 416
           VIL++++S GN + Y  SR+L  L++ G  PK F    + G P++A++  +L G + F+ 
Sbjct: 397 VILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVS 456

Query: 417 TSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAY 476
            S+  +  F WL+ V G++  F+W  I  +H+RF + +Q +  S  +L F+++   + +Y
Sbjct: 457 ASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSY 516

Query: 477 YATIVMIIIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWK 531
           Y   +MI++   Q + A  P       D  NFFA+Y+++ +F   +  F++W K    W+
Sbjct: 517 YGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKK---DWR 573

Query: 532 L 532
           L
Sbjct: 574 L 574

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  261 bits (667), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 152/501 (30%), Positives = 266/501 (53%), Gaps = 14/501 (2%)

Query: 32  QGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLM 91
           +G  +KN  TT PS E  S  ++D    + +DLS RH                     L 
Sbjct: 66  EGGSEKNIETT-PS-EQFSIAKEDINENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALA 123

Query: 92  ISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWF 151
             GP   +I ++ + T +++V  +LGE+A   PV   F ++  RF+ P++  A    Y  
Sbjct: 124 SGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLA 183

Query: 152 SWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKV 211
            W +   LEL      I++W   +   AW++IF+ ++ ++N+  V+ +GE EF ++ +K+
Sbjct: 184 QWLVLLPLELVAASITIKYWNDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKI 243

Query: 212 NAILGFIIYCFCIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAA 270
            AI+GF I    + CG G  G      YW +PG +       +    +F G  S  + AA
Sbjct: 244 LAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSF-----VGDKPGTQFKGLCSVFVTAA 298

Query: 271 FTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSEN 330
           F++ G EL  ++A E+ +PR+T+PKA ++  + +   Y+  L  IG LVP+DD +L + +
Sbjct: 299 FSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGS 358

Query: 331 SYV--SSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPK 388
           S V  ++SP +I+I+N+G K L  + N +IL++I+S  NS VY  SR +  +A  G  PK
Sbjct: 359 SSVDAAASPLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPK 418

Query: 389 LFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHI 448
           + ++  K G PV A++ T  FG L+F+  S    E F WL  + G++  F W+ I+++HI
Sbjct: 419 VLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHI 478

Query: 449 RFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFF 504
           RF   ++ +  + ++LP+ ++     ++Y  IV+ +++    +T+  P      DV +FF
Sbjct: 479 RFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFF 538

Query: 505 ASYISVFLFFIFWGSFQLWFK 525
             Y+S+ +    +   +L+ +
Sbjct: 539 EGYLSLPILIACYVGHKLYVR 559

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  262 bits (670), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 162/519 (31%), Positives = 270/519 (52%), Gaps = 18/519 (3%)

Query: 15  KSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXX 74
           K    I S E +   ++    + +     P ++   EN+ DE   +K+ +  RH      
Sbjct: 109 KDTASITSNEMMIDEEILSLSNLDGQRVPPPRK--IENKSDE---LKKTIKPRHVLMISL 163

Query: 75  XXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFS 133
                        + L+ +GP G L+ +  +GT +Y + Q++GEMA  +  +   F  + 
Sbjct: 164 GTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVGGFNAYP 223

Query: 134 HRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWV-ILTISN 192
              + PA G +  ++Y   W     LEL      I++WT  V    ++ IF+V IL I+ 
Sbjct: 224 SFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVLILAINI 283

Query: 193 LFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVGFRYWRNPGPWGTGIIS 251
           +     Y E EF     K+  ++GF I    I+CG     G +G +YW  PG +      
Sbjct: 284 VGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPGAF-----R 338

Query: 252 SNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILS 311
              A  RF G  ++L+NAAF F  +E +G+TA E +NPR+ +P A +K+++RI+  ++ S
Sbjct: 339 GEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRIVCMFLAS 398

Query: 312 LFFIGLLVPYD-DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNV 370
           +  +G LVPYD D  L S    V +SP+++A+   G K++PH  N VIL++++S  NS  
Sbjct: 399 ITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVVPHFINAVILISVLSVANSAF 458

Query: 371 YIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLN 430
           Y  SR+L  LA+ G  PK+F    + G P+  +   SLFG +AF  TS   DE F WLL 
Sbjct: 459 YSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCATSPKEDEVFVWLLA 518

Query: 431 VVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQG 490
           + G++  F+W+ I  +H+RF + +  +G S  +L F+++   + + YA I+M+ I+  Q 
Sbjct: 519 ISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCILIAQF 578

Query: 491 FTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
           + A AP    K D  NFF +Y+++ +    +  ++++ K
Sbjct: 579 WVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTK 617

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  259 bits (662), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 159/507 (31%), Positives = 259/507 (51%), Gaps = 18/507 (3%)

Query: 29  HDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXN 88
           HD+     ++     PS E             +R L  R                     
Sbjct: 23  HDVGAETIRSLEGQAPSLEE---------RIARRKLFPRQVSMIGIGGAIGTALFVSIGT 73

Query: 89  PLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYM 148
            ++  GP   LIA+     V   ++Q +  M T++PVT SF  F+ RF+  + G + G+ 
Sbjct: 74  QIIHGGPGSLLIAFCLWSVVFIGLSQCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWT 133

Query: 149 YWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAF 208
           Y+   A     E++ V  +++FWT  +P  A ISI   +    NLF V I+GE EF+++ 
Sbjct: 134 YFVCQAANVCFEITAVCLVVEFWTDKIPKAALISILIALFGSLNLFSVFIFGEGEFYLSI 193

Query: 209 LKVNAILGFIIYCFCIVCGAGKTGPV-GFRYWRNPGPWGTGIISSNIAEARFLGWASSLI 267
            KV   +G I +   ++ G      V GF+ W NPG +   I  S  +  +F G+ S LI
Sbjct: 194 GKVILAIGLIFFTIVVMAGGNPQHKVLGFKNWSNPGAFAEYI--SKGSAGKFHGFMSCLI 251

Query: 268 NAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDD---V 324
            A + F G + +G  A EA NPR+ +P + RKV  R+++FYI     +G+LVP++D   +
Sbjct: 252 FALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMI 311

Query: 325 KLKSENSY-VSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKN 383
           K  SE +    +SP++ A++  G  +LPHI N +IL +IISAGNS++Y  SR+L  LA  
Sbjct: 312 KAISEGAVGAGASPYVSAMKTLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALE 371

Query: 384 GTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLI 443
           G  PKLF K TK GVP++  V   L   LA++  S   +    W LNV   A    ++ I
Sbjct: 372 GQAPKLF-KITKRGVPIYCCVAVLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFI 430

Query: 444 SFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF-APKFDVLN 502
             ++++F +  +++ I    LP+ + F+PYL +++   +++++F  G+  F    +D+ +
Sbjct: 431 CISYLQFAKGCKAQNIDLKTLPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQS 490

Query: 503 FFASYISVFLFFIFWGSFQLWFKCRYV 529
           F  SY  +  F + +   +L+ K R+V
Sbjct: 491 FIFSYFMIPFFIVLFAGHKLYKKTRFV 517

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  260 bits (665), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 162/517 (31%), Positives = 256/517 (49%), Gaps = 27/517 (5%)

Query: 20  IKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXX 79
           + S +  E+H    N D    TT     +V+ +       +KR +  RH           
Sbjct: 52  VNSFKRAEKHSTPSNGDLEHATT----HSVASSSP-----LKRSIKPRHVAMMSICTGIG 102

Query: 80  XXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASFTIFSHRFLS 138
                     L   GP G +I Y  +  V Y + Q+ GEMA   P +  +F  +S + +S
Sbjct: 103 TGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLIS 162

Query: 139 PALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRI 198
              G A  ++Y   W     LEL      I++W  ++    +I+IF+V +   + F  R 
Sbjct: 163 RPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRG 222

Query: 199 YGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEA 257
           YGE EF     KV  I+GF+I    I CG AG    +G +YW +PG +  G         
Sbjct: 223 YGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVGS-----GAT 277

Query: 258 RFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGL 317
           +F G A  L+   F++ GTEL  +T  E +NPR+ +    ++ ++RIL+ Y+L++  IG 
Sbjct: 278 KFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGF 337

Query: 318 LVPYDDVKL--KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSR 375
           LVP+   +L   S  S   +SP+++A+   G KI+PHI N VIL+ +IS GNS +Y G R
Sbjct: 338 LVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPR 397

Query: 376 LLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVA 435
           +L  LA+ G  P+  A   ++G P+ A++  S+FG LAF+  S   ++ F WL  + G++
Sbjct: 398 ILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLS 457

Query: 436 GFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFA 495
             F+W  I  +H+RF Q ++      ++L +KA      +       I++   Q + + A
Sbjct: 458 ELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIA 517

Query: 496 P-----KFDVLNFFASYIS----VFLFFIFWGSFQLW 523
           P     K DVL+FF SY++    V LFF +   F+ W
Sbjct: 518 PFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNW 554

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  260 bits (664), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 165/496 (33%), Positives = 270/496 (54%), Gaps = 18/496 (3%)

Query: 48  NVSENEKDEY----HEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYL 103
           N++E EK  +      +K  L  RH                     L   GP   LI + 
Sbjct: 69  NLTEAEKVAFITAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWG 128

Query: 104 FLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSV 163
            +GT++Y++  +LGE+A   P++  FT ++ RF+  + G A  + Y   W +T  LE+  
Sbjct: 129 SMGTMIYAMVMALGELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVS 188

Query: 164 VGQIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCF 222
               + +W T       ++++FW+++   N+F V+ YGE EF  + +KV  I+GFII   
Sbjct: 189 ASITVNYWGTDPKYRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGI 248

Query: 223 CIVCGAG-KTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281
            + CG G + G +G +Y+ +PG +     + +   A+F G  S  + AAF+F G+ELVG+
Sbjct: 249 ILNCGGGPEKGYIGGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGL 303

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFII 340
            A E+ +PR++VPKA ++V +RI +FYILSL  IGLLVPY+D +L   +S   ++SPF+I
Sbjct: 304 AASESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVI 363

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           AI   G K LP + N VIL+ ++S GNS ++  SR    LA+ G  P++FA   + G P+
Sbjct: 364 AIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPL 423

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
             ++ TS  G +AF+  S   ++ F WLL + G++  F+W  I   HIRF + L S+G S
Sbjct: 424 VGIIITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRS 483

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYISVFLFFIFW 517
            ++L FK+    + +Y+   +++I+   Q + A  P         FF +Y+S  L    +
Sbjct: 484 VDELSFKSPTGVWGSYWGLFMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMY 543

Query: 518 GSFQLWFKCRYVWKLV 533
              +++   +  WKL+
Sbjct: 544 IGHKIY---KRNWKLL 556

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  261 bits (666), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 159/519 (30%), Positives = 275/519 (52%), Gaps = 17/519 (3%)

Query: 21  KSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXX 80
           ++T S+   D++  + K     T  +  V +  ++   ++ ++LS RH            
Sbjct: 72  ETTRSVADSDME-VDGKRYKEMTDVERAVCDAARNS-SQLSKNLSIRHLLTLAVGGAIGT 129

Query: 81  XXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPA 140
                    L   GP   LIA+  + T ++++  SLGE+A+  PV   F ++  RF+ P+
Sbjct: 130 GLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPS 189

Query: 141 LGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYG 200
            G A    Y   WA+   LEL+     I++W   +   AW++IF+V + ++N+  V+ +G
Sbjct: 190 FGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFG 249

Query: 201 EIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARF 259
           E EF ++ +K+ AI GF I    ++CG G  G     +YW +PG +       +   A+F
Sbjct: 250 ETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAF-----VGDTPGAQF 304

Query: 260 LGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLV 319
            G  S  + AAF++ GTELVG++A E+ NPR T+P+A ++  + I   Y+L L   G LV
Sbjct: 305 KGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLV 364

Query: 320 PYDDVKLKSENSY--VSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLL 377
           P +D +L +  S   V++SP +IAIEN G + +P + N +IL+ IIS  NS+VY  SR +
Sbjct: 365 PSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCM 424

Query: 378 FGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGF 437
             +A+ G  PK+F    + G P+ A++ T +FG L+F+  S   +  F WL  + G++  
Sbjct: 425 VSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTL 484

Query: 438 FSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPK 497
           F W  I+ +HIRF + + ++  S ++LP+ +      ++Y   V++ ++    +T+  P 
Sbjct: 485 FCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPP 544

Query: 498 F----DVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
                   +FF  Y+S  +F I + S +L+   +  W+L
Sbjct: 545 GSSGPSAESFFEGYLSFPIFLICYISHKLY---KRDWRL 580

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  259 bits (662), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 168/479 (35%), Positives = 263/479 (54%), Gaps = 19/479 (3%)

Query: 60  VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEM 119
           +KR L  RH                     L  +GP G LI +   GT++Y +  ++GE+
Sbjct: 76  LKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 120 ATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW-TFAVPLP 178
           A   PV   +T ++ RF+  + G A   +Y   W +T  LE+      + +W T A    
Sbjct: 136 AVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRD 195

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF-R 237
           A++++F+V++   NLF V+ YGE EF  +F+KV A++GFII    +VCG G  G     R
Sbjct: 196 AFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGR 255

Query: 238 YWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAI 297
            W NPG +  G          F G  S  + AAF+F G+ELVG+ A E ANPR+++P A 
Sbjct: 256 LWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAA 305

Query: 298 RKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFIIAIENSGTKILPHIFNG 356
           ++V +RI +FYIL+L  +GLLVPY   +L  ++S   ++SPF+I+I+N+G K LP + N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 357 VILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFME 416
           VIL+ ++S GN  V+  SR +  LA  G+ PK+F    ++G P+  +V T +FG L+F+ 
Sbjct: 366 VILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIA 425

Query: 417 TSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAY 476
            S    E F WLL + G++  F+W  I   HIR  + L ++  +  +L F A    + + 
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSV 485

Query: 477 YATIVMIIIIFFQGFTAFAP---KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
           Y+ I++I+I+  Q + A  P   K     FF +Y+S  ++ +F+   ++W K    WKL
Sbjct: 486 YSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKN---WKL 541

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  260 bits (665), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 154/492 (31%), Positives = 262/492 (53%), Gaps = 12/492 (2%)

Query: 38  NTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVG 97
           +   TT   E+       E  ++K+ + KRH                     L  +GP G
Sbjct: 95  DEKQTTSDLESGLGEVPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGG 154

Query: 98  SLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMT 156
            +I Y  +G+ +Y + Q+ GE+A  +  + ++F I+    +  A G A  ++Y   W   
Sbjct: 155 LVIGYSIMGSCLYCIIQACGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCV 214

Query: 157 FALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILG 216
             LEL      I++WT +V    ++SIF+V++ + N F  R Y E EF+    KV  + G
Sbjct: 215 CPLELVTASMTIKYWTTSVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAG 274

Query: 217 FIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQG 275
           F I    I CG AG +G +G +YW +PG +     + N     F G  ++   AAF F  
Sbjct: 275 FFILGIIITCGGAGTSGYIGAKYWHSPGAF-----NGNRPIDHFKGVMATFTTAAFAFGA 329

Query: 276 TELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDD-VKLKSENSYVS 334
           +E + +TA E +NPR+ +PKA + +++RIL  ++ S+  IG LVPY+    L S +    
Sbjct: 330 SEFISLTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATK 389

Query: 335 SSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTT 394
           +SP+++A+ + G +++PH  N VIL++++S GNS  Y  SRLL  LA+ G  PK+F    
Sbjct: 390 ASPYVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYID 449

Query: 395 KSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCL 454
           K G P+ A+V ++LF  +AF   S   ++ F WLL + G++  F+W+ I  +H+RF + L
Sbjct: 450 KRGRPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRAL 509

Query: 455 QSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISV 510
           + +G S  ++ FK++   Y + YA  ++I+ +  Q + A AP      D  NFF +Y+++
Sbjct: 510 KVQGHSLGEIGFKSQVGIYGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAM 569

Query: 511 FLFFIFWGSFQL 522
            +  + +  +++
Sbjct: 570 PILLVLYFGYKI 581

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  258 bits (660), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 147/482 (30%), Positives = 253/482 (52%), Gaps = 19/482 (3%)

Query: 50  SENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVV 109
           ++ E     ++K+ +  RH                   + L  +GP G ++ Y+    ++
Sbjct: 55  ADAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAML 114

Query: 110 YSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQII 168
           Y + ++ GE+   +  +T ++T +S   + PA+G +  ++Y   W   F L+L     II
Sbjct: 115 YLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMII 174

Query: 169 QFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG- 227
           Q+WT   P   +++I + ++   NLF  + Y E EF+    KV  I+GF+I    I CG 
Sbjct: 175 QYWTDINP-DIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGG 233

Query: 228 AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAA 287
           AG +G +G +YW  P P+  G          F G       AAF + G E++ ++A E  
Sbjct: 234 AGTSGYIGDKYWHEPRPFMNG----------FKGLCFVFCYAAFAYGGIEVMVLSASEQE 283

Query: 288 NPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGT 347
           NPR+++  A +KV++RI++ Y+L+   +  LVP D   L SE S   +SP +IA+   G 
Sbjct: 284 NPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS--RASPLVIAVSFHGV 341

Query: 348 KILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTS 407
           KI+PHI N VIL+ ++S GNS++Y   RLL  LA+ G  PK+F    + G P+ A     
Sbjct: 342 KIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAM 401

Query: 408 LFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFK 467
           +FG LAF+  S   D+ F WLL + G++  F W+ I  +HIRF   ++++G S  ++ +K
Sbjct: 402 VFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYK 461

Query: 468 AKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLW 523
           A+   + ++ A +   +I+  Q + A +P      D  +FF SY++  +  + +  ++++
Sbjct: 462 ARTGYWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIY 521

Query: 524 FK 525
            K
Sbjct: 522 HK 523

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  258 bits (658), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 168/510 (32%), Positives = 250/510 (49%), Gaps = 26/510 (5%)

Query: 1   MSILDINTEET-LEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHE 59
           M++L++  E   +E  +K  IK   +     +  +ED +     P               
Sbjct: 1   MAVLNLKRETVDIEETAKKDIKPYFASNVEAVDIDEDPDVSRYDPQTG------------ 48

Query: 60  VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEM 119
           VKR L  RH                   N L   GP+  L+ +  +G + +SV +S+GEM
Sbjct: 49  VKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEM 108

Query: 120 ATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPA 179
            T  P    FT  + RF S AL A  GY Y   +    A E + +  I+QFW   VPL  
Sbjct: 109 ITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYG 168

Query: 180 WISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPV-GFRY 238
           +I IFW    I  L  V ++GE E+W+A+LK+  ++ + I+    + G  +  P  GF Y
Sbjct: 169 YILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFGFHY 228

Query: 239 WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIR 298
           W +PG    G          F G A   +  +  + GTE V + A E+ NP + VP A+R
Sbjct: 229 WNSPGALSHG----------FKGIAIVFVFCSTFYSGTESVALAATESKNPGKAVPLAVR 278

Query: 299 KVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVI 358
           + ++RILV YI    F G  VP+DD  L S ++ V  SP  IAI  +G     H+ N  I
Sbjct: 279 QTLWRILVVYIGIAVFYGATVPFDDPNL-SASTKVLKSPIAIAISRAGWAGGAHLVNAFI 337

Query: 359 LVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETS 418
           L+T ISA N ++YIGSR L  LA  G  PK+ A T + GVP+ A+   +  G ++ M  S
Sbjct: 338 LITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVS 397

