Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F028202.151ON1281286742e-92
NCAS0G024702.151ON88942815e-33
KNAG0I021302.151ON92952763e-32
CAGL0L04070g2.151ON95802661e-30
KAFR0J020902.151ON92862651e-30
KLLA0F24068g2.151ON95792633e-30
SAKL0E10978g2.151ON95692591e-29
Skud_14.2102.151ON103762572e-29
Smik_14.2062.151ON113692566e-29
YNL122C2.151ON115782557e-29
Suva_14.2182.151ON112692558e-29
ZYRO0G06490g2.151ON92692493e-28
TDEL0B051302.151ON93932494e-28
ABR133W2.151ON96692346e-26
KLTH0B05214g2.151ON91672321e-25
Kwal_33.147622.151ON91652294e-25
Ecym_82022.151ON98682201e-23
Kpol_505.212.151ON85812121e-22
TPHA0F018802.151ON99691965e-20
TBLA0B012302.151ON97671748e-17
Kpol_2001.11.253ON176851750.10
YMR031C (EIS1)2.590ON843108652.6
TDEL0F014402.191ON1620120643.0
TDEL0D044803.175ON126839643.0
TDEL0A004503.26ON42263617.4
Skud_4.2303.175ON129460618.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F02820
         (128 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.15...   264   2e-92
NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}...   112   5e-33
KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151...   110   3e-32
CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly ...   107   1e-30
KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.15...   106   1e-30
KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} simila...   105   3e-30
SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some sim...   104   1e-29
Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309...   103   2e-29
Smik_14.206 Chr14 complement(377692..377997,378001..378009,37801...   103   6e-29
YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON} P...   102   7e-29
Suva_14.218 Chr14 complement(394669..394965,394969..394983,39499...   102   8e-29
ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON...   100   3e-28
TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}...   100   4e-28
ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homo...    95   6e-26
KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some sim...    94   1e-25
Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON...    93   4e-25
Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON} s...    89   1e-23
Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..570...    86   1e-22
TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151...    80   5e-20
TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}...    72   8e-17
Kpol_2001.1 s2001 (2062..7368) [5307 bp, 1768 aa] {ON} (2062..73...    33   0.10 
YMR031C Chr13 complement(332212..334743) [2532 bp, 843 aa] {ON} ...    30   2.6  
TDEL0F01440 Chr6 (255662..260524) [4863 bp, 1620 aa] {ON} Anc_2....    29   3.0  
TDEL0D04480 Chr4 (818876..822682) [3807 bp, 1268 aa] {ON} Anc_3....    29   3.0  
TDEL0A00450 Chr1 complement(80330..81598) [1269 bp, 422 aa] {ON}...    28   7.4  
Skud_4.230 Chr4 complement(410772..414656) [3885 bp, 1294 aa] {O...    28   8.1  

>NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.151
           YNL122C
          Length = 128

 Score =  264 bits (674), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 128/128 (100%), Positives = 128/128 (100%)

Query: 1   MENHTNHLGSLIYLASNIRYFQGNPKSYNLTPDMFTVSSMSSLFKTGLLSMGLKGQSFNS 60
           MENHTNHLGSLIYLASNIRYFQGNPKSYNLTPDMFTVSSMSSLFKTGLLSMGLKGQSFNS
Sbjct: 1   MENHTNHLGSLIYLASNIRYFQGNPKSYNLTPDMFTVSSMSSLFKTGLLSMGLKGQSFNS 60

Query: 61  LVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVKH 120
           LVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVKH
Sbjct: 61  LVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVKH 120

Query: 121 LKRMLPYH 128
           LKRMLPYH
Sbjct: 121 LKRMLPYH 128

>NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}
           Anc_2.151 YNL122C
          Length = 88

 Score =  112 bits (281), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 7/94 (7%)

Query: 34  MFTVSSMSSLFKTGLLSMGLKGQSFNSLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRN 93
           M   S + + ++   L++        +L ITRNLMKTHKG AKRWR++AQ FKRGIAGRN
Sbjct: 1   MLPFSFLPTFYRARCLNL-------TTLTITRNLMKTHKGTAKRWRRTAQSFKRGIAGRN 53

Query: 94  HGNVGWSHRYLNKLTGRKEADPTHVKHLKRMLPY 127
           HGN GWS R L  L+GRK+ADP++++HLKR++PY
Sbjct: 54  HGNAGWSRRSLKHLSGRKDADPSYLRHLKRLMPY 87

>KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151
           YNL122C
          Length = 92

 Score =  110 bits (276), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 54