Query: 419 TGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYA 478
            G   A+ +++N+ GV  F  W +IS+ H+R  +   ++G S  +LP++A F P+    +
Sbjct: 398 VGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEALFYPWTPVLS 457

Query: 479 TIVMIIIIFFQGFTAFAPKFDVLNFFASYI 508
               I +   QG++ F P FD  NF  +YI
Sbjct: 458 LAANIFLALIQGWSYFVP-FDAGNFVDAYI 486

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  259 bits (663), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 151/522 (28%), Positives = 269/522 (51%), Gaps = 19/522 (3%)

Query: 21  KSTESLEQ--HDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXX 78
           +  E  E+   DL+ NE  +T + + SK+   +   D+   +++ +  RH          
Sbjct: 79  RRAEDDEETAEDLE-NELVSTLSPSKSKQLHGQKNGDDDAHLQKSIRPRHVLMMSLGTGI 137

Query: 79  XXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFL 137
                    + L  +GP   +I Y  +G+ +Y + Q+ GEMA  +  +  +F  +    +
Sbjct: 138 GTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNFNAYPSFLV 197

Query: 138 SPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVR 197
              +     ++Y   W     LEL      I +WT  V    ++ IF+V++T+ N F  +
Sbjct: 198 DEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVFVVIFFVLITLINTFGAK 257

Query: 198 IYGEIEFWIAFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAE 256
            Y E EF+    KV  + GF I    I   GAG  G +G +YW NPG +       + + 
Sbjct: 258 GYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAF-----RGDKSI 312

Query: 257 ARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIG 316
            RF    S+   AAF F  +E + I A E +NPR+ +P A + +++RIL  ++ S+  +G
Sbjct: 313 DRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVG 372

Query: 317 LLVPYDDVKL--KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGS 374
            LVPYD  +L     ++   +SP++IA+ + G +++PH  N VIL++++S  NS  Y   
Sbjct: 373 FLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAYYSSC 432

Query: 375 RLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGV 434
           R+L+ LA+ G  PK F    + G P  A++ T++FG +AF   S   ++ F WLL++ G+
Sbjct: 433 RILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSIAGL 492

Query: 435 AGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF 494
           +  F+W  I  +HIRF + ++ +G S +++ FK++   + + YA I+MI+ +  + + + 
Sbjct: 493 SQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMMILALIAEFWVSI 552

Query: 495 AP----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
           AP      D  NFF +Y+++ +  + +  ++++ K    WKL
Sbjct: 553 APIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKK---DWKL 591

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  259 bits (661), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 152/496 (30%), Positives = 255/496 (51%), Gaps = 18/496 (3%)

Query: 36  DKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGP 95
           ++NT       E+++ + K     +K+ +  RH                     L   GP
Sbjct: 72  NENTSDLEDGIESITSDSK-----LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGP 126

Query: 96  VGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASFTIFSHRFLSPALGAANGYMYWFSWA 154
              +I Y+ +  V Y + Q+ GEMA   P + A+F  +S  F+S   G A  ++Y F W 
Sbjct: 127 AALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWL 186

Query: 155 MTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAI 214
               LEL      IQ+W   +    +I IF++ L   ++F V+ YGE EF     K+  I
Sbjct: 187 TVLPLELITASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMI 246

Query: 215 LGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTF 273
            GFII    I CG AG  G +G  YW NPG +     + + + ARF      L+   F+F
Sbjct: 247 AGFIILSVVINCGGAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSF 301

Query: 274 QGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLK-SENSY 332
            G EL  ++  E +NPR++ P A ++ ++RI++ Y+L++  IG  VPY+D +L  +  S 
Sbjct: 302 GGMELFALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSA 361

Query: 333 VSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAK 392
             +SP+++A    G KI+PHI N VIL++++S  NS++Y G RL+  L++ G  PK    
Sbjct: 362 THASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDY 421

Query: 393 TTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQ 452
             + G P+ A++   +FG +AF+  S+  +  F WL  + G++  F+W  I  +H+RF Q
Sbjct: 422 VDREGRPLRALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQ 481

Query: 453 CLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVLNFFASY 507
            ++ +G S ++L +KA    + + Y     I++   Q + A AP     +  V +FF SY
Sbjct: 482 AMKVQGRSLDELGYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESY 541

Query: 508 ISVFLFFIFWGSFQLW 523
           ++  ++  F+  + ++
Sbjct: 542 LAAPIWLTFFFGYMIY 557

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  257 bits (656), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 154/511 (30%), Positives = 265/511 (51%), Gaps = 9/511 (1%)

Query: 20  IKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXX 79
           +K TE+++  +    +          +E V  N++     +K+ L +RH           
Sbjct: 13  LKKTEAVQVCETYEADSVEPQNANEPEEGVLYNDRTR---LKQGLKERHIKMLTLVGVFG 69

Query: 80  XXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSP 139
                     L  +GP G  +AY+ +G VV     ++ E+A+F+P T +    + +F+  
Sbjct: 70  TGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDE 129

Query: 140 ALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIY 199
           ++G   G++  +S  M    ELS    ++++WT   P   WI+IF ++  ++N++ +R Y
Sbjct: 130 SVGFTFGWISTYSSLMPG--ELSATAVVMRYWTDINP-AVWITIFGILFVLTNIYTIRFY 186

Query: 200 GEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARF 259
           GE+E++  ++K+  I+  I+    I  G  K   +GF YWR PGP+   I+   I   +F
Sbjct: 187 GEVEYFFGWMKIILIIILIVTGLVIDLGGAKQERLGFHYWREPGPFAEYIVKGEIG--KF 244

Query: 260 LGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLV 319
           +G+ ++L +  +++ G + + I AGE  N R  +    R V  RI+V Y++++  + L+V
Sbjct: 245 VGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGARNVFLRIIVLYLIAVLVLTLIV 304

Query: 320 PYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFG 379
           PY+D  + +      SSP++IAI+ +  KILPHI N +IL +  SAGN  +  GSR LF 
Sbjct: 305 PYNDKLIATGTGTAKSSPYVIAIQRANIKILPHIINAIILTSAWSAGNLAIVEGSRNLFA 364

Query: 380 LAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFS 439
           LA     PK+F  T K G+P   + F S F  L++M  S+     F W   +V       
Sbjct: 365 LASKNQAPKIFLTTNKRGIPYVGIAFISAFLPLSYMSVSSSSANVFSWFQELVSSNTLLR 424

Query: 440 WLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF-APKF 498
           W+LIS  HI   + L+++G SR+DLP      P+ A+++ I+ +I +   GF  F    F
Sbjct: 425 WILISANHIHMDRALKAQGYSRSDLPHSTCLGPFAAWFSGIMSLIFLLTGGFYNFIHGHF 484

Query: 499 DVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529
           D+ +FF  Y  + L  I +  ++L+ K +Y+
Sbjct: 485 DIESFFTRYFIIPLAIILFTFWKLFKKTKYL 515

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  258 bits (660), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 159/521 (30%), Positives = 271/521 (52%), Gaps = 17/521 (3%)

Query: 16  SKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXX 75
           S++ I++    EQ     +++    + T S +   + + +E  ++K+ L  RH       
Sbjct: 26  SEVDIEANTITEQLTKDKHKETIDYSETSSLDEEKQQQPEENGKLKQGLKSRHVQLIALG 85

Query: 76  XXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFS-- 133
                         L   GP G   +YL + T +Y +  + GEM  ++P   S +  S  
Sbjct: 86  GTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMNAFGEMVCYLPGNGSDSAGSSA 145

Query: 134 ---HRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP--AWISIFWVIL 188
               +++  +LG A+ + Y++ + +  A E +    ++++W +A+ +P  AWI+IF   +
Sbjct: 146 YLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVEYWAWALKVPKGAWITIFLFCV 205

Query: 189 TISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGT 247
              N+ PV  YGE EFW A +K+  ILG II  F +  G G +   +GFRYW+ PG +  
Sbjct: 206 VALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWGGGPSHDRLGFRYWQRPGAFAD 265

Query: 248 GIISSNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRILV 306
            I  ++     FL   + +I   F F  G ELV +T+ E  + R+ + KA R+ V+R+++
Sbjct: 266 HI--TDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRLMI 323

Query: 307 FYILSLFFIGLLVPYDDVKLKS----ENSYVSSSPFIIAIENSGTKILPHIFNGVILVTI 362
           FY+L    I ++V Y+D  L++          SSPF+I I+N+G K+LPHI N  I+ + 
Sbjct: 324 FYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMTSA 383

Query: 363 ISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGD 422
            SAGN+ ++  SR L  +A +G  PK F+K  + GVP  AV F+ LF  LA++  S+   
Sbjct: 384 WSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYVAVGFSFLFCCLAYLNVSSSTA 443

Query: 423 EAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVM 482
             F W  N+  ++GF  W+    A+IRF + +    +  + LP+K     YL +Y+  ++
Sbjct: 444 NVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-YDRLPYKGFAQKYLIWYSLFMV 502

Query: 483 IIIIFFQGFTAFAPKF-DVLNFFASYISVFLFFIFWGSFQL 522
            +I    G+  F P+F D  +F A+YI++ +F + W   +L
Sbjct: 503 SLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGHKL 543

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  258 bits (659), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 156/535 (29%), Positives = 264/535 (49%), Gaps = 35/535 (6%)

Query: 19  VIKSTESLEQHDLQGNEDKNTPTTTPSKENVS---------------ENEKDEYHEV--- 60
           ++   +S+   D+  NE  N+       E  +               E+EK +  E+   
Sbjct: 1   MVNDKDSIRTKDINFNETSNSTAVDLGGEGRASGVFHRFIDSFKPPVEDEKSDLEEMSME 60

Query: 61  ------KRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQ 114
                 K+ +  RH                     L   GP   +I Y+ +  V Y + Q
Sbjct: 61  STDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQ 120

Query: 115 SLGEMATFIP-VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTF 173
           + GEMA   P +  SF  ++  F+S  +G A  +++   W     LEL      IQ+W  
Sbjct: 121 AAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYWND 180

Query: 174 AVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI-VCGAGKTG 232
           ++    WI IF+V L   ++F V+ YGE+EF     K+  I GFII+   +   GAG  G
Sbjct: 181 SINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDG 240

Query: 233 PVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQT 292
            +G +YW+NPG +     +S+ +  RF      L+ A F++ GTEL  ++  E ANPR++
Sbjct: 241 YIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRS 295

Query: 293 VPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLK-SENSYVSSSPFIIAIENSGTKILP 351
            PKA ++ ++RIL+ Y+L++  IG  VP+D+ +L  +  S   +SP+++A    G K++P
Sbjct: 296 TPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPYVLAASIHGVKVVP 355

Query: 352 HIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGA 411
           HI N VIL+ + S GNS++Y   RL   LA+ G  PK  A   + G P+ A+   ++ G 
Sbjct: 356 HIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGV 415

Query: 412 LAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFM 471
           +AF   S+  ++ F WL  +  ++  F+W  I  +HIRF   ++ +G   N+L +KA   
Sbjct: 416 IAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTG 475

Query: 472 PYLAYYATIVMIIIIFFQGFTAFAPKFDVLN---FFASYISVFLFFIFWGSFQLW 523
            + + +     +++   Q + A +P    ++   FF SY++  L+  F+ ++ LW
Sbjct: 476 VWGSMWGFGFCVLVFIAQFWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYMLW 530

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  258 bits (659), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 164/495 (33%), Positives = 262/495 (52%), Gaps = 23/495 (4%)

Query: 48  NVSENEK----DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYL 103
           N+++ EK         +KR L  RH                     L  +GP G LI + 
Sbjct: 60  NLTDAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWA 119

Query: 104 FLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSV 163
             GT++Y +  ++GE+A   P+   FT ++ RF+  + G A   +Y   W +   LE+  
Sbjct: 120 LTGTMIYCMVMAMGELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVA 179

Query: 164 VGQIIQFW-TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCF 222
               + +W T       ++++F+V++   N F V+ YGE EF  +F+KV  ++G+II   
Sbjct: 180 ASITVNYWGTPDKYRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGV 239

Query: 223 CIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281
            +VCG G  G     R W NPG +  G          F G  S  + AAF+F G+ELVG+
Sbjct: 240 ILVCGGGPQGGYIGGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGL 289

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY-VSSSPFII 340
            A E ANPR+++P A ++V +RI +FYIL+L  +GLLVPY   +L  ++S   ++SPF+I
Sbjct: 290 AAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVI 349

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           +I+N+G K LP + N VIL+ ++S GNS V+  SR +  LA  G+ PK+F    ++G P+
Sbjct: 350 SIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPL 409

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
             ++ T +FG L+F+  S    E F WLL + G++  F+W  I   HIR  + L ++  +
Sbjct: 410 VGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRT 469

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFASYISVFLFFIFW 517
             +L F A    + + Y  +++I+I+  Q + A  P   K     FF +Y+S  +   F+
Sbjct: 470 TAELSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFY 529

Query: 518 GSFQLWFKCRYVWKL 532
              ++W K    WKL
Sbjct: 530 IGHKIWKKN---WKL 541

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  257 bits (657), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 157/506 (31%), Positives = 266/506 (52%), Gaps = 18/506 (3%)

Query: 17  KIVIKSTESLEQHDL-QGNEDKNTPTTTPSKENVS----ENEKDEYHE-VKRDLSKRHXX 70
           K V+   +    HDL Q ++D     +T S  +       N   EY E + +DL  RH  
Sbjct: 29  KAVVDIPDPGSSHDLGQSSKDSGYKISTGSAIDSDSLHGNNVAFEYGENLNKDLDIRHLL 88

Query: 71  XXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFT 130
                              L   GP   +I ++ + + +++V  +LGE+A   P+   F 
Sbjct: 89  TLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGELAATFPIVGGFN 148

Query: 131 IFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTI 190
           ++  RF+ P+   A    Y   W ++  LEL      I++W   +   AW++IF+V + +
Sbjct: 149 VYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREINSDAWVTIFFVFIAL 208

Query: 191 SNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRYWRNPGPWGTGI 249
            N+  V+ + E EF ++ +K+ AI+GF I    + V G    G +G +YW +PG +    
Sbjct: 209 LNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGAF---- 264

Query: 250 ISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYI 309
              + A +RF G  S  + AAF++ G E+  ++A E+ NPR+T+PKA ++  + I   YI
Sbjct: 265 -HGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVITFSYI 323

Query: 310 LSLFFIGLLVPYDDVKLKSENSYV--SSSPFIIAIENSGTKILPHIFNGVILVTIISAGN 367
             L  IG+LVPY+D +L S +S V  S+SP +IAIEN+G K LP + N +IL+ ++S  N
Sbjct: 324 SILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNAIILIALLSVAN 383

Query: 368 SNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQW 427
           S VY+ SR++  +A   T PK+F+K  K G P++++  T   G L+F+  S   +E F W
Sbjct: 384 SCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQEEVFTW 443

Query: 428 LLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIF 487
           L  + G++  F W+ I+ AHIRF   L+ +  S ++L + ++   + ++Y  I++++++ 
Sbjct: 444 LSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVIILVLVLI 503

Query: 488 FQGFTAFAP----KFDVLNFFASYIS 509
              + +  P      D   FF  Y+S
Sbjct: 504 ASFWVSLFPVGESSADAEAFFEGYLS 529

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  257 bits (656), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 165/498 (33%), Positives = 262/498 (52%), Gaps = 21/498 (4%)

Query: 39  TPTTTPSKENVSENEKDEYHE-VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVG 97
           TP  + S       + D+  E + R LS RH                     L + GP  
Sbjct: 35  TPLDSISDAVTDLEDHDKIRESLNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGS 94

Query: 98  SLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTF 157
             I Y  +G VVY     LGEM+TF+P++ SF  ++ +F   +   A    YWF+ A++ 
Sbjct: 95  LFINYTIMGGVVYLTMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSV 154

Query: 158 ALELSVVGQIIQFWTFAVP-LPAWIS--IFWVILTISNLFPVRIYGEIEFWIAFLKVNAI 214
           A +L+ +  ++ +W  +    P W +  +FWV L   N+  VR+YGE E+W+A LKV AI
Sbjct: 155 ASDLTALQLVLDYWKSSQHNFPYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAI 214

Query: 215 LGFIIYCFCIVCGAGKTGP-VGFRYWR-NPGPWGTGIISSNIAEARFLGWASSLINAAFT 272
           + F I    +  G       +GF+YW     P+  G          F G+ +  +++AF+
Sbjct: 215 VIFFILAIVVNVGHNPDHEYIGFKYWSYKEAPFVNG----------FKGFVTIFVSSAFS 264

Query: 273 FQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSY 332
           + GTE + +TAGEA NP +  P+ ++ V +RIL+FY+ ++FFI + +PYD   L +++  
Sbjct: 265 YGGTESITLTAGEARNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNLSTKS-- 322

Query: 333 VSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNG-TGPKLFA 391
           V +SPF I  + +GTK      N VIL +I+SAGN  ++ GSR+L+ +   G   PKL  
Sbjct: 323 VMTSPFTIIFQMAGTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLIT 382

Query: 392 KTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFM 451
           KT +   P  AV+ T   G L F  +  G    + WL N+VGV+   +WL I+   IRF 
Sbjct: 383 KTNRYRAPYVAVILTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFR 442

Query: 452 QCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVF 511
           + L  +G ++ +L FK    PY  Y+  I + +II  QG++AF P +   +FF+ Y+ +F
Sbjct: 443 KGLAQQGKTQ-ELQFKNWTYPYGPYFLVIFVTLIILVQGWSAFDP-WSTSDFFSYYLELF 500

Query: 512 LFFIFWGSFQLWFKCRYV 529
           +F   W  + ++ + R+V
Sbjct: 501 VFPTCWLIWWIFKRDRFV 518

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  257 bits (657), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 147/497 (29%), Positives = 256/497 (51%), Gaps = 24/497 (4%)

Query: 34  NEDKNTPTTTPSKENVSENEK-DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMI 92
           N  +    +   KE   ENE+     ++K+ +  RH                     L  
Sbjct: 43  NSFRRKGESEDVKELKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAK 102

Query: 93  SGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWF 151
           +GP G +I Y     ++Y + Q+ GE+   +  +  ++T +S   + PALG +  ++Y  
Sbjct: 103 AGPAGLVIGYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCV 162

Query: 152 SWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKV 211
            W     L+L      +++WT A P   ++++F+V++ + N+F  + Y E EF     KV
Sbjct: 163 QWMTVLPLQLVTAAMTVRYWTNANP-DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKV 221

Query: 212 NAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAA 270
             I GF+I    I CG AG +G +G +YW +PG +  G          F G       AA
Sbjct: 222 LMIAGFVILGIAINCGGAGTSGYIGAKYWHSPGSFAAG----------FKGVCYVFCYAA 271

Query: 271 FTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL--KS 328
           F++ G E++ +TA E  NPR+++P A +KV++RIL+ Y+L+   +  LVPY+  +L   S
Sbjct: 272 FSYGGIEVMVLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSS 331

Query: 329 ENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPK 388
             S   +SP +IA+ + G KI+PHI N VIL+++IS GNS++Y   RLL  L++ G  PK
Sbjct: 332 GESASHASPLVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPK 391

Query: 389 LFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHI 448
                 + G P+     T L   +AF+  S   ++ F WLL + G++  F W  I  +H+
Sbjct: 392 FLNYVDRQGRPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHV 451

Query: 449 RFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVLNF 503
           RF   + ++G+S   + +K++   + +++A ++ ++++  Q + A AP     + +   F
Sbjct: 452 RFRDAMHAQGLSLGQIGYKSQTGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETF 511

Query: 504 FASYISVFLFFIFWGSF 520
           F +Y++   F I  G++
Sbjct: 512 FQNYLA---FPILLGAY 525

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  257 bits (657), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 156/488 (31%), Positives = 250/488 (51%), Gaps = 15/488 (3%)

Query: 37  KNTPTTTPSKENVSENEKDEYH--EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISG 94
           K       +  ++ + E    H  ++K+++  RH                   + L   G
Sbjct: 46  KRVEGEVRNSSDLEDGEVTSAHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGG 105

Query: 95  PVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASFTIFSHRFLSPALGAANGYMYWFSW 153
           P G LI Y F+  + Y + Q+ GEMA   P +  +F  +S  F+S   G A  +++   W
Sbjct: 106 PGGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQW 165

Query: 154 AMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNA 213
                LEL     ++++WT  +    ++ IF++ +   +    R YGE EF     KV  
Sbjct: 166 TTILPLELITSSIVVKYWTTKINADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLM 225

Query: 214 ILGFIIYCFCIVCGA-GKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFT 272
           + GFII    I CGA G  G +G +YW  PG +  G   S I   RF G A  L+ A F+
Sbjct: 226 VAGFIIVGILINCGAVGDDGYIGGKYWHEPGAFAAG---SGID--RFKGIAYVLVTAYFS 280

Query: 273 FQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENS 331
           + G EL  ++  E  NPR+ +P A  K V+RIL+ Y+L++  IG LVP+D  KL  S +S
Sbjct: 281 YGGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSS 340

Query: 332 YVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFA 391
            V  SP+++A+   G KI+PHI N VIL+++IS GNS +Y G RLL  LA+ G  PK+  
Sbjct: 341 GVHPSPYVLALSLHGIKIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILD 400

Query: 392 KTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFM 451
              + G P+ A++  S+FG +AF+  S   ++ F WL  + G++  F+W  I  +H RF 
Sbjct: 401 YVDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFR 460

Query: 452 QCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVLNFFAS 506
           + ++ +G S   L +++    + + YA +  + ++  Q + A  P     KF V + F S
Sbjct: 461 RAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKS 520

Query: 507 YISVFLFF 514
            +++ L+ 
Sbjct: 521 CLALPLWL 528

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  256 bits (654), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 153/474 (32%), Positives = 242/474 (51%), Gaps = 24/474 (5%)

Query: 34  NEDKNTPTTTPSKENV----------SENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXX 83
            +D+  P     K N+           EN   +   +KR L  RH               
Sbjct: 41  EDDQVQPNKKAYKRNLFHRCIDSFKPPENGSFDPDSLKRSLKSRHLIMIAIGGSIGTGLF 100

Query: 84  XXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGA 143
                 L I GP+  +I +L  GT +      LGE+    PV  +F  +  RFL P+L  
Sbjct: 101 VGSGKALAIGGPLAVIIGWLIAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLDPSLSF 160

Query: 144 ANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIE 203
               +Y   W     LE+      IQFW  ++    W++IF+V +   NLF VR +GE E
Sbjct: 161 VVSSIYVLQWFFVLPLEIIASAMTIQFWNTSIDPVVWVAIFYVTIVAINLFGVRGFGEAE 220

Query: 204 FWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTGIISSNIAEARFLGW 262
           F  + +KV  I GFII C  ++ G G T   VG RYW +PG    G          F G 
Sbjct: 221 FLFSSIKVITISGFIILCIVLIVGGGPTHEYVGARYWHDPGALAHG----------FKGV 270

Query: 263 ASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD 322
           AS  + A+++  G+E+  + +GE  +P++ +P AI++V +RI+ F+++SL  +G LVPY 
Sbjct: 271 ASVFVTASYSLGGSEMACLASGET-DPKE-LPSAIKQVFWRIIFFFLVSLTLVGFLVPYT 328

Query: 323 DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAK 382
           +  L   +S V++SPF+IA      K+LP I N VILV+I+S GNS ++  SR L  +A 
Sbjct: 329 NQNLLGGSS-VNNSPFVIACNLYHIKVLPSIINAVILVSIMSVGNSCIFASSRTLCSMAH 387

Query: 383 NGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLL 442
            G  P++F    ++G P+  ++  SLFG LAF+  S+   E F WL+ + G+A    WL 
Sbjct: 388 QGLIPQIFGYVDRAGRPLVGIITNSLFGLLAFLVKSSSMSEVFNWLMAIAGLATCVVWLS 447

Query: 443 ISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP 496
           I+ +HIRF   ++++  + ++L F +    + + Y+ +V ++I+  Q + +  P
Sbjct: 448 INVSHIRFRMAMKAQDKTLDELEFVSAVGIWGSVYSAVVNVLILIAQFYISLWP 501

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  257 bits (657), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 154/496 (31%), Positives = 256/496 (51%), Gaps = 22/496 (4%)

Query: 47  ENVSENE-KDEY--------HEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVG 97
           E+V E E ++EY         ++K ++  RH                     L   GP G
Sbjct: 49  EDVHEKEGQEEYATGLNKTQQKLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPGG 108

Query: 98  SLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMT 156
            LI YL   T++Y V Q+  E+   +  +  ++  +    +    G A   +Y   WA+ 
Sbjct: 109 LLIGYLTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIV 168

Query: 157 FALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILG 216
             LEL      I++WT +V    +++IF++ +   + F  R Y E EF    LKV  + G
Sbjct: 169 LPLELVTASMTIKYWTESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMAG 228

Query: 217 FIIYCFCIVCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGT 276
           FII    + CGA K G +G +YW NPG +  G  S N       G  S  + +AF + G+
Sbjct: 229 FIIMGISLNCGASKLGYIGAKYWSNPGTFA-GERSIN----HLKGICSVWVQSAFAYGGS 283

Query: 277 ELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPY--DDVKLKSENSYVS 334
           E + +TA E ANPR++VP A ++ ++R++V +++ +  I  LVPY  D +   S  S   
Sbjct: 284 EFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASASH 343

Query: 335 SSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTT 394
           +SPF+IA    G KI+PHI N +IL ++IS GNS +Y   R+L  LA+NG  PK+F    
Sbjct: 344 ASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTYVD 403

Query: 395 KSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCL 454
           ++G P+  ++F  +FG L+F+  S   +  F WL  + G++  F+W  I+ +HIRF   +
Sbjct: 404 RAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRAAM 463

Query: 455 QSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVLNFFASYIS 509
           + +G S  +L + +      +YYA    I+++  Q + A AP     + D  +FF +Y++
Sbjct: 464 KVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAPIDKHGELDAESFFKNYLA 523

Query: 510 VFLFFIFWGSFQLWFK 525
             +  +F+  +++W++
Sbjct: 524 FAVLVLFYVGYKIWYR 539

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  257 bits (656), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 152/510 (29%), Positives = 262/510 (51%), Gaps = 15/510 (2%)

Query: 26  LEQHDLQG-NEDKNTPTTTPSKENVSENEKDEYHE--VKRDLSKRHXXXXXXXXXXXXXX 82
           L   D  G N+  N  T++       + E+++ +   + +DLS RH              
Sbjct: 49  LSSKDSPGINQTTNDITSSDRFRRNEDTEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGL 108

Query: 83  XXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALG 142
                  L   GP   +I ++ + T +++V  SLGE++   PV   F ++S RF+ P+  
Sbjct: 109 YVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFIEPSFA 168

Query: 143 AANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEI 202
            A    Y   W +   LEL      I++W   +   AW++IF+  + ++N+  V+ +GE 
Sbjct: 169 FAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGET 228

Query: 203 EFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLG 261
           EF ++ +K+ +I+GF I    + CG G  G     +YW +PG +       + +  +F G
Sbjct: 229 EFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAF-----VGHSSGTQFKG 283

Query: 262 WASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPY 321
             S  + AAF++ G E+  ++A E+ NPR+T+PKA ++  + I   Y+  L  IG LVP 
Sbjct: 284 LCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPS 343

Query: 322 DDVKLKSENSYV--SSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFG 379
           +D +L + +S V  +SSP +IAIEN G K LP + N +IL+ ++S  NS VY  SR +  
Sbjct: 344 NDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVA 403

Query: 380 LAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFS 439
           +A  G  PK   +  K G P+ A++ T  FG L+F+  S    E F WL  + G++  F 
Sbjct: 404 MAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFC 463

Query: 440 WLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP--- 496
           W+ I+ +HIRF Q ++ +  S ++LPF ++     ++Y  IV+ +++    +T+  P   
Sbjct: 464 WMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGG 523

Query: 497 -KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
                 +FF  Y+S  +  + +   +L+ +
Sbjct: 524 SGASAESFFEGYLSFPILIVCYVGHKLYTR 553

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  257 bits (656), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 157/505 (31%), Positives = 264/505 (52%), Gaps = 16/505 (3%)

Query: 28  QHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXX 87
           +H +  ++  N  TT   +  ++  E +    +K+ +  RH                   
Sbjct: 82  EHMIPADDKINEMTTAEPEAEMASVEDN----LKQTIKPRHVIMISLGTGIGTGLLVGNG 137

Query: 88  NPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT-FIPVTASFTIFSHRFLSPALGAANG 146
           + L+ +GP G +  Y  +GT VY + QS GEMA  +  +   F  +    + P       
Sbjct: 138 SALVKAGPAGLVTGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCCR 197

Query: 147 YMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWI 206
               F+     +  +       ++WT  V    ++ IF+V++ + N+F  R Y E EF+ 
Sbjct: 198 LGVLFTMVDCLSFGIGYCFDDYKYWTTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFF 257

Query: 207 AFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASS 265
              KV  + GF I    I V GAG  G +G  YWRNPG +       +     F G  ++
Sbjct: 258 NCCKVLMMAGFFILGIIINVGGAGNDGYLGNIYWRNPGAF-----RGDKGIDHFKGVVAT 312

Query: 266 LINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVK 325
           L+ AAF F GTE + +TA E +NPR+ +P A +KV++RI++ Y+ S+  IG LVP+   +
Sbjct: 313 LVTAAFAFGGTEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPE 372

Query: 326 L-KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNG 384
           L  S ++  ++SP++IA+ + G +++PH  N VIL++++S GNS  Y  SRLL  L+K G
Sbjct: 373 LLGSGSAATAASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQG 432

Query: 385 TGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLIS 444
             PK F    + G P  A++ ++LFG +AF  TS    E F WLL + G++  F+W+ I 
Sbjct: 433 YAPKWFDYVDREGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISIC 492

Query: 445 FAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDV 500
            +HIRF   ++++G S  ++ FKA+   + +YY+  +MI+ +  Q + A AP    +   
Sbjct: 493 LSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVAIAPIGTAELSA 552

Query: 501 LNFFASYISVFLFFIFWGSFQLWFK 525
            NFF +Y+++ +   F+  +++W K
Sbjct: 553 RNFFENYLAMPILIGFYFGYKIWKK 577

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  256 bits (654), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 152/499 (30%), Positives = 255/499 (51%), Gaps = 16/499 (3%)

Query: 35  EDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISG 94
           EDK+  +     E+ S++   +   +K+ +  RH                     L ++G
Sbjct: 56  EDKHADSDL---EDGSKSITSDDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAG 112

Query: 95  PVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASFTIFSHRFLSPALGAANGYMYWFSW 153
           P   ++ Y  +  V Y + Q+ GEMA   P + ASF  ++  F+S   G A  +++   W
Sbjct: 113 PAPLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQW 172

Query: 154 AMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNA 213
                LEL      I++W   +    +I IF+V L   + F V+ YGE EF     K+  
Sbjct: 173 LTVLPLELITASMTIKYWNDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILM 232

Query: 214 ILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFT 272
           I GFII    I CG AG+ G +G +YW NPG +     +S    ARF G A  L+   F+
Sbjct: 233 IAGFIILSIVINCGGAGRDGYIGNKYWINPGAF-----ASESPAARFKGVAYILVTGYFS 287

Query: 273 FQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD-DVKLKSENS 331
           + GTEL  ++  E  NPR++ P A ++ ++RIL+ Y+L++  IG  VP+D D  + +  S
Sbjct: 288 YGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGS 347

Query: 332 YVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFA 391
              +SP+++A    G K++PH  N VIL++++S  NS +Y   RL+  LA+ G  PK F 
Sbjct: 348 ATHASPYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFN 407

Query: 392 KTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFM 451
              + G P+ A+    LFG + F+  S   ++AF WL  + G++  F+W  I  +HIRF 
Sbjct: 408 YVDREGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFR 467

Query: 452 QCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVLNFFAS 506
             ++ +G S  +L ++A    + + Y+    +++   Q + A +P     K+D   FF S
Sbjct: 468 MAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFES 527

Query: 507 YISVFLFFIFWGSFQLWFK 525
           Y++  L+ +F+  + ++ +
Sbjct: 528 YLAAPLWLVFYFGYMIYSR 546

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  256 bits (653), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 151/440 (34%), Positives = 232/440 (52%), Gaps = 14/440 (3%)

Query: 58  HEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLG 117
           H +KR L  RH                     L   GP+  +I +   GT +      LG
Sbjct: 83  HNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHGLG 142

Query: 118 EMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPL 177
           E+    PV  +F  +S RFL P++      +Y   W     LE+      IQ+W  ++  
Sbjct: 143 EITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWNQSIDP 202

Query: 178 PAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGF 236
             W++IF+ ++   NLF  R +GE EF  + +KV  I+GFII C  ++CG G     VG 
Sbjct: 203 VVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVGA 262

Query: 237 RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKA 296
           RYW +PG    G          F G  S L+ A+++  GTE+V + +GE  NPR+ +P A
Sbjct: 263 RYWHDPGCLSHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-NPRE-LPSA 310

Query: 297 IRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNG 356
           I++  +RIL F+++SL  IG LVPY +  L   +S V++SPF+IAI+    K LP I N 
Sbjct: 311 IKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS-VNNSPFVIAIKLHHIKALPSIVNA 369

Query: 357 VILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFME 416
           VIL++I+S GNS ++  SR L  +A  G  PK F    ++G P+  ++  SLFG LAF+ 
Sbjct: 370 VILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLV 429

Query: 417 TSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAY 476
            S+   E F WL+ + G+A    WL I+ +HIRF   ++++G S ++L F +    + + 
Sbjct: 430 KSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGMWGSA 489

Query: 477 YATIVMIIIIFFQGFTAFAP 496
           Y+ ++  +I+  Q + A  P
Sbjct: 490 YSALINSLILIAQFYCALWP 509

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  255 bits (652), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 151/484 (31%), Positives = 252/484 (52%), Gaps = 14/484 (2%)

Query: 51  ENEKDEYH--EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTV 108
           ++ K++ H   + +DL+ RH                     L   GP   +I +  + T 
Sbjct: 75  DDIKEDIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTA 134

Query: 109 VYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQII 168
           +++V  SLGE+A   PV   F ++  RF+ P+   +    Y   W +   LEL      I
Sbjct: 135 LFTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTI 194

Query: 169 QFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGA 228
           ++W   +   AW++IF+ ++ I+NL  V+ +GE EF ++ +K+ AI+GF I    + CG 
Sbjct: 195 RYWDDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGG 254

Query: 229 GKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAA 287
           G  G     +YW +PG +       + A  +F G  S  + AAF++ G E++ ++A E+ 
Sbjct: 255 GPKGGYIGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQ 309

Query: 288 NPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYV--SSSPFIIAIENS 345
           NPR+T+P A ++  + I   YI  L  +G LV Y+D +L + +S V  ++SP +IAIEN 
Sbjct: 310 NPRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENG 369

Query: 346 GTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVF 405
           G K LP + N +IL+ I+S  NS VY  SR +  +A  G  PK  +   K G P+ A+  
Sbjct: 370 GIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFT 429

Query: 406 TSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLP 465
           T  FG L+F+  S   +E F WL  + G++  F W+ I+ AHIRF Q +  +  S +++P
Sbjct: 430 TLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMP 489

Query: 466 FKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQ 521
           + ++   Y +YY T ++ +++    +T+  P      D   FF  Y+S  +    +   +
Sbjct: 490 YLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHK 549

Query: 522 LWFK 525
           L+FK
Sbjct: 550 LYFK 553

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  255 bits (652), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 150/485 (30%), Positives = 250/485 (51%), Gaps = 17/485 (3%)

Query: 37  KNTPTTTPSKENVSENEKDEYHEVK-----RDLSKRHXXXXXXXXXXXXXXXXXXXNPLM 91
           K T     S E   +N+  E  ++      +DLS RH                     L 
Sbjct: 58  KQTTNDITSSERSRDNDDVEQVDINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALS 117

Query: 92  ISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWF 151
             GP   +I ++ +GT +++V  SLGE++   PV   F ++  RF+ P+   A    Y  
Sbjct: 118 TGGPASLVIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLA 177

Query: 152 SWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKV 211
            W +   LEL      I++W   +   AW++IF+  + ++N+  V+ +GE EF ++ +K+
Sbjct: 178 QWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKI 237

Query: 212 NAILGFIIYCFCIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAA 270
            +I+GF I    + CG G  G     +YWRNPG +    +  N +  +F G  S  + AA
Sbjct: 238 LSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAF----VGHN-SGTKFKGLCSVFVTAA 292

Query: 271 FTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSEN 330
           F++ G E+  ++A E+ NPR+T+PKA ++  + I   Y+  L  IG LVP +D +L + +
Sbjct: 293 FSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGS 352

Query: 331 SYV--SSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPK 388
           S V  +SSP +IAIEN   K LP + N +IL+ ++S  NS VY  SR +  +A  G  PK
Sbjct: 353 SSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPK 412

Query: 389 LFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHI 448
              +  K G P+ A++ T  FG L+F+  S    E F WL  + G++  F W+ I+ +HI
Sbjct: 413 FLNRVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHI 472

Query: 449 RFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFF 504
           RF + ++ +  S ++LPF ++     ++Y  +V+ +++    +T+  P         +FF
Sbjct: 473 RFRKAMKVQERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFF 532

Query: 505 ASYIS 509
             Y+S
Sbjct: 533 EGYLS 537

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  254 bits (650), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 165/525 (31%), Positives = 267/525 (50%), Gaps = 25/525 (4%)

Query: 12  LEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYH--EVKRDLSKRHX 69
           LE K    I S E+  + DL   EDKN        ++        YH   +KR L  RH 
Sbjct: 22  LEMKFSDGIMSKET--EIDLDKKEDKNKNIVRRMIDSFKPPLDGSYHSDNLKRKLKSRHL 79

Query: 70  XXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASF 129
                               L   GP+  +I +   G+ +      LGE+    PV  +F
Sbjct: 80  IMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLGEITMRFPVVGAF 139

Query: 130 TIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILT 189
             +S R L P++      +Y   W     +EL      +QFWT  V    W++IF+VI+ 
Sbjct: 140 ANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVV 199

Query: 190 ISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTG 248
             NLF V+++GE EF  + +KV  I+GFII    ++CG G     +G  YW +PG    G
Sbjct: 200 SVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGTEYWHHPGALANG 259

Query: 249 IISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFY 308
                     F G AS  + A+++  G+E+V + + E  +P++ +P AI++V +RI+ F+
Sbjct: 260 ----------FKGVASVFVTASYSLGGSEMVCLCSAET-DPKE-LPHAIKQVFWRIVFFF 307

Query: 309 ILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNS 368
           ++SL  +G LVPY +  L   +S V++SPF+IAI+ SG ++LP I N VIL++I+S GNS
Sbjct: 308 LVSLTLVGFLVPYTNENLLGGSS-VNNSPFVIAIKLSGIRVLPSIINAVILISILSVGNS 366

Query: 369 NVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWL 428
            ++  SR L  +A  G  P++F    ++G P+  ++  SLFG LAF+  S      F WL
Sbjct: 367 CIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWL 426

Query: 429 LNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFF 488
           + + G+A    WL I+ +HIRF   ++++  S ++L FK+    Y + Y+  V I+I+  
Sbjct: 427 MAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYGSIYSATVNILILIA 486

Query: 489 QGFTAFAP-------KFDVLNFFASYISVFLFFIFWGSFQLWFKC 526
           Q + +  P       +    +FF +Y+   +    + + +++FKC
Sbjct: 487 QFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKC 531

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  254 bits (650), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/523 (29%), Positives = 265/523 (50%), Gaps = 20/523 (3%)

Query: 9   EETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRH 68
           E + E ++ +V +  +S  + + Q  E+ N        E+ +++ K   H +K+ +  RH
Sbjct: 42  EHSEESRNGLVHRFVDSFRRAESQRLEEDN------DLEDGTKSMKSNNH-LKKSMKSRH 94

Query: 69  XXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTA 127
                                L ++GP   +I Y+ +  V Y + Q+ GEM    P +  
Sbjct: 95  VVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPG 154

Query: 128 SFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVI 187
           +F  ++  F+S + G A  +++   W     LEL      +++W   +    +I IF+V 
Sbjct: 155 NFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADVFIVIFYVF 214

Query: 188 LTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWG 246
           L   + F V+ YGE EF     K+  + GFII    I CG AG  G +G +YWR+PG + 
Sbjct: 215 LLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFA 274

Query: 247 TGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILV 306
            G         RF G    L++A F+F G EL  ++  E +NPR++ P A ++ V+RIL+
Sbjct: 275 EGS-----GATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILI 329

Query: 307 FYILSLFFIGLLVPYDDVKLK-SENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISA 365
            Y+L++  IG  VP+++ +L  S  S   +SP+++A      +++PHI N VIL+++IS 
Sbjct: 330 IYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISV 389

Query: 366 GNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAF 425
            NS +Y   RL+  LA+ G  PK      + G P+ A+V  SL G + F+  S   ++AF
Sbjct: 390 ANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAF 449

Query: 426 QWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIII 485
            WL  + G++  F+W  I  +HIRF + ++ +G S +++ +KA    + +YY     +++
Sbjct: 450 TWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLV 509

Query: 486 IFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLW 523
              Q + A +P     K D   FF SY++  L+   +  + ++
Sbjct: 510 FMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVY 552

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  253 bits (647), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 146/466 (31%), Positives = 243/466 (52%), Gaps = 12/466 (2%)

Query: 51  ENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVY 110
           E E      + +DLS RH                     L   GP   +I ++ + T ++
Sbjct: 77  EQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLF 136

Query: 111 SVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQF 170
           +V  SLGE++   PV   F ++S RF+ P+   A    Y   W +   LEL      I++
Sbjct: 137 TVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKY 196

Query: 171 WTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGK 230
           W   +   AW++IF+  + ++N+  V+ +GE EF ++ +K+ +I+GF I    + CG G 
Sbjct: 197 WNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGP 256

Query: 231 TGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANP 289
            G     +YW +PG +       + +  +F G  S  + AAF++ G E+  ++A E+ NP
Sbjct: 257 HGGYIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNP 311

Query: 290 RQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYV--SSSPFIIAIENSGT 347
           R+T+PKA ++  + I   Y+  L  IG LVP +D +L + +S V  +SSP +IAIEN G 
Sbjct: 312 RETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGI 371

Query: 348 KILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTS 407
           K LP + N +IL+ ++S  NS VY  SR +  +A  G  PK   +  K G P+ A++ T 
Sbjct: 372 KGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTL 431

Query: 408 LFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFK 467
            FG L+F+  S    E F WL  + G++  F W+ I+ +HIRF Q ++ +  S ++LPF 
Sbjct: 432 FFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFI 491

Query: 468 AKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYIS 509
           ++     ++Y  IV+ +++    +T+  P      +  +FF  Y+S
Sbjct: 492 SQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLS 537

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  252 bits (644), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 157/473 (33%), Positives = 229/473 (48%), Gaps = 15/473 (3%)

Query: 39  TPTTTPSKENVSENEK--DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPV 96
           TP    + E  + N    D    VKR L  RH                   N L   GP+
Sbjct: 28  TPDQIETGEGKNHNASLYDPKTGVKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPL 87

Query: 97  GSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMT 156
             L+ +  +G + +++ +S+GEM T  P    FT  + RF S +L A  GY Y   +   
Sbjct: 88  ALLLGFSIIGIIAFTIMESIGEMITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAV 147

Query: 157 FALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILG 216
            A E + +  I QFW   VPL  +I IFW       +  V  +GEIE+W+++ K+  ++ 
Sbjct: 148 MANEYNTLSSIFQFWGPQVPLYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVA 207

Query: 217 FIIYCFCIVCGAGKTGPV-GFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQG 275
           F I+    + G  K  P  GF YW NPG    G          F G A   +  +  + G
Sbjct: 208 FYIFSTIYISGGIKDRPAFGFHYWNNPGALSHG----------FKGIAEVFVFCSTFYSG 257

Query: 276 TELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSS 335
           TE V  +A E+ NP + +P AIR+  +RILV YI   FF G+ VPY+D  L +    + S
Sbjct: 258 TESVAYSASESKNPNRAIPLAIRQTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKALKS 317

Query: 336 SPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTK 395
            P  IAI  +G +   H+ N  ILVT ISA N +++IGSR +  LA  G  PK  A T +
Sbjct: 318 -PISIAITRAGWEGGTHLVNAFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDR 376

Query: 396 SGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQ 455
            GVP+ A+   +  G ++ M  S G   A+ +++N+ GV  F  W  I   H+RF +   
Sbjct: 377 RGVPIPAITLFNALGLVSLMNVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWI 436

Query: 456 SRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYI 508
            +G +  +LP+KA F PY         I +   QG+T+F P F   +F  +Y+
Sbjct: 437 KQGRTVKELPYKALFYPYTQIIGIAANIFLALIQGWTSFVP-FKAGDFVDAYV 488

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  255 bits (651), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 155/522 (29%), Positives = 258/522 (49%), Gaps = 15/522 (2%)

Query: 14  GKSKIVIKSTESLEQHDLQGNEDKNT---PTTTPSKENVSENEKDEYHEVKRDLSKRHXX 70
           G+    I +   +  +++  N  KN          ++  +     E    K  +  RH  
Sbjct: 105 GEPSTNIDTAYDMNSNEVDPNNKKNENIYALNDDLEDGTTSIAASEDMPKKGGMKARHVI 164

Query: 71  XXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASF 129
                              L  SGP G ++ Y  +  V Y V Q+ GEMA   P +   F
Sbjct: 165 MMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGF 224

Query: 130 TIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILT 189
             +   F+S   G A  +++  +W     LEL      +++WT ++    ++ IF++ L 
Sbjct: 225 NTYQSLFISKPFGFATVWIFALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLL 284

Query: 190 ISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTG 248
             +   +R+Y E EF+    K+  I GFII+   + CG AG  G +G +YW +PGP+   
Sbjct: 285 FVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPF--- 341

Query: 249 IISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFY 308
             +S+   ARF      LINA F++ GTEL  ++  E  NPR+ VP A +  V+R+ + Y
Sbjct: 342 --ASDNGAARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIY 399

Query: 309 ILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNS 368
           +L++  IG  VPY+   L    +   +SP+++A +  G KI+PH  N VIL+++IS  NS
Sbjct: 400 LLTMILIGFNVPYNSPDLMGNANSKDASPYVLAAQIHGVKIVPHFINAVILLSVISVANS 459

Query: 369 NVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWL 428
            ++ G RLL  LA+ G  PK      ++G P+ A+   SLFG +AF  TS   DE F WL
Sbjct: 460 ALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWL 519

Query: 429 LNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFF 488
             + G++  F+W  I  +HIRF   ++  G S +++ +KA    + +YY     ++++  
Sbjct: 520 AAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIWGSYYGLFFNLLVLIA 579

Query: 489 QGFTAF-AP----KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
           Q + A  AP    +   ++FF SY++  ++  F+  + ++ K
Sbjct: 580 QFWVALSAPGSGGQVTAISFFESYLAFVIWVFFYLCYMIYNK 621

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  253 bits (645), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 148/500 (29%), Positives = 252/500 (50%), Gaps = 12/500 (2%)

Query: 32  QGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLM 91
           + N+     +      + + +   + H +K+ +  RH                     L 
Sbjct: 64  EDNKHSEVDSDVERNGDAAYSVNTDTH-LKKAMKTRHVIMMTLGTGIGTGLLVANAKGLH 122

Query: 92  ISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASFTIFSHRFLSPALGAANGYMYW 150
             GP   +I Y  +  V Y + Q+ GEMA   P +  +F  ++  F+S   G A  +++ 
Sbjct: 123 FGGPAALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFC 182

Query: 151 FSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLK 210
             W     LEL     II++WT  V    ++ IF+V L   +   V+ YGE EF     K
Sbjct: 183 IQWLTVLPLELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCK 242

Query: 211 VNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINA 269
           +  I GFII+   + CG AG  G +G +YW +PG +      +N AE RF G    L++ 
Sbjct: 243 ILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAFA----GTNAAE-RFKGVCYVLVSG 297

Query: 270 AFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLK-S 328
            F++ GTEL  ++  E  NPR++ P A ++ ++RILV Y+L++  IG  VP++D +L  +
Sbjct: 298 YFSYGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGA 357

Query: 329 ENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPK 388
             S   +SP+++A    G +++PHI N VIL+ +IS  NS++Y   RLL  LA+ G  PK
Sbjct: 358 GGSATHASPYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPK 417

Query: 389 LFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHI 448
                 + G P++A++  ++FG +AF   S   ++ F WL  + G++  F+W  I  +H+
Sbjct: 418 FMTYVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHV 477

Query: 449 RFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFA 505
           RF Q ++ +G   N++ + A    + + Y  +  I++   Q + A AP        +FF 
Sbjct: 478 RFRQAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAPPKSPITAQSFFE 537

Query: 506 SYISVFLFFIFWGSFQLWFK 525
           SY++  ++  F+  + +W K
Sbjct: 538 SYLAFPIWIAFYFGYMIWNK 557

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  251 bits (642), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 160/518 (30%), Positives = 258/518 (49%), Gaps = 24/518 (4%)

Query: 14  GKSKIVIKSTESLEQHDLQG-NEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXX 72
           G++ +V K T  + + DL   + D     + P+K    +      H +K+ L   H    
Sbjct: 11  GETSVVDKQTGQVYELDLTSYSNDSEKNGSLPNKPQSGD------HNLKKGLKSAHIQLI 64

Query: 73  XXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-------V 125
                          + L   GP G  I+Y  + T++Y V  +L EM  F+P        
Sbjct: 65  AIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENET 124

Query: 126 TASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFW 185
             S +    R++  +LG A G+ Y + + +  A E +    ++ +WT AVP  AWI+IF 
Sbjct: 125 GGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTTAVPKAAWITIFL 184

Query: 186 VILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGP 244
            I+ + N   V  YG  E     LK+  ILG II    +  G G     +GFR+W++PG 
Sbjct: 185 GIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGA 244

Query: 245 WGTGIISSNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFR 303
           W   +  ++    R     + +I A F F  G ELV +T+ EA + R+ + KA R+ V+R
Sbjct: 245 WAYHL--ADGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWR 302

Query: 304 ILVFYILSLFFIGLLVPYDDVKLKSENSY----VSSSPFIIAIENSGTKILPHIFNGVIL 359
           ++ FY +S    G++V  +D  L +  S       SSPF+I I+N+G K+LPHI N  IL
Sbjct: 303 LIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCIL 362

Query: 360 VTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETST 419
            +  S+GNS +Y  +R L  L++ G  PK+F +  + GVP   V F + F  LA++  S+
Sbjct: 363 SSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSS 422

Query: 420 GGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYAT 479
              + F W  N+  ++GF  W+    A++RF + +    +  + LPFK  F PY  ++  
Sbjct: 423 STADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPYFTWFYI 481

Query: 480 IVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFW 517
           I++ II    G+ +F   ++  +F A+YI++ LF I W
Sbjct: 482 ILIAIICLINGYESFV-HWNYKDFIAAYITLPLFLILW 518

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  251 bits (640), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 155/467 (33%), Positives = 232/467 (49%), Gaps = 14/467 (2%)

Query: 44  PSKENVSENEK-DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAY 102
           P   N+   E+ D    VKR L  RH                   N L   GP+  L+ +
Sbjct: 27  PDTHNIKSFEQFDPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGF 86

Query: 103 LFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELS 162
             +G V ++V +S+GEM T  P  + F+  S RF S AL A +GY Y   +    A E +
Sbjct: 87  GIIGIVAFAVMESIGEMITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYN 146

Query: 163 VVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCF 222
            +  I+QFW   VPL  +I IF V   +  +  V I+GE E+W+A+ K+  ++ + I+  
Sbjct: 147 TLSSILQFWGPQVPLYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSI 206

Query: 223 CIVCGAGKTGPV-GFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281
             + G  K  P  GF YW NPG    G          F G A   +  +  + GTE V +
Sbjct: 207 IYISGGIKNRPAFGFHYWNNPGALADG----------FKGIAVVFVFCSSFYSGTESVAL 256

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIA 341
            A E+ NP + VP AI++  +RI++ Y+    F G  VPY+D  L +    + S P  IA
Sbjct: 257 AATESRNPGKAVPIAIKQTFWRIIIVYLGIAVFYGATVPYNDTSLGAHTKALKS-PIAIA 315

Query: 342 IENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVF 401
           I  +G +   H+ N  IL+T +SA N ++YIGSR L  LA  G  PK    T K GVP+ 
Sbjct: 316 ITRAGWEGGVHLVNAFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIP 375

Query: 402 AVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISR 461
           A+   +  G ++ M  S G   A+ +++N+ GV  F  W +IS  H+RF +    +G S 
Sbjct: 376 AITLFNALGLVSLMNVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSA 435

Query: 462 NDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYI 508
           ++LP+K+   P+   ++    I +   QG+T F P F   +F  +YI
Sbjct: 436 SELPYKSLLFPWGPIFSLAANIFLGLIQGWTTFVP-FSAKDFVDAYI 481

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  251 bits (642), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 143/475 (30%), Positives = 251/475 (52%), Gaps = 21/475 (4%)

Query: 59  EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118
            +KR L  RH                     L   GP+  LI +   GT +      LGE
Sbjct: 67  NLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGE 126

Query: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178
           +    PV  +F  +S RFL P++      +Y   W     LE+      ++FWT +V   
Sbjct: 127 VTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTSVDPV 186

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFR 237
            W+++F+ ++   NLF VR +G+ +F  + +K+  I GFII C  ++ G G T   +G R
Sbjct: 187 VWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGAR 246

Query: 238 YWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAI 297
           YW +PG    G          F G A+ ++ A+++  G+E+  + +GE  +P++ +P AI
Sbjct: 247 YWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DPKE-IPHAI 294

Query: 298 RKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGV 357
           +++ +RI+ F+++SL  +G LVPY + +L    S V++SPF+IAI+    ++LPHI NGV
Sbjct: 295 KQIFWRIIFFFLVSLTLVGFLVPYTNDQLLG-GSNVNNSPFVIAIKMHNIRVLPHIINGV 353

Query: 358 ILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMET 417
           ILV+I+S GNS ++  SR L  +A  G  P++F    ++G P+  ++  SLFG LAF+  
Sbjct: 354 ILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLVK 413

Query: 418 STGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYY 477
           S+     F WL+ V G+A    WL I+ +HIRF   ++++G S ++L F +    + + Y
Sbjct: 414 SSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWGSVY 473

Query: 478 ATIVMIIIIFFQGFTAF-------APKFDVLNFFASYISVFLFFIFWGSFQLWFK 525
           + ++ ++++  Q + +         P+     FF +Y+   +    + + +++++
Sbjct: 474 SGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYR 528

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  251 bits (640), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 172/527 (32%), Positives = 271/527 (51%), Gaps = 43/527 (8%)

Query: 2   SILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVK 61
           SI D    +   GK +I  + + SL+  +L+ + D         ++N+ E       ++ 
Sbjct: 4   SISDREAVKVDSGKQEIY-EVSSSLDIDELRSDFDP--------EQNIRE-------DLT 47

Query: 62  RDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT 121
           R LS RH                     L   GP    + Y  +G VVY     LGEM+T
Sbjct: 48  RALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMST 107

Query: 122 FIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW-TFAVPLPAW 180
           F+P++ SF  ++ +F S +   A  + YWF+ A++ A +L+ +  ++ +W T     P W
Sbjct: 108 FMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYW 167

Query: 181 IS--IFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP---VG 235
            +  IFW  +   N+  VRIYGE E+W+A LKV AI+ F I    I+   GK      +G
Sbjct: 168 GASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFI--MSIIVNVGKNPQHEYIG 225

Query: 236 FRYW-RNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVP 294
           F+ W     P+  G          F G+AS  ++A F + GTE + +T GEA+NP +  P
Sbjct: 226 FKNWTHGEAPFVNG----------FKGFASLFVSACFAYGGTESITLTGGEASNPVRNTP 275

Query: 295 KAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIF 354
           K ++ V +RIL+FY+LS FFIG+ +PYD   L +++  V +SPF +  + +GT+      
Sbjct: 276 KIVKTVFWRILIFYVLSTFFIGMNIPYDYPGLSTKS--VMTSPFTLVFQMAGTRGAGSFM 333

Query: 355 NGVILVTIISAGNSNVYIGSRLLFGLAKNGTGP-KLFAKTTKSGVPVFAVVFTSLFGALA 413
           N VIL ++ISA N  ++ GSR+++ +A +G  P K+  +T +   P  AV+ T   G L 
Sbjct: 334 NAVILTSVISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLC 393

Query: 414 FMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPY 473
              +  G    + WL N+VGV+   +WL I    IRF + L+ +G   + L FK    P+
Sbjct: 394 LGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPF 452

Query: 474 LAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLF---FIFW 517
             Y+  I  + II  QG+ AF P + V +FF+ Y+ +F+F   +I W
Sbjct: 453 GPYFLVIFTVFIILIQGWQAFDP-WSVTDFFSVYLELFVFPFVYIIW 498

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  248 bits (634), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 153/488 (31%), Positives = 241/488 (49%), Gaps = 36/488 (7%)

Query: 16  SKIVIKSTESLEQHDLQGNEDKNTP---TTTPSKENVSEN-----------------EKD 55
           SK   K  ES  +    G E K++     TTP  + V                    E  
Sbjct: 7   SKYYDKGIESHLEAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPEDG 66

Query: 56  EYH--EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVT 113
            +H   +K+ L  RH                     L + GP+  +I +   GT +    
Sbjct: 67  SFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTI 126

Query: 114 QSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTF 173
             LGE+    PV  +F  +  RFL P++      +Y   W     LE+      +++W  
Sbjct: 127 HGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDT 186

Query: 174 AVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-KTG 232
           +V    W++IF+ I+ + NL  VR +GE EF  + +KV  I+GFII C  ++CG G K  
Sbjct: 187 SVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKE 246

Query: 233 PVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQT 292
            VG +YW +PGP   G          F G A  L+ A+++  GTE+  + +GE  +P++ 
Sbjct: 247 FVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGET-DPKE- 294

Query: 293 VPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPH 352
           +P AI++V +RI+ F+++SL  +G LVPY +  L   +S V +SPF+IAI   G   LP 
Sbjct: 295 LPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS-VDNSPFVIAIRLHGINALPS 353

Query: 353 IFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGAL 412
           I N VILV+++S GNS ++  SR L  +A  G  P++F    ++G P+  ++   LFG L
Sbjct: 354 IVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLL 413

Query: 413 AFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMP 472
           AF+  S    + F WL+ + G+A    WL I+ +HIRF   ++++G+   +L F +    
Sbjct: 414 AFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGI 473

Query: 473 YLAYYATI 480
           Y + Y+ I
Sbjct: 474 YGSVYSAI 481

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  248 bits (634), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 153/488 (31%), Positives = 241/488 (49%), Gaps = 36/488 (7%)

Query: 16  SKIVIKSTESLEQHDLQGNEDKNTP---TTTPSKENVSEN-----------------EKD 55
           SK   K  ES  +    G E K++     TTP  + V                    E  
Sbjct: 7   SKYYDKGIESHLEAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPEDG 66

Query: 56  EYH--EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVT 113
            +H   +K+ L  RH                     L + GP+  +I +   GT +    
Sbjct: 67  SFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTI 126

Query: 114 QSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTF 173
             LGE+    PV  +F  +  RFL P++      +Y   W     LE+      +++W  
Sbjct: 127 HGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDT 186

Query: 174 AVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-KTG 232
           +V    W++IF+ I+ + NL  VR +GE EF  + +KV  I+GFII C  ++CG G K  
Sbjct: 187 SVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKE 246

Query: 233 PVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQT 292
            VG +YW +PGP   G          F G A  L+ A+++  GTE+  + +GE  +P++ 
Sbjct: 247 FVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGET-DPKE- 294

Query: 293 VPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPH 352
           +P AI++V +RI+ F+++SL  +G LVPY +  L   +S V +SPF+IAI   G   LP 
Sbjct: 295 LPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSS-VDNSPFVIAIRLHGINALPS 353

Query: 353 IFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGAL 412
           I N VILV+++S GNS ++  SR L  +A  G  P++F    ++G P+  ++   LFG L
Sbjct: 354 IVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLL 413

Query: 413 AFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMP 472
           AF+  S    + F WL+ + G+A    WL I+ +HIRF   ++++G+   +L F +    
Sbjct: 414 AFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGI 473

Query: 473 YLAYYATI 480
           Y + Y+ I
Sbjct: 474 YGSVYSAI 481

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  251 bits (642), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 153/523 (29%), Positives = 263/523 (50%), Gaps = 20/523 (3%)

Query: 9   EETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRH 68
           E + E ++ +V +  +S ++ + Q  ED N        E+ + + K   + +K+ +  RH
Sbjct: 42  EHSEESRNGLVHRFVDSFKRAESQHLEDDN------DLEDGTRSMKSN-NRLKKSMKSRH 94

Query: 69  XXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTA 127
                                L ++GP   +I Y+ +  V Y + Q+ GEM    P +  
Sbjct: 95  VVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPG 154

Query: 128 SFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVI 187
           +F  ++  F+S + G A  +++   W     LEL      I++W   +    +I IF+V 
Sbjct: 155 NFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKINSDVFIVIFYVF 214

Query: 188 LTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWG 246
           L   + F V+ YGE EF  +  K+  I GFII    I CG AG  G +G +YWR+PG + 
Sbjct: 215 LLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFA 274

Query: 247 TGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILV 306
            G         RF G    L+ A F+F G EL  ++  E +NPR++ P A ++ V+RIL+
Sbjct: 275 EGN-----GATRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILI 329

Query: 307 FYILSLFFIGLLVPYDDVKLKSENSYVS-SSPFIIAIENSGTKILPHIFNGVILVTIISA 365
            Y+L++  IG  VP+++ +L    S  + +SP+++A      +++PHI N VIL+++IS 
Sbjct: 330 IYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVVPHIINAVILISVISV 389

Query: 366 GNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAF 425
            NS +Y   RL+  LA+ G  PK      + G P+ A+    L G + F+  S   ++AF
Sbjct: 390 ANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAF 449

Query: 426 QWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIII 485
            WL  + G++  F+W  I  +HIRF + ++ +G S +++ +KA    + +YY     I++
Sbjct: 450 TWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILV 509

Query: 486 IFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLW 523
              Q + A +P     K +   FF SY++  L+   +  + L+
Sbjct: 510 FMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLY 552

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  251 bits (641), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 150/510 (29%), Positives = 266/510 (52%), Gaps = 19/510 (3%)

Query: 34  NEDKNTPTTT---PSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPL 90
           N+  N  T++    S ++V + + +  + + ++LS RH                     L
Sbjct: 58  NQTTNDITSSGRFHSDDDVQQEDINNTN-LSKELSVRHLLTLAVGGAIGTGLFVNTGAAL 116

Query: 91  MISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYW 150
              GP   +I ++ + T +++V  SLGE++   PV   F ++S RF+ P+   A    Y 
Sbjct: 117 STGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYL 176

Query: 151 FSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLK 210
             W +   LEL      I++W   +   AW++IF+  + ++N+  V+ +GE EF ++ +K
Sbjct: 177 AQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIK 236

Query: 211 VNAILGFIIYCFCIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINA 269
           + AI+GF I    + CG G  G     +YW +PG +       + +  +F G  S  + A
Sbjct: 237 ILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAF-----VGHDSGTKFKGLCSVFVTA 291

Query: 270 AFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSE 329
           AF++ G E+  ++A E+ NPR+T+PKA ++  + I + Y+  L  IG LVP +D +L + 
Sbjct: 292 AFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNG 351

Query: 330 NSYV--SSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGP 387
           +S V  +SSP +IAIEN   K LP + N +IL+ ++S  NS VY  SR +  +A  G  P
Sbjct: 352 SSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLP 411

Query: 388 KLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAH 447
           K   +  K G P+ A+V T  FG L+F+  S    E F WL  + G++  F W+ I+ +H
Sbjct: 412 KFLRRVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSH 471

Query: 448 IRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNF 503
           IRF Q ++ +  S ++LPF ++   + + Y  +V+ +++    +T+  P      +  +F
Sbjct: 472 IRFRQAMKFQERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESF 531

Query: 504 FASYISVFLFFIFWGSFQLWFKCRYVWKLV 533
           F  Y+S  +  + +   +++ +    W+L+
Sbjct: 532 FEGYLSFPILIVCYFGHKIYTR---DWRLL 558

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  250 bits (638), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 162/500 (32%), Positives = 265/500 (53%), Gaps = 29/500 (5%)

Query: 28  QHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXX 87
            H +   +  N+ +  P  ++    E+     + R LS RH                   
Sbjct: 35  DHKIVVVDTNNSVSDDPESQDAVIRER-----LNRSLSPRHVNMIAIAGVIGTGLFLSTA 89

Query: 88  NPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGY 147
             L   GP   LI Y+ +G V+Y    SLGEM+TF+P++ S+  +S +F+S +   A   
Sbjct: 90  KSLNAGGPGSLLINYVIMGGVIYLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMC 149

Query: 148 MYWFSWAMTFALELSVVGQIIQFW-TFAVPLPAWIS--IFWVILTISNLFPVRIYGEIEF 204
             W+S A++ A +L+ +  ++ +W T     P W +  +FW ++   N+  V++YGE E+
Sbjct: 150 NMWYSDAVSVASDLTALQLVLDYWKTNTHHFPYWAASLLFWFLILGLNVVHVKLYGEAEY 209

Query: 205 WIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRN-PGPWGTGIISSNIAEARFLGW 262
           W+A LKV A++ F I      CG  +    +GF+ W +   P+  G          F G+
Sbjct: 210 WLAMLKVVAVIIFFIMAIIANCGHNQQHEYIGFKNWSHGDAPFVQG----------FKGF 259

Query: 263 ASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD 322
            +  + ++F++ GTE V +T GEA NP +  PK I+ V +RILVFY+ ++FF+G+ +PYD
Sbjct: 260 VTIFVTSSFSYGGTETVTLTGGEAKNPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYD 319

Query: 323 DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAK 382
              LK+++  V +SPF I  + +GTK      N VI+ + ISA N  ++ GSR+L+ +  
Sbjct: 320 YPNLKTKS--VLTSPFTIVFQMAGTKAAGSFMNAVIMTSAISACNHALFGGSRILYNMGL 377

Query: 383 NGTGP--KLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSW 440
            G  P  + F KT ++  P  AV+ T   G L F  +  G  E F WL N+VGV+   SW
Sbjct: 378 EGFLPYSRFFTKTNRNKAPYVAVITTWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISW 437

Query: 441 LLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDV 500
           L I+   IRF + L+++G   ++L F+    PY  ++  I + +II  QG++AF P +  
Sbjct: 438 LSIAVISIRFRKGLEAQG-KVHELKFRNWTYPYGPWFCIIFISLIILVQGWSAFDP-WST 495

Query: 501 LNFFASYISVFLF---FIFW 517
            +FF+ Y+ + +F   +IFW
Sbjct: 496 SSFFSFYLELIVFPACWIFW 515

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  251 bits (640), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 183/567 (32%), Positives = 294/567 (51%), Gaps = 42/567 (7%)

Query: 1   MSILDIN-TEETLEGKSKIVIKS--------TESLEQHDLQGNEDKNTPTTTPSKENVSE 51
           M  LD N T +  E K + VI++        +E+L   DL     ++T   +  +  +  
Sbjct: 1   MITLDPNITSDAQEEKGQAVIENCYLGQDVISETLSYKDLSNTTPESTIDKSRWRNFLDS 60

Query: 52  NEKDEYHEV-------------------KRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMI 92
            ++ E  EV                   +  L  RH                     L  
Sbjct: 61  FKRIEVEEVDPNLTDIEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRT 120

Query: 93  SGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFS 152
           +GP G LI +   GT+++++  +LGE+A   PV+  F  ++ RF+  + G AN + Y F 
Sbjct: 121 AGPAGILIGWGITGTMIFTMVMALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQ 180

Query: 153 WAMTFALELSVVGQIIQFWTFAVP-LPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKV 211
           W +   LE+      + +W   V     ++++FW+++ I N+F VR YGE EF  + +KV
Sbjct: 181 WLVALPLEIVAASITVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKV 240

Query: 212 NAILGFIIYCFCIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAA 270
            A++GFII    +VCG G  G     RYW +PG +     + +    RF G+ S  + AA
Sbjct: 241 IAVIGFIILGIILVCGGGPVGGYVGGRYWHDPGAF-----AGHSPGRRFKGFCSVFVTAA 295

Query: 271 FTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSE 329
           F+F G+ELVGI + E+ NPR++VP+A ++V +RIL+FYIL L  +GLLVPY D +L  S 
Sbjct: 296 FSFAGSELVGIASAESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSS 355

Query: 330 NSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKL 389
               S+SPF+IAI   G   LP + N VIL++++S GNS++Y  SR L  L++ G  PK 
Sbjct: 356 GVDASASPFVIAIVTHGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKT 415

Query: 390 FAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIR 449
            A   + G P+  +   S FG +AF+  S   ++ F WLL + G++ F +W  I F HIR
Sbjct: 416 VAYIDRKGRPLVGIAICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIR 475

Query: 450 FMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---KFDVLNFFAS 506
           F   L+  G S ++LPFK+      +Y+   + ++++  Q + A  P     +  +FF++
Sbjct: 476 FRSALKVNGRSDDELPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSA 535

Query: 507 YISVFLFFIFWGSFQLWFKCRYVWKLV 533
           Y++  +   F+ + +LW   +  WKL+
Sbjct: 536 YLAAPIVLAFYIAHKLW---KRNWKLL 559

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  249 bits (637), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 166/507 (32%), Positives = 264/507 (52%), Gaps = 37/507 (7%)

Query: 34  NEDKNTPTTTPSKEN----------VSENEKDEYHEVKRDLSK----RHXXXXXXXXXXX 79
            ED      TP K+N           +E + D    ++ DL +    RH           
Sbjct: 14  EEDYYKGLNTPPKKNEVVVELDPSLTTEEDYDPEANIREDLQRALKPRHINMISIAGVIG 73

Query: 80  XXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSP 139
                     L   GP    + Y  +G VVY     LGEM+T++P++ SF  ++ +F S 
Sbjct: 74  TGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSE 133

Query: 140 ALGAANGYMYWFSWAMTFALELSVVGQIIQFW-TFAVPLPAWIS--IFWVILTISNLFPV 196
           +   A  + YWF+ A++ A +++ +  ++ +W T A   P W +  +FW ++ + N+  V
Sbjct: 134 SFACALMWNYWFNDAVSVASDMTALQLVMDYWDTEASGFPYWAASLLFWFLVVLLNVIHV 193

Query: 197 RIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRN-PGPWGTGIISSNI 254
           R YGE E+W+A LKV AI+ F I    +  G       +GF+ W +   P+  G      
Sbjct: 194 RFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQHEYIGFKNWNHGEAPFVDG------ 247

Query: 255 AEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFF 314
               F G+AS  ++A+F + GTE + +T GEAANP +  PK ++ V +RILVFY+ S FF
Sbjct: 248 ----FKGFASLFVSASFAYGGTESITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFF 303

Query: 315 IGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGS 374
           I + +PYD   L +++  V +SPF +  + +GTK      N VI+ ++ISA N  ++ GS
Sbjct: 304 IAMNIPYDYPGLDTKS--VVTSPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGS 361

Query: 375 RLLFGLAKNGTGP-KLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVG 433
           R+++ +   G  P K+ ++T +  VP  +V+ TS  G L F  +  G    + WL N+VG
Sbjct: 362 RVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVG 421

Query: 434 VAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTA 493
           V+   +WL I    IRF + L+ +G   ++L +K    PY  Y+  I +  II  QG++A
Sbjct: 422 VSNQIAWLCIGITSIRFRKGLEKQG-KTHELRYKNWTYPYGPYFLVIFVTFIILVQGWSA 480

Query: 494 FAPKFDVLNFFASYISVFLF---FIFW 517
           F P +DV NFF+ Y+ +F+F   FI W
Sbjct: 481 FDP-WDVTNFFSYYLDLFVFPFCFIIW 506

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  251 bits (640), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 152/500 (30%), Positives = 260/500 (52%), Gaps = 12/500 (2%)

Query: 33  GNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMI 92
           G  D ++ T   +   V + + D + ++ +DL  RH                     L  
Sbjct: 69  GKGDSHSLTRDEAGSGVMKEDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSS 128

Query: 93  SGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFS 152
            GP   +I ++ + T +++V  SLGE+A   PV   F ++  RF+ P+ G A    Y   
Sbjct: 129 GGPASLVIDWVIISTCLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQ 188

Query: 153 WAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVN 212
           W +   LEL      I++W   +   AW++IF+  +  +N+  V+ +GE EF ++ +K+ 
Sbjct: 189 WLVLLPLELVAASITIRYWNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKIL 248

Query: 213 AILGFIIYCFCIVCGAGKTGPVGF-RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAF 271
           AI+GF I    + CG G  G     +YW +PG +         +  +F G  S  + AAF
Sbjct: 249 AIVGFTILGIVLSCGGGPKGGYIGGKYWHDPGAF-----VGETSGTKFKGLCSVFVTAAF 303

Query: 272 TFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENS 331
           ++ G EL  ++A E+ NPR+T+PKA ++  + I + Y+  L  IG LVPY++ KL + +S
Sbjct: 304 SYSGMELTAVSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSS 363

Query: 332 YV--SSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKL 389
            V  +SSP +IAIEN G + LP + N +IL+ I+S  NS VY  SR +  +A+    P+ 
Sbjct: 364 SVDAASSPLVIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRF 423

Query: 390 FAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIR 449
             +  + G P+ A + T  FG L+F+  S   +E F WL  + G++  F+W+ I+ +HIR
Sbjct: 424 LGRVDRKGRPLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIR 483

Query: 450 FMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFA 505
           F Q +  +GIS ++LP+ +      ++Y  IV+ +++    +T+  P      D  +FF 
Sbjct: 484 FRQAMAHQGISLDELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFE 543

Query: 506 SYISVFLFFIFWGSFQLWFK 525
            Y+S  +  + +   +L+ +
Sbjct: 544 GYLSFPILIVCYVGHKLYIR 563

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  250 bits (639), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 154/527 (29%), Positives = 263/527 (49%), Gaps = 24/527 (4%)

Query: 9   EETLEGKSKIVIKSTESLEQHDLQGNEDKNT--PTTTPSKENVSENEKDEYHEVKRDLSK 66
           E + E ++ +V +  +S  + + Q  E+ N     T P K N         + +K+ +  
Sbjct: 42  EHSEESRNGLVHRFVDSFRRAESQCLEENNDLEDGTRPMKSN---------NHLKKSMKS 92

Query: 67  RHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPV 125
           RH                     L ++GP   +I Y+ +  + Y + Q+ GEM   +  +
Sbjct: 93  RHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAAGEMGVAYATL 152

Query: 126 TASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFW 185
             +F  ++  F+S + G A  +++   W     LEL      I++W  ++    +I IF+
Sbjct: 153 PGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDSINADVFIVIFY 212

Query: 186 VILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGP 244
           V L   + F V+ YGE EF     K+  + GFII    I CG AG  G +G +YWR+PG 
Sbjct: 213 VFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGS 272

Query: 245 WGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRI 304
           +  G   SN    RF G    L+ A F+F G EL  ++  E +N R++ P A ++ V+RI
Sbjct: 273 FADG---SN--ATRFKGICFILVTAYFSFGGIELFVLSINEQSNARKSTPLAAKRSVYRI 327

Query: 305 LVFYILSLFFIGLLVPYDDVKLKSENSYVS-SSPFIIAIENSGTKILPHIFNGVILVTII 363
           L+ Y+L++  IG  VP+++ +L    S  + +SP+++A      +++PHI N VIL+++I
Sbjct: 328 LIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVIPHIINAVILISVI 387

Query: 364 SAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDE 423
           S  NS +Y   RL+  LA+ G  P+      + G P+ A+   +L G + F+  S   ++
Sbjct: 388 SVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGVVGFVACSPQEEQ 447

Query: 424 AFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMI 483
           AF WL  + G++  F+W  I  +HIRF + ++ +G S  +L +KA    + +YY     I
Sbjct: 448 AFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKANTGIWGSYYGVFFNI 507

Query: 484 IIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
           ++   Q + A +P     K DV  FF  Y++  L+   +  + L+ K
Sbjct: 508 LVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYMLYNK 554

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  251 bits (640), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 155/536 (28%), Positives = 274/536 (51%), Gaps = 17/536 (3%)

Query: 6   INTEETLEGKSKIVIKSTESLEQHDLQGNED---KNTPTTTPSKENVSENEKDEYHEVKR 62
           I ++ ++ GK +    +  SLE+ +    +D   +N    +P  +++S  E+      +R
Sbjct: 66  IVSQMSVSGKKEAFELNVTSLEEGETATIDDFVLQNR--DSPKSQSLSLEERI----ARR 119

Query: 63  DLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATF 122
            L  R                      ++  GP   LIA+     V   +++ +  M T+
Sbjct: 120 KLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVMVTY 179

Query: 123 IPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWIS 182
           +PVT SF  F+ RF+  + G A G+ Y+   A     E++ V  ++++WT  +P  A IS
Sbjct: 180 LPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTDKIPKAALIS 239

Query: 183 IFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPV-GFRYWRN 241
           +  ++    NL+ V  +GE EF+++  KV   +G II+   ++ G      V GF+ W N
Sbjct: 240 MLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSN 299

Query: 242 PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVV 301
           PG +   I  S+ +  RF G+ S L+ A + F G + +G  A EA NPR+ +P + RKV 
Sbjct: 300 PGAFAEYI--SDGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVF 357

Query: 302 FRILVFYILSLFFIGLLVPYDDVKL----KSENSYVSSSPFIIAIENSGTKILPHIFNGV 357
            R+++FYI     +G+L+PY+D  +    K       +SP++ A++  G ++LPHI N +
Sbjct: 358 GRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHIVNIL 417

Query: 358 ILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMET 417
           IL +IISAGNS++Y  SR+L  LA +   P++F  TTK GVPV+  +   +   LA++  
Sbjct: 418 ILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSV 477

Query: 418 STGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYY 477
           S   +    W LNV   A    ++ I  ++++F +   ++ +    LP+ +  +PYLA++
Sbjct: 478 SNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSLPYLAWH 537

Query: 478 ATIVMIIIIFFQGFTAFAP-KFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
           +   +++++   G+T F    +D  +F  SY  +  F +F    +L+   + V  L
Sbjct: 538 SLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTKSVRPL 593

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  249 bits (635), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 154/535 (28%), Positives = 263/535 (49%), Gaps = 28/535 (5%)

Query: 1   MSILDINTEETLE-GKSKIVIKSTESL---EQHDLQGNEDKNTPTTTPSKENVSENEKDE 56
           M  L     + +E  KS +V +  +S    E  +L+ N+ ++   +  +K ++       
Sbjct: 1   MKTLQSPRSDDVEISKSNLVHRFVDSFRRAESPELEENDLEDGTRSIVTKTHL------- 53

Query: 57  YHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSL 116
               K+ +  RH                     L  SGP   +I Y+ +  V Y + Q+ 
Sbjct: 54  ----KKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAA 109

Query: 117 GEMATFIP-VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAV 175
           GEMA   P +  SF  ++  F+S   G A  ++++  W   F LEL      +++W   +
Sbjct: 110 GEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKI 169

Query: 176 PLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPV 234
               +I IF+  L   + F V+ YGE EF     KV  + GFII    I CG AG  G +
Sbjct: 170 NADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYI 229

Query: 235 GFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVP 294
           G +YW +PG +  G   +     RF G    L++A F++ G EL  ++  E  NPR++ P
Sbjct: 230 GAKYWHDPGSFADGPPIT-----RFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTP 284

Query: 295 KAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVS-SSPFIIAIENSGTKILPHI 353
            A ++ ++RIL+ Y+ ++  IG  VP++  +L    S  + +SP+++A      K++PH 
Sbjct: 285 AAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHF 344

Query: 354 FNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALA 413
            N VIL+++IS  NS +Y   RL+  LA+ G  PK      + G P+  ++  +LFG + 
Sbjct: 345 INAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIG 404

Query: 414 FMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPY 473
           F+  S+  +E F WL  + G++  F+W  I  +HIRF Q ++  G S +++ FKA    +
Sbjct: 405 FVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIW 464

Query: 474 LAYYATIVMIIIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLW 523
            +YY     I++   Q + A +P     K D   FF SY++  ++ +F+  + ++
Sbjct: 465 GSYYGCAFNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIY 519

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  250 bits (639), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 159/548 (29%), Positives = 275/548 (50%), Gaps = 37/548 (6%)

Query: 7   NTEETLEGKSKIVIKSTESLEQHDLQGN----EDKNTPTTTP-------------SKENV 49
           N   T E +      ST   ++H ++G      D   P   P             + E +
Sbjct: 43  NAATTREEEYDFTTDSTSGRKRHGVKGYFRDFIDSFKPAENPQPHTNLDMELVGVTSETI 102

Query: 50  SENEKDEYH---EVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLG 106
            +++KDE     ++K+ +  RH                     L  +GP G +I Y  +G
Sbjct: 103 EQHKKDEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMG 162

Query: 107 TVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVG 165
           +++Y + Q+ GEMA  ++ +   F  +    + P    A  ++Y   W     LEL    
Sbjct: 163 SLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTAS 222

Query: 166 QIIQFWTFAVPLPAWISIFWV-ILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI 224
             I++WT  V    ++ IF+V IL I+ L   R Y E EF     K+  ++GF I    I
Sbjct: 223 MTIKYWTTKVDPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIII 282

Query: 225 VCGAGKT-GPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITA 283
           +CG   T G +G RYW +PG +         A  RF G  ++L+ AAF+F  +E + +TA
Sbjct: 283 ICGGAGTDGYIGGRYWHDPGAF-----RGERAVDRFKGVVATLVTAAFSFGQSEFIAVTA 337

Query: 284 GEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAI 342
            E +NPR+ +P A +K+++R L  Y+ S+  +G LVPY+  +L  ++++ + +SP+++A+
Sbjct: 338 SEQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKASPYVLAV 397

Query: 343 ENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFA 402
            N G +++PH  N VI+++++S  NS  Y   R+L  L++ G  PK+F+   ++G P   
Sbjct: 398 ANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMG 457

Query: 403 VVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRN 462
           ++  SLF  +AF  TS   D+ F WLL V G++  F+W+ I  +H+RF + +  +G S  
Sbjct: 458 IIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLG 517

Query: 463 DLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWG 518
           +  F ++   Y + Y+  V+ +I+  Q + A  P    K D  +FF +Y++  +    W 
Sbjct: 518 ECGFLSQVGIYGSAYSFFVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPI----WI 573

Query: 519 SFQLWFKC 526
           +  + +KC
Sbjct: 574 ALYIGYKC 581

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  249 bits (637), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 148/478 (30%), Positives = 245/478 (51%), Gaps = 21/478 (4%)

Query: 56  EYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQS 115
           + + +KR L  RH                     +   GP+  +I +   G+ +      
Sbjct: 81  DTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHG 140

Query: 116 LGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAV 175
           LGE+    PV  +F  +S RFL P+L      +Y   W     LE+      +Q+W  ++
Sbjct: 141 LGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQSI 200

Query: 176 PLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-V 234
               W++IF+  +   NLF  R +GE EF  + +KV  I GFII C  ++CG G     V
Sbjct: 201 DPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFV 260

Query: 235 GFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVP 294
           G +YW +PG    G          F G  S L+ A+++  GTE+V + +GE  +P++ +P
Sbjct: 261 GAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-DPKE-LP 308

Query: 295 KAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIF 354
            AI++  +RIL F+++SL  IG LVPY +  L   +S V++SPF+IAI+    K+LP I 
Sbjct: 309 SAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS-VNNSPFVIAIKLHQIKVLPSIV 367

Query: 355 NGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAF 414
           N VIL++I+S GNS ++  SR L  +A  G  P+ F    ++G P+  ++  SLFG LAF
Sbjct: 368 NAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLAF 427

Query: 415 METSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYL 474
           +  S+   E F WL+ + G+A    WL I+ +HIRF   ++++G S ++L F +    + 
Sbjct: 428 LVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIWG 487

Query: 475 AYYATIVMIIIIFFQGFTAFAP-------KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
           + Y+ ++  +I+  Q + A  P             FF SY+   +  + +   +++++
Sbjct: 488 SAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFYR 545

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  250 bits (638), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 154/522 (29%), Positives = 268/522 (51%), Gaps = 23/522 (4%)

Query: 7   NTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSK 66
           N +E L+ ++K    S +   Q++ +   D +     P+ +N SE E  E + + R +  
Sbjct: 39  NQDEGLQQQAKRQGTSGKFKLQNECKKFFD-SFKRQLPADQN-SELESQERNNLTRSIKS 96

Query: 67  RHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPV 125
           RH                     L  +GP G ++ Y     ++Y + Q+ GE+   +  +
Sbjct: 97  RHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGL 156

Query: 126 TASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFW 185
           T ++T +S   + P+LG A   +Y   W     L+L      I++WT  V    +++  +
Sbjct: 157 TGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTIKYWT-NVNADIFVAAVF 215

Query: 186 VILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGP 244
           + + I NLF  + Y E EF     K+  ++GF+I    I CG AG    +G +YW NPGP
Sbjct: 216 IFVIIINLFGSKGYAEAEFMFNICKILMVIGFVILAIVINCGGAGDRKFIGTKYWHNPGP 275

Query: 245 WGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRI 304
           +  G          F G  +    AAF++ G E++ ++A E  NP +++P A +KVV+RI
Sbjct: 276 FAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRI 325

Query: 305 LVFYILSLFFIGLLVPY--DDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTI 362
           L  Y+L+   I  LVPY  D++     +S   +SPF+IA+ + G K++PH  N VIL+++
Sbjct: 326 LFIYMLTTILICFLVPYNSDELLGSGSSSGSHASPFVIAVASHGVKVVPHFINAVILISV 385

Query: 363 ISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGD 422
           IS  NS++Y   RLL  LA+ G  PK  A   ++G P+   + + +FG + F+ TS   +
Sbjct: 386 ISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGRPLLCFLVSIIFGCIGFVATSDAEE 445

Query: 423 EAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVM 482
           + F WLL +  ++  F W+ +S +HIRF   +  +G S +++ +KA+   + ++ A ++ 
Sbjct: 446 QVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSWLAVLIA 505

Query: 483 IIIIFFQGFTAFAP-----KFDVLNFFASYISV-FLFFIFWG 518
           +  +  Q + A AP     K D   FF +Y+++  + F ++G
Sbjct: 506 LFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAMPIVLFAYFG 547

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  249 bits (637), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 162/508 (31%), Positives = 264/508 (51%), Gaps = 16/508 (3%)

Query: 32  QGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLM 91
           +  ED     +  S E+   N   E  ++++ +  RH                   + L 
Sbjct: 95  KAREDDEIMQSVASAEHRKVNNT-ESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLS 153

Query: 92  ISGPVGSLIAYLFLGTVVYSVTQSLGEMAT-FIPVTASFTIFSHRFLSPALGAANGYMYW 150
            +GP   +I Y  +G+ +Y + Q+ GEMA  +  +   F  +    L PALG +  ++Y 
Sbjct: 154 AAGPAPLVIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYC 213

Query: 151 FSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLK 210
             W     LEL      I++WT  V    ++ IF+V++   N+F  R Y E EF+    K
Sbjct: 214 LQWLCVCPLELVTASLTIKYWTTKVDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCK 273

Query: 211 VNAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINA 269
           V  ++GF I    I  G AG  G +G +YW  PG +         A  RF G   + + A
Sbjct: 274 VLMMIGFFILGIIITAGGAGNDGYLGAKYWHEPGAF-----RGEHAVDRFKGVMDTFVAA 328

Query: 270 AFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD-DVKLKS 328
           AF F  TE + +TA E +NPR+ +P A +KV++RI++ +++S+  +G LVPYD D  L S
Sbjct: 329 AFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGS 388

Query: 329 ENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPK 388
             S V +SP+++A+   G +++PH  N VIL++++S GNS  Y  SRLL  L++ G  PK
Sbjct: 389 SGSGVKASPYVLAVSLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPK 448

Query: 389 LFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHI 448
            F    + G P  A++ ++LFG +AF  TS    + F WLL + G++  F+W  I  +H+
Sbjct: 449 WFDYVDRQGRPARAMLMSALFGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHV 508

Query: 449 RFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFF 504
           RF   ++ +G S  ++ F ++   Y + YA  +MI+ +  Q + A AP    K D  NFF
Sbjct: 509 RFRYAMKVQGRSIGEVGFHSQTGVYGSLYAATMMILALMAQFWVAIAPLNEGKLDAQNFF 568

Query: 505 ASYISVFLFFIFWGSFQLWFKCRYVWKL 532
            SY+++ +    +  ++L+++    WKL
Sbjct: 569 QSYLAMPILIALYFGYKLYYR---DWKL 593

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  247 bits (630), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 166/508 (32%), Positives = 269/508 (52%), Gaps = 31/508 (6%)

Query: 24  ESLEQHDLQGNEDKNTPTTTPS---KENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXX 80
           E+  + DL   E+       PS    EN  + E +   ++ R L  R             
Sbjct: 12  ENYYKTDLSPKENHVVCELDPSFTTDENY-DPEANIREDLTRALKPRVVNMISIAGIIGT 70

Query: 81  XXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPA 140
                    L   GP    + Y  +G VVY    +LGEM+T++P++ SF +++ +F S +
Sbjct: 71  GLYLSTSKSLHTGGPASLFMNYTIMGGVVYLTLLALGEMSTYMPISGSFCVYARKFGSES 130

Query: 141 LGAANGYMYWFSWAMTFALELSVVGQIIQFW-TFAVPLPAWIS--IFWVILTISNLFPVR 197
              A  + YWF+ A++ A +L+ +  ++ +W T     P W +  IFW ++   N+  VR
Sbjct: 131 FACALMWNYWFNDAVSVASDLTALQLVMDYWKTSEHGFPYWAASLIFWFVVVCLNVIHVR 190

Query: 198 IYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP---VGFRYW-RNPGPWGTGIISSN 253
            YGE E+W+A LK+ AI+  I +   IV   GK      +GF+ W R   P+  GI    
Sbjct: 191 FYGEAEYWLAMLKIIAII--IFFILSIVVNVGKNPQHEYIGFKNWTRGEAPFVDGI---- 244

Query: 254 IAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLF 313
                  G+AS  ++A+F + GTE + +T GEA NP +  PK ++ V +RIL+FY+ S F
Sbjct: 245 ------KGFASLFVSASFAYGGTESITLTNGEAENPIRNTPKIVKTVFWRILIFYVGSTF 298

Query: 314 FIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIG 373
           FI + +PYD   L S++  + +SPF +  + +GTK      N VI+ ++ISA N  ++ G
Sbjct: 299 FIAMNIPYDYPGLDSKS--IVTSPFTLVFQMAGTKGAGSFMNAVIMTSVISACNHALFAG 356

Query: 374 SRLLFGLAKNGTGP-KLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVV 432
           SR+++ +   G  P ++ ++T ++ VP  +V+ T+  GAL F  +  G    + WL N+V
Sbjct: 357 SRIMYNMGLEGFLPARIVSRTNRNKVPYVSVLITAAVGALCFGASFIGAGTLWTWLQNIV 416

Query: 433 GVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFT 492
           GV+   +WL I    IRF + L+ +G   ++L +K    PY  Y+  I +  II  QG++
Sbjct: 417 GVSNQIAWLCIGITSIRFRKGLEKQG-KTHELIYKNWTYPYGPYFVIIFVSFIILIQGWS 475

Query: 493 AFAPKFDVLNFFASYISVFLF---FIFW 517
           AFAP ++V NFF+ Y+ +F+F   FI W
Sbjct: 476 AFAP-WNVSNFFSYYLELFVFPVCFIIW 502

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  248 bits (632), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 148/486 (30%), Positives = 258/486 (53%), Gaps = 12/486 (2%)

Query: 47  ENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLG 106
           E ++ ++  ++  +K+++  RH                     L   GP   LI Y  + 
Sbjct: 74  ERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVS 133

Query: 107 TVVYSVTQSLGEMAT-FIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVG 165
           T++Y V QS  E+A  +  ++  F  +    +  A   +  ++Y   W     LEL    
Sbjct: 134 TMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTAS 193

Query: 166 QIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIV 225
             I++W  ++   A++ IF+V+L + N      Y E EF+    KV  ++GF I    + 
Sbjct: 194 MTIKYWNDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVN 253

Query: 226 CG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAG 284
           CG AG  G +G  YW +PG +       N    RF G  + L+NAAF + G E   +TA 
Sbjct: 254 CGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAA 308

Query: 285 EAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIE 343
           E  NP++++  A +K+V+RI+  Y+++   +G LVPY+  +L  S ++   +SPF+IAI 
Sbjct: 309 EQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIA 368

Query: 344 NSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAV 403
           + G K++PHI N VIL++++S  NS +Y  SR+L  L++ G  PKLF    + G PV  +
Sbjct: 369 SHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCL 428

Query: 404 VFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRND 463
           + + +FG L F+  S   +  F WLL + G++  F+W  IS +H+RF + +  +G S ++
Sbjct: 429 LVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDE 488

Query: 464 LPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGS 519
           L +++    + AYYA I++++I+  Q + A +P    K D  NFF +Y+++ +    +  
Sbjct: 489 LGYQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLG 548

Query: 520 FQLWFK 525
           ++LW++
Sbjct: 549 YKLWYR 554

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  246 bits (627), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/527 (28%), Positives = 256/527 (48%), Gaps = 33/527 (6%)

Query: 22  STESLEQHDLQGN--EDKNTPTTTPSKENVSENEKDEYH----------EVKRDLSKRHX 69
           ST    ++D Q        +P    +K N+ +   D +            +KR L  RH 
Sbjct: 13  STSEFTKYDSQKPYYSSGESPEPVVTKRNIFQRCVDSFKPPVDGSFDTSNLKRTLKSRHL 72

Query: 70  XXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASF 129
                               L   GP+  +I +   G+ +      LGE+    PV  +F
Sbjct: 73  IMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHGLGEITVRFPVVGAF 132

Query: 130 TIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILT 189
             +S RFL P++      +Y   W     LE+      IQ+W  ++    W++IF+ ++ 
Sbjct: 133 ADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSIDPVVWVAIFYGVIV 192

Query: 190 ISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTG 248
             NLF  R +GE EF  + +K   I GFII C  ++CG G     +G +YW +PG    G
Sbjct: 193 SINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDHEFIGAKYWHDPGALAHG 252

Query: 249 IISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFY 308
                     F G  S L+ A+++  GTE+  + +GE  +P++ +P AI++V +RIL F+
Sbjct: 253 ----------FPGVLSVLVVASYSLGGTEMTCLASGET-DPKE-LPSAIKQVFWRILFFF 300

Query: 309 ILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNS 368
           + SL  +G LVPY +  L   +S V +SPF+IAI+    K LP I N VIL++I+S GNS
Sbjct: 301 LASLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKLHHIKALPSIVNAVILISILSVGNS 359

Query: 369 NVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWL 428
            ++  SR L  +A  G  P+ F    ++G P+  +V  SLFG LAF+  S+   E F WL
Sbjct: 360 CIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLVKSSSVSEVFDWL 419

Query: 429 LNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFF 488
           + + G+A    WL I+ +HIRF   ++++  + ++L F +    + + Y+ ++ ++I+  
Sbjct: 420 MAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSAYSALINVLILIA 479

Query: 489 QGFTAFAP-------KFDVLNFFASYISVFLFFIFWGSFQLWFKCRY 528
           Q + +  P             FF SY+   +  + +   +++++  +
Sbjct: 480 QFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYRVSF 526

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  246 bits (628), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 155/528 (29%), Positives = 262/528 (49%), Gaps = 31/528 (5%)

Query: 7   NTEETLE-GKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLS 65
           + E T E GK  ++  STE  +++ +Q   D   P    S +            +KR L 
Sbjct: 33  HNEYTYESGKCSLLNGSTEERKRNVVQRVIDSFKPPVDGSFDP---------SNMKRALK 83

Query: 66  KRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPV 125
            RH                     L   GP+  +I +   GT +      LGE+   +PV
Sbjct: 84  SRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGTIHGLGELTVRLPV 143

Query: 126 TASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFW 185
             +F  +S RFL P++      +Y   W     LE+      ++FWT +V    W+++F+
Sbjct: 144 VGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFWTQSVDPIIWVALFY 203

Query: 186 VILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGP 244
            ++   NL  VR +GE EF  + +KV  I GFII C  ++ G G T   VG RYW +PGP
Sbjct: 204 TMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPTHQYVGSRYWHDPGP 263

Query: 245 WGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRI 304
              G          F G A+ ++ A+++  G+E+  + +GE  +P++ +P AI+++ +RI
Sbjct: 264 LANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DPKE-LPHAIKQIFWRI 311

Query: 305 LVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIIS 364
           L F+++SL  +G LVPY +  L   +S   +SPF++A+     K++PHI NGVILV+I+S
Sbjct: 312 LFFFLVSLTLVGFLVPYTNENLLGGSS-AENSPFVLALYLHHVKVVPHIVNGVILVSILS 370

Query: 365 AGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEA 424
            GNS ++  SR L  +A  G  P +F    + G P+  ++  S+FG LAF+   +     
Sbjct: 371 VGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLAFLVKFSSISNV 430

Query: 425 FQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMII 484
           F WL+ + G+A    WL I+ +H+RF   ++++  S ++L F +    + + YA ++  +
Sbjct: 431 FSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVGVWGSVYAGVLNFL 490

Query: 485 IIFFQGFTAFAP-------KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
            +  Q + A  P       K     FF +Y+   +    + + + +F+
Sbjct: 491 TLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYFR 538

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  246 bits (627), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 151/490 (30%), Positives = 245/490 (50%), Gaps = 21/490 (4%)

Query: 46  KENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFL 105
           KE+      DE +++ + +  RH                   + L  SGP+G +I Y+  
Sbjct: 71  KEHDDSTAGDE-NDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVS 129

Query: 106 GTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVV 164
             +V+ + Q+ GE+   +  V  +FT +    + PA G A  ++Y   W +   L+L   
Sbjct: 130 SLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTA 189

Query: 165 GQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI 224
              IQFW   V L  ++   +V++ + NL   R Y E EF+    K+  + GF+I    I
Sbjct: 190 AMTIQFWNVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIII 249

Query: 225 VCGAGKTGPVGF---RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGI 281
             G    GP G+   +YWRNPG +  G          F G  S    AAF++ G E + +
Sbjct: 250 TAGGIPNGPDGYIGGKYWRNPGLFANG----------FKGVCSVFCYAAFSYGGVETLVL 299

Query: 282 TAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFII 340
           +A E  NP +++P A +KV++RIL  Y+LSL  +  LVPY    L  S  S   SSPF+I
Sbjct: 300 SAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVI 359

Query: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400
           AI + G  ++PH+ N VIL++++S  NS +Y+  RLL  LA+ G+ PK      K G P 
Sbjct: 360 AIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPT 419

Query: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460
              +   LFG + F+  S   +  F WLL++ G+   F W+ I  +HIRF   ++ +G  
Sbjct: 420 TCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHP 479

Query: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFI 515
             ++ +KA+   + +Y A  + + ++  Q + A AP     K D  NFF +Y++  +   
Sbjct: 480 LTEIAYKAQTGYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLC 539

Query: 516 FWGSFQLWFK 525
            +  F++++K
Sbjct: 540 AYLGFKVYYK 549

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  245 bits (626), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 156/468 (33%), Positives = 249/468 (53%), Gaps = 19/468 (4%)

Query: 51  ENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVY 110
           + E +   ++KRDLS RH                     L + GP    + Y   G VVY
Sbjct: 59  DPESNIREDLKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNYSIFGGVVY 118

Query: 111 SVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQF 170
                LGEM+T++P++ SF  ++ +F S +   A  + YWF+ A++ A +L+ +  ++ +
Sbjct: 119 LTMMCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDY 178

Query: 171 W-TFAVPLPAWIS--IFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG 227
           W T     P W +  +FWV + + N+  VR+YGE E+W+A LKV AI+ F I    +  G
Sbjct: 179 WKTKDHHFPYWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFILSIVVNVG 238

Query: 228 AGKTGP-VGFRYWRN-PGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGE 285
                  +GF  W +   P+  G          F G+AS  ++A+F + GTE + +T GE
Sbjct: 239 HNPEHKYIGFHNWNHGDAPFVNG----------FKGFASLFVSASFAYGGTESITLTNGE 288

Query: 286 AANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENS 345
           A NP +  PK I+ V +RIL+FY+ S FFI + VPYD   L +++  V +SPF I  + +
Sbjct: 289 ATNPVRNTPKVIKTVFWRILIFYVFSAFFIAMNVPYDYPGLATKS--VMTSPFTIVFQMA 346

Query: 346 GTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVF 405
           G+K      N VI+ ++ISA N  ++ GSR+++ ++ +G  PK   KT +   P  AV  
Sbjct: 347 GSKGAGSFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYKAPYVAVAI 406

Query: 406 TSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLP 465
           T   G L F  +  G    + WL N+VGV+   +WL I+   IRF + L+ +G   ++L 
Sbjct: 407 TWAVGGLCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQG-KTHELK 465

Query: 466 FKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLF 513
           FK    P+  Y+  + +  +I  QG++AF P +   NFF+ Y+ +F+F
Sbjct: 466 FKNWTYPWGPYFLVVFVSFVILIQGWSAFDP-WSTSNFFSVYLELFVF 512

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  245 bits (625), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 151/496 (30%), Positives = 254/496 (51%), Gaps = 26/496 (5%)

Query: 45  SKENVSENEK-----DEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSL 99
           +KE+ S+ EK      E   +++ +  RH                     +  +G  G+L
Sbjct: 5   AKEDCSDAEKLSSEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTL 64

Query: 100 IAYLFLGTVVYSVTQSLGEMATFIPVTAS-FTIFSHRFLSPALGAANGYMYWFSWAMTFA 158
           I YL +G +V    QS+GE+    P  A  F  +  +F+ P+LG    +++   W +   
Sbjct: 65  IGYLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLP 124

Query: 159 LELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFI 218
           LEL      I++W   +    ++S F++++ I N F    Y E EF    +KV  +  FI
Sbjct: 125 LELVTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFI 184

Query: 219 IYCFCIVCGA-GKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTE 277
           +    I+ G  G +GP+GF+Y + PG + T   + N+    F   A +L+NAAF+  G E
Sbjct: 185 VLGIVIITGGLGNSGPIGFQYLKTPGAFNT---NYNV----FKATAGTLVNAAFSCGGVE 237

Query: 278 LVGITAGEAANPRQTVPKAIRK----VVFRILVFYILSLFFIGLLVPYDDVKLKSENSYV 333
            + ++A E    R  +PK+IR+    V  R+ VFY+LS+  +GLLVPYD   L    S  
Sbjct: 238 FLALSAAE--QNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDT 295

Query: 334 S-SSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAK 392
           + +SP++ AI   G +I+PHI N VIL+ ++S  NS +Y  SR L  LA+    P+ FA 
Sbjct: 296 THTSPYVAAIALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFAL 355

Query: 393 TTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQ 452
             K G P+  +V +++ G ++F+      +  F WLL++ G++  F+W  I  AHIRF  
Sbjct: 356 LNKHGQPMRCLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRN 415

Query: 453 CLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVLNFFASY 507
            L+ +G S + L +++      +Y AT + +++I  Q + +  P     K D + FF +Y
Sbjct: 416 ALKLQGQSLDTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNY 475

Query: 508 ISVFLFFIFWGSFQLW 523
           ++V +  + +   +L+
Sbjct: 476 MAVPVAVLLYLGHKLY 491

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  245 bits (626), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 146/510 (28%), Positives = 263/510 (51%), Gaps = 20/510 (3%)

Query: 35  EDKNTPTTTPSKENVSENE-----KDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNP 89
           E + T T +P    + E++     K+E   +++ +  RH                   + 
Sbjct: 97  ETELTTTLSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSA 156

Query: 90  LMISGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYM 148
           L  +GP G +I Y  +GT +Y + Q+ GEMA ++  +  +F  +    +    G A  ++
Sbjct: 157 LHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWV 216

Query: 149 YWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAF 208
           Y   W     LEL      I +WT  V    ++ IF+V++ + N+F  + Y E +F+   
Sbjct: 217 YCIQWLCVMPLELVTASMTIDYWTTKVNNDIFVVIFYVLIILINVFGAKGYAEADFFFNT 276

Query: 209 LKVNAILGFIIYCFCI-VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLI 267
            KV  I GF I    I   GAG +G +G +YW +PG +       + +  RF    ++  
Sbjct: 277 CKVLMITGFFILAIIINAGGAGTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMATFT 331

Query: 268 NAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLK 327
            AAF F  +E + I A E +NPR+ +P A + +++RIL  ++ S+  +G LVPYD  +L 
Sbjct: 332 TAAFAFGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM 391

Query: 328 SENSY-VSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTG 386
              S    +SP+++AI + G +++PH  N VIL+ ++S  NS  Y   R+LF L++ G  
Sbjct: 392 GSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYA 451

Query: 387 PKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFA 446
           P+ F    + G P  A++ + LFG +AF   S+  +E F WLL + G++  F+W+ I  +
Sbjct: 452 PQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLS 511

Query: 447 HIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLN 502
           HIRF + +  +G S ++L F+++   + + YA  ++ + +  + + + AP      D  +
Sbjct: 512 HIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKS 571

Query: 503 FFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
           FF +Y+++ +  +F+  ++++ +    WKL
Sbjct: 572 FFENYLAMPILIVFYFGYKIYNR---DWKL 598

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  243 bits (620), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 154/513 (30%), Positives = 264/513 (51%), Gaps = 24/513 (4%)

Query: 20  IKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXX 79
           IK       +D+ G+ D+ + +     EN    +K     + R L  RH           
Sbjct: 23  IKEQAFSSVNDVIGDSDQGSYSDI---ENFKPPQK-----IVRGLKTRHIQLIALGSAIG 74

Query: 80  XXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFS--HRFL 137
                     L + GP   LIAY+ +   V+S+   + EM   IP+    +++S    +L
Sbjct: 75  TGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTEMVCLIPLPGEASLYSLAKTYL 134

Query: 138 SPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVR 197
           +  +    G+  +++ AM    E++    ++Q+WT A     +ISIF V+  +  + PV+
Sbjct: 135 NSPISFMCGWNLFYAMAMIVPAEITACALLVQYWTDANS-AIFISIFIVVSILLTMLPVK 193

Query: 198 IYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG--KTGPVGFRYWRNPGPWGTGIISSNIA 255
           ++GE EFW++ +K+  I+G II    I  G G  +   +GF YW+NPG +   +   N  
Sbjct: 194 VFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVLGFHYWKNPGAFNPHLAEGN-- 251

Query: 256 EARFLGWASSLINAAFTFQGT-ELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFF 314
             RFL   +++I + F+F    E V   + E   PR+ +PKA ++ ++R+ +FYI+    
Sbjct: 252 TGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLV 311

Query: 315 IGLLVPYDDVKL----KSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNV 370
           +G++V +++ +L    +S  S  ++SPF+I I+ +G KILPHI N  IL +  S G   +
Sbjct: 312 VGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLL 371

Query: 371 YIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLN 430
           Y  SR L+ +A  G  PK+FAK  + G P ++    SLF  LA++  S      F WL N
Sbjct: 372 YGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSN 431

Query: 431 VVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQG 490
           +  ++GF SW+ +S  +IRF + + +  ++ + +PF+  F   LAY       I+    G
Sbjct: 432 IATISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRRPFQVPLAYLTCGFFFILSLTNG 490

Query: 491 FTAFAP-KFDVLNFFASYISV-FLFFIFW-GSF 520
           +  F    ++V +FFASY+++ F+ F++  GSF
Sbjct: 491 YAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSF 523

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  244 bits (622), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 143/453 (31%), Positives = 240/453 (52%), Gaps = 26/453 (5%)

Query: 93  SGPVGSLIAYLFLGTVVYSVTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWF 151
           SGP G +I Y     ++Y V Q+ GE+   +  +T ++T +    + PA+G A   +Y  
Sbjct: 139 SGPAGLVIGYGVASIMIYCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTL 198

Query: 152 SWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKV 211
            W     L+L      I++WT  V    +++   V++   N+F  + Y E EF+    K+
Sbjct: 199 QWLTVLPLQLVTAAMTIRYWTTNVNPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKL 258

Query: 212 NAILGFIIYCFCIVCG-AGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAA 270
             + GF+I    I CG AG    +G +YW+ PG +  G          F G A+    AA
Sbjct: 259 LMMAGFVILGIVINCGGAGDKEYIGVKYWQTPGAFANG----------FKGVAAVFCYAA 308

Query: 271 FTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSEN 330
           F++ G E++ +TA E ANPR+ +P A RKVV+R+L  Y+L+   +  LVPY+   L   N
Sbjct: 309 FSYGGIEVLVLTANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSN 368

Query: 331 ---SYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGP 387
              S   +SPF+IA+ + G +++PHI N  IL+++IS  NS++Y G RLL  L++ G  P
Sbjct: 369 NDGSGSDASPFVIAVASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAP 428

Query: 388 KLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAH 447
           K F    + G P+  V+ +   G +AF+      +E F WLL V G++  F W+ I+ +H
Sbjct: 429 KCFNYIDRRGRPIICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISH 488

Query: 448 IRFMQCLQSR--GI-SRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFD 499
           +RF   ++S+  G+ +R+ + + A+     +  A  + I I+  Q + A AP     + D
Sbjct: 489 LRFRDAIRSQLGGLRARDVVEYTAQTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLD 548

Query: 500 VLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532
           V  FF +Y++  +    + ++++W +    W+L
Sbjct: 549 VQIFFENYLAAPVLLGGYLAYKIWHR---DWRL 578

>KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {ON}
           similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W Lysine permease; one of three amino acid
           permeases (Alp1p, Can1p, Lyp1p) responsible for uptake
           of cationic amino acids
          Length = 543

 Score =  241 bits (616), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 169/494 (34%), Positives = 257/494 (52%), Gaps = 20/494 (4%)

Query: 42  TTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIA 101
           ++ +++  + N       + R L+ RH                     L   GP   LI 
Sbjct: 21  SSDTQDAGALNRGHVRENLNRSLTPRHINMISIAGVIGTGLYLGTGKALANGGPASLLIN 80

Query: 102 YLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALEL 161
           Y  +G VVY +   LGEM+TF+P++ SF  ++ +F S +L       YWF+ A++ A +L
Sbjct: 81  YGIIGLVVYLIMLCLGEMSTFMPISGSFCSYAKKFGSGSLAFTLMCNYWFNDAVSVASDL 140

Query: 162 SVVGQIIQFWTFA-VPLPAWIS--IFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFI 218
           + +  I+ +W       P W +  IFW  L + N+  VR+YGE E+W+A LKV AI+ F 
Sbjct: 141 TALQLILDYWKNPNSHFPYWAASLIFWFALLLLNVVHVRVYGEAEYWLALLKVIAIIMFF 200

Query: 219 IYCFCIVCGAGKTGP-VGFRYWR-NPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGT 276
           I    +  G       +GF+ W     P+  G          F G+AS  ++++F F GT
Sbjct: 201 IISIIVNAGHNSDHAYIGFKNWGVGDAPFVNG----------FKGFASLFVSSSFAFGGT 250

Query: 277 ELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSS 336
           E + +TAGEA NP +  PK I+ V +RIL+FY+ + FFIG+ VPY+   L SE S V +S
Sbjct: 251 ESITLTAGEAVNPVRNTPKIIKTVFWRILIFYVFTAFFIGMNVPYNYPNL-SEKS-VMTS 308

Query: 337 PFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGT-GPKLFAKTTK 395
           PF I  +  G++      N VIL ++ISAGN  ++ GSR+LF +   G   P    KT +
Sbjct: 309 PFTIVFQMVGSRGAGSFMNAVILTSVISAGNHALFAGSRVLFNIGLEGYFFPSFITKTNR 368

Query: 396 SGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQ 455
             VP  AV+ T   G L F  +  G    + WL N+VGV+   +WL IS   IRF + L 
Sbjct: 369 YQVPYVAVLITWAAGGLCFGSSFIGAGTLWTWLQNIVGVSNQLAWLCISVISIRFRRGLA 428

Query: 456 SRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFI 515
            +G   ++L F     PY  Y+  + +  IIF QG+++FAP + V +FF+ YI + +F  
Sbjct: 429 RQG-KTHELQFVNWTYPYGPYFLVVFVTFIIFVQGWSSFAP-WSVSDFFSYYIELIVFVA 486

Query: 516 FWGSFQLWFKCRYV 529
            +  + LW +  +V
Sbjct: 487 LYAFWWLWKRDSFV 500

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  244 bits (622), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 159/549 (28%), Positives = 265/549 (48%), Gaps = 42/549 (7%)

Query: 7   NTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKE---NVSENEKDEYHE---- 59
           NT    E ++K+V +  +S ++        ++ PT   SKE   N     K  + E    
Sbjct: 48  NTSIESEPRTKLVHRFVDSFKRA-------QDVPTGRKSKEIGNNGGSKTKGGFEEDSLD 100

Query: 60  --------------VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFL 105
                         +K+ +  RH                     L   GP   +I Y+ +
Sbjct: 101 LEGSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLV 160

Query: 106 GTVVYSVTQSLGEMATFIP-VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVV 164
             V Y + Q+ GEMA   P +  +F  +S  F+S A G A  +++   W     LEL   
Sbjct: 161 SFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELITA 220

Query: 165 GQIIQFWTFAVPLPAWISIFWVILTISNLFP-VRIYGEIEFWIAFLKVNAILGFIIYCFC 223
              I++W   +    +I IF+V L   +LF  V  YGE EF     K+  ++GFII    
Sbjct: 221 SLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMSIV 280

Query: 224 I-VCGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGIT 282
           I   GAG    +G ++W +PG +     +   A +RF G    L++  F++ GTEL  ++
Sbjct: 281 INAGGAGNREYIGGKFWHDPGAF-----AGKTAGSRFKGICYVLVSGYFSYGGTELFALS 335

Query: 283 AGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD-DVKLKSENSYVSSSPFIIA 341
             E +NPR++ P+A +  ++RIL+ Y+L++  IG  VPYD D  + S  S   +SP+++A
Sbjct: 336 VNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHASPYVLA 395

Query: 342 IENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVF 401
              +G KI PH  N VIL+++IS  NS++Y   RL+  LA+ G  PK      + G P+ 
Sbjct: 396 ASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLL 455

Query: 402 AVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISR 461
           A++   L G + F+  S   +E F WL  + G++  F+W  I  +H+RF   ++ +  S 
Sbjct: 456 ALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSL 515

Query: 462 NDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIF 516
            +L +KA    Y + Y     +++   Q +TA  P     K +  +FFA+Y+++ ++ +F
Sbjct: 516 EELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVF 575

Query: 517 WGSFQLWFK 525
           +  + LW +
Sbjct: 576 YFGYMLWTR 584

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  241 bits (616), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 156/511 (30%), Positives = 260/511 (50%), Gaps = 23/511 (4%)

Query: 35  EDKNTPTTTPSKENVSENEKDEYHEVK----RDLSKRHXXXXXXXXXXXXXXXXXXXNPL 90
           ++K   +   + + VS+    +    K    R L  RH                     L
Sbjct: 22  KEKTQFSIHSTGDEVSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGAL 81

Query: 91  MISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFS--HRFLSPALGAANGYM 148
            I GP   LIAY  +   V+SV   + EM T IP+    T++S    +++  L    G+ 
Sbjct: 82  SICGPAPLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWN 141

Query: 149 YWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAF 208
            +++ AM    E++    ++Q+WT A P   +ISIF V+     + PV+++GE EFW++ 
Sbjct: 142 LFYAQAMIAPAEVTACALLVQYWTDANP-AIFISIFLVLSVAITMLPVKVFGESEFWVSS 200

Query: 209 LKVNAILGFIIYCFCIVCGAG--KTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSL 266
           +K+  I+G II    I  G G  +   +GF YW+ PG +   ++       +FL + +++
Sbjct: 201 IKILTIVGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKPYLVEG--GTGKFLAFWTAI 258

Query: 267 INAAFTFQGT-ELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVK 325
           I + F+F    E+V   A EA  PR+ +P+A ++ ++R+ +FY+  +  +G++V YD+ +
Sbjct: 259 IKSGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDR 318

Query: 326 LKSENSYVSSS----PFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLA 381
           L +  +   SS    PF+I I+ +G ++LPHI N  IL +  S G   +Y  SR L  +A
Sbjct: 319 LLNAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMA 378

Query: 382 KNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWL 441
             G  P++     K GVP +    TSLF  LA++  S      F WL N+  ++GF SW+
Sbjct: 379 CKGDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWV 438

Query: 442 LISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP-KFDV 500
           L+S A+IRF   +    ++ + +PF+  +   LAY A     I+    GF  F    +D 
Sbjct: 439 LVSIAYIRFRNVIDVLKLN-DRIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDT 497

Query: 501 LNFFASYISV-FLFFIFWGS---FQLWFKCR 527
            NFFA+YI++ F+  +F GS   ++ W +CR
Sbjct: 498 SNFFAAYITLGFVLVLFVGSTIYYKEW-RCR 527

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  242 bits (618), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 149/482 (30%), Positives = 242/482 (50%), Gaps = 21/482 (4%)

Query: 51  ENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVY 110
           E+   +   +K+ L  RH                     L   GP+  +I +   G+ + 
Sbjct: 77  EDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQII 136

Query: 111 SVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQF 170
                LGE+    PV  +F  +S RFL P++      +Y   W     LE+      +Q+
Sbjct: 137 GTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQY 196

Query: 171 WTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGK 230
           W  ++    W++IF+V +   NLF VR +GE EF  + +KV  I GFI+ C  ++ G G 
Sbjct: 197 WNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGGP 256

Query: 231 TGP-VGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANP 289
               VG RYW NPG    G          F G  S ++ A+++  GTE+  + +GE  +P
Sbjct: 257 DHVYVGSRYWHNPGCLANG----------FPGVLSVMVVASYSLGGTEMTCLASGET-DP 305

Query: 290 RQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKI 349
           ++ +P AI++V +RIL F+++SL  +G LVPY +  L   +S V +SPF+IAI+    K+
Sbjct: 306 KE-LPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKIHHIKV 363

Query: 350 LPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLF 409
           LP I N VIL++I+S GNS ++  SR L  +A     P  F    ++G P+  ++  SLF
Sbjct: 364 LPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLF 423

Query: 410 GALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAK 469
           G LAF+  S    E F WL+ + G+A    WL I+ +HIRF   ++++G S N+L F + 
Sbjct: 424 GLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSA 483

Query: 470 FMPYLAYYATIVMIIIIFFQGFTAFAP-------KFDVLNFFASYISVFLFFIFWGSFQL 522
              + + Y+ I+  +I+  Q + +  P       +     FF SY+   +    W   ++
Sbjct: 484 VGIWGSVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCIWIGHKI 543

Query: 523 WF 524
           ++
Sbjct: 544 YY 545

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  242 bits (617), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 142/482 (29%), Positives = 242/482 (50%), Gaps = 13/482 (2%)

Query: 52  NEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYS 111
           N       +K+ +  RH                     L ++GP   +I Y  +  + Y 
Sbjct: 69  NSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYF 128

Query: 112 VTQSLGEMATFIP-VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQF 170
           V Q+ GEMA   P +   F  ++  F+S   G A  +++   W     LEL      I++
Sbjct: 129 VIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKY 188

Query: 171 WTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AG 229
           W   +    ++ I +V L   + F VR YGE EF     K+  I GF+I    + CG AG
Sbjct: 189 WNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAG 248

Query: 230 KTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANP 289
             G +G +YWR+PG +     +S+ A +RF G A  L+ A F++ G EL  ++  E  NP
Sbjct: 249 VDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENP 303

Query: 290 RQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD-DVKLKSENSYVSSSPFIIAIENSGTK 348
           R++ P A ++ ++RIL+ Y+L++  IG  VP++ D  + +  S   +SP+++A+   G K
Sbjct: 304 RRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVK 363

Query: 349 ILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSL 408
           ++PHI N VIL+++ S  NS +Y   RLL  LA+ G  PK F    + G P+ A++  S+
Sbjct: 364 VVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSI 423

Query: 409 FGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKA 468
           FG +AF   S   +  F WL  + G++  F+W  I  +H+RF   ++++G S N+L + +
Sbjct: 424 FGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYIS 483

Query: 469 KFMPYLAYYATIVMIIIIFFQGFTAFAPK-----FDVLNFFASYISVFLFFIFWGSFQLW 523
               + + Y     +++   Q + A +P      +    FF SY++  ++  F+  + L+
Sbjct: 484 ITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLY 543

Query: 524 FK 525
            +
Sbjct: 544 SR 545

>YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}
           TAT1Amino acid transport protein for valine, leucine,
           isoleucine, and tyrosine, low-affinity tryptophan and
           histidine transporter; overexpression confers FK506 and
           FTY720 resistance
          Length = 619

 Score =  243 bits (619), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 158/543 (29%), Positives = 270/543 (49%), Gaps = 38/543 (6%)

Query: 9   EETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTT-----------------PSKENVSE 51
           E T   K K     TE  ++   Q  E + T + +                 P   N SE
Sbjct: 23  ERTHSEKQKRDFTITEKQDEVSGQTAEPRRTDSKSILQRKCKEFFDSFKRQLPPDRN-SE 81

Query: 52  NEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYS 111
            E  E + + + +  RH                     L  +GP G ++ Y     ++Y 
Sbjct: 82  LESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYC 141

Query: 112 VTQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQF 170
           + Q+ GE+   +  +T ++T +    + P+LG A   +Y   W     L+L      +++
Sbjct: 142 IIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKY 201

Query: 171 WTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AG 229
           WT +V    ++++ +V + I NLF  R Y E EF     K+  ++GF+I    I CG AG
Sbjct: 202 WT-SVNADIFVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILAIIINCGGAG 260

Query: 230 KTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANP 289
               +G  YW NPGP+  G          F G  +    AAF++ G E++ ++A E  NP
Sbjct: 261 DRRYIGAEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENP 310

Query: 290 RQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL--KSENSYVSSSPFIIAIENSGT 347
            +++P A +KVV+RIL+ Y+L+   +  LVPY+  +L   S++S   +SPF+IA+ + G 
Sbjct: 311 TKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGV 370

Query: 348 KILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTS 407
           K++PH  N VIL+++IS  NS++Y G RLL  LA+ G  PK  A   ++G P+     + 
Sbjct: 371 KVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSL 430

Query: 408 LFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFK 467
           +FG + F+ TS   ++ F WLL +  ++  F W+ +S +HIRF   +  +G S N++ +K
Sbjct: 431 VFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYK 490

Query: 468 AKFMPYLAYYATIVMIIIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQL 522
           A+   + ++ A ++ I  +  Q + A AP     K +V  FF +Y+++ +    +   ++
Sbjct: 491 AQTGYWGSWLAVLIAIFFLVCQFWVAIAPVNEHGKLNVKVFFQNYLAMPIVLFAYFGHKI 550

Query: 523 WFK 525
           +FK
Sbjct: 551 YFK 553

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  241 bits (614), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 154/536 (28%), Positives = 259/536 (48%), Gaps = 26/536 (4%)

Query: 2   SILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVK 61
           SI+  N+  +  G SK        ++ +        +   +   ++ ++    D   + K
Sbjct: 21  SIVSANSYNSSAGNSKTRGYFRNFIDSYKRADPSQLHNARSEDVEDGIASIRSDT--QFK 78

Query: 62  RDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMAT 121
           + LS RH                     L   GP   +I Y+ +  V Y + Q+ GEMA 
Sbjct: 79  KSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYVLVSFVTYFMIQAAGEMAV 138

Query: 122 FIP-VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAW 180
             P +  +F  +   F+S + G A  +++   W     LEL      I++W   +    +
Sbjct: 139 AYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELITSSLTIKYWNDKINADIF 198

Query: 181 ISIFWVILTISNLFP-VRIYGEIEFWIAFLKVNAILGFIIYCFCI-VCGAGKTGPVGFRY 238
           + IF+V L   +L   +R YGE EF     K+  ++GFII    I   GAG  G +G +Y
Sbjct: 199 VMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILSIVINAGGAGNDGYIGGKY 258

Query: 239 WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIR 298
           W  PG +  G      A +RF G    L++  F++ GTEL  ++  E A PR+  P A +
Sbjct: 259 WHEPGSFAEGD-----ATSRFKGICLVLVSGYFSYGGTELYVLSVNEQAEPRKATPAAAK 313

Query: 299 KVVFRILVFYILSLFFIGLLVPYDDVKL-KSENSYVSSSPFIIAIENSGTKILPHIFNGV 357
           K ++RIL+ Y+L++  IG  VP+++ +L  +  S   +SP+++A    G KI+PH  N V
Sbjct: 314 KSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHASPYVLAATIHGVKIVPHFINAV 373

Query: 358 ILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMET 417
           IL+++IS  NS+++ G RLL  LA  G  PK+ +   + G P+ A+  + L G +AF+  
Sbjct: 374 ILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRPLVALGISFLIGLIAFVSC 433

Query: 418 STGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYY 477
           ++  +E F WL  + G++  F+W  I F+H+RF   ++ +G   N+L +KA    + + Y
Sbjct: 434 TSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDINELGYKANTGVWGSAY 493

Query: 478 ATIVMIIIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLWFKCRY 528
                ++++  Q + A AP     K D   FF SY+          +F +W  C +
Sbjct: 494 GAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESYL----------AFPIWVACYF 539

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  240 bits (613), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 143/480 (29%), Positives = 241/480 (50%), Gaps = 21/480 (4%)

Query: 56  EYHEVKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQS 115
           +   +KR L  RH                     +   GP+G +I +   G+ +      
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHG 133

Query: 116 LGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAV 175
           LGE+    PV  +F  +  RFL P++      +Y   W     LE+      +Q+W  ++
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 176 PLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-V 234
               W++IF+ ++   NLF VR +GE EF  + +K   + GFII C  ++CG G     +
Sbjct: 194 DPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFI 253

Query: 235 GFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVP 294
           G +YW +PG    G          F G  S L+ A+++  G E+  + +GE  +P+  +P
Sbjct: 254 GAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DPK-GLP 301

Query: 295 KAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIF 354
            AI++V +RIL F+++SL  +G LVPY +  L   +S V +SPF+IAI+    K LP I 
Sbjct: 302 SAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKALPSIV 360

Query: 355 NGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAF 414
           N VIL++++S GNS ++  SR L  +A  G  P  F    ++G P+  ++  SLFG LAF
Sbjct: 361 NAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAF 420

Query: 415 METSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYL 474
           +  S    E F WL+ + G+A    WL I+ +HIRF   ++++G S ++L F +    + 
Sbjct: 421 LVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWG 480

Query: 475 AYYATIVMIIIIFFQGFTAFAP-------KFDVLNFFASYISVFLFFIFWGSFQLWFKCR 527
           + Y+ ++  +I+  Q + +  P       K     FF +Y+   +    +   ++++KC+
Sbjct: 481 SAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIYYKCQ 540

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  239 bits (611), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 150/510 (29%), Positives = 263/510 (51%), Gaps = 18/510 (3%)

Query: 26  LEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHXXXXXXXXXXXXXXXXX 85
           L + D  G E  +  +     E      + +   +++ +  RH                 
Sbjct: 8   LCKKDASGAEADSVESVAEDVE-AGAGVQGKKEVLRQSIRPRHVFMISMATGIGTGLLVG 66

Query: 86  XXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIP-VTASFTIFSHRFLSPALGAA 144
               +  +G  G+LI Y  +G ++    QS+GE+    P ++  F  +  RF+ P+LG +
Sbjct: 67  NGKSIACAGIGGTLIGYGIIGVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFS 126

Query: 145 NGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEF 204
             +++   W +   LEL      I++W  ++    ++S+F+ ++ + N F    Y E EF
Sbjct: 127 VSWLFCLQWMIVLPLELVTGSMTIKYWNASLSPSLFVSVFYALICVVNSFGSGGYAEAEF 186

Query: 205 WIAFLKVNAILGFIIYCFCIVCGA-GKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWA 263
               LKV  I+GFII    I  G  G +G +GFRY  +PG +     + NI +A     A
Sbjct: 187 IFNSLKVVVIIGFIILGVLIDTGCVGTSGTIGFRYLIDPGMFNK---NYNIIKAT----A 239

Query: 264 SSLINAAFTFQGTELVGITAGEA--ANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPY 321
            +L+NAAF+  G E + ++A E    N  +++ +A  +V  RI VFY+LS+  +GLLVP+
Sbjct: 240 GTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPH 299

Query: 322 DD-VKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGL 380
           +  + + S ++ + SSP++ A+  +G  ++PHI N VIL+ +IS  NS +Y  SR L  L
Sbjct: 300 NSPILMGSGSNMIHSSPYVAAVAMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSL 359

Query: 381 AKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSW 440
           A+    PK F K  K G P+  +  ++LFG ++F+      +  F WLL++ G++  F+W
Sbjct: 360 AEQNFAPKYFTKLNKHGQPMRCLFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTW 419

Query: 441 LLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAFAP---- 496
             I  AHIRF   ++SRG S   L +K+      +Y AT++ ++I+  Q + +  P    
Sbjct: 420 TTICIAHIRFRDAIKSRGQSLETLGYKSITGVAGSYIATVINLVILVVQFWVSLFPLESN 479

Query: 497 -KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
            K +++ FF +Y++V +  +F+   +++ K
Sbjct: 480 GKPNIVQFFQNYMAVPVALLFYIGHKVYTK 509

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  239 bits (610), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 150/511 (29%), Positives = 254/511 (49%), Gaps = 29/511 (5%)

Query: 13  EGKSKIVIKS---TESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRHX 69
           +G S + +K    TES+++ DL+           PS            H+++R L  RH 
Sbjct: 21  QGASDMKVKENFVTESIQEDDLERGSIDVLIDEKPS------------HQMQRGLKSRHM 68

Query: 70  XXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPV--TA 127
                               L   GP   LI+Y+ +   V+++   L EM    P+   A
Sbjct: 69  QLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTEMVVLTPIPGEA 128

Query: 128 SFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVI 187
           S    +  +L+  L    G+  +++ AM    E++    +IQ+WT A     ++SIF VI
Sbjct: 129 SMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWTDANS-AIFVSIFIVI 187

Query: 188 LTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG--KTGPVGFRYWRNPGPW 245
                  PV+++GE EFW++ +K+  I G II    I  G G  +   +GF YW++PG +
Sbjct: 188 TIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAF 247

Query: 246 GTGIISSNIAEARFLGWASSLINAAFTF-QGTELVGITAGEAANPRQTVPKAIRKVVFRI 304
              I + N    +FL   +++I + F F    E +   + EA  PR+ +P+A  + V+R+
Sbjct: 248 KPHISTGN--TGKFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNMPRAANRFVWRL 305

Query: 305 LVFYILSLFFIGLLVPYDDVKL----KSENSYVSSSPFIIAIENSGTKILPHIFNGVILV 360
           ++FYI     +G+ V YD+  L     S  S  ++SPF+I I+  G K+LPHI N  IL 
Sbjct: 306 MLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKVLPHIINAAILT 365

Query: 361 TIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTG 420
              SAG + +Y  SR+L  +A  G  PK+FA+  + GVP ++++  S F  LA++  S  
Sbjct: 366 GAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNS 425

Query: 421 GDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATI 480
             + F WL N+  ++GF SW+ +S  ++RF + +    ++ + + F+  F    AY++  
Sbjct: 426 ASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLN-DRIKFRKPFQRIFAYFSGC 484

Query: 481 VMIIIIFFQGFTAFAP-KFDVLNFFASYISV 510
             +I+    G+  F    + V +FFA+YI++
Sbjct: 485 FFVILSLTNGYAVFTKGNWSVSDFFANYITI 515

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  240 bits (612), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 141/474 (29%), Positives = 246/474 (51%), Gaps = 14/474 (2%)

Query: 60  VKRDLSKRHXXXXXXXXXXXXXXXXXXXNPLMISGPVGSLIAYLFLGTVVYSVTQSLGEM 119
           +K+ L  RH                     L   GP   +I Y+ +  +VY + Q+ GEM
Sbjct: 90  MKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEM 149

Query: 120 ATFIP-VTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178
           A   P +  +F  +   F+S + G A  +++   W     LEL      IQ+WT  +   
Sbjct: 150 AVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYWT-DLNGD 208

Query: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFR 237
            ++ IF+V L + +   V+ YGE EF     K+  I GFII+   + CG AG  G +G +
Sbjct: 209 IFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIGGK 268

Query: 238 YWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAI 297
           YW  PG +  G  +S     RF G    L+   F++ GTEL  ++  E A PR+  P A 
Sbjct: 269 YWHTPGSFAEGGPTS-----RFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPAAA 323

Query: 298 RKVVFRILVFYILSLFFIGLLVPYD-DVKLKSENSYVSSSPFIIAIENSGTKILPHIFNG 356
           +K ++RILV Y+L++  IG  VP++ D  + +  S   +SP+++A    G K++PHI N 
Sbjct: 324 KKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIHGVKVVPHIINA 383

Query: 357 VILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFME 416
           VIL++++S  NS++Y   RLL  LA+ G  PK      + G P+ A++  ++FG +AF+ 
Sbjct: 384 VILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGCIAFVA 443

Query: 417 TSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAY 476
           +S   ++ F WL  + G++  F+W  I F+H+RF   ++ +    +++ +KA    Y ++
Sbjct: 444 SSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATAGIYGSW 503

Query: 477 YATIVMIIIIFFQGFTAFAP-----KFDVLNFFASYISVFLFFIFWGSFQLWFK 525
           + +I  ++++  Q + A +P          +FF +Y+++ ++  F+  + ++ K
Sbjct: 504 FGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYNK 557

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.141    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,708,526
Number of extensions: 2261131
Number of successful extensions: 12607
Number of sequences better than 10.0: 406
Number of HSP's gapped: 11474
Number of HSP's successfully gapped: 428
Length of query: 566
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 451
Effective length of database: 40,294,809
Effective search space: 18172958859
Effective search space used: 18172958859
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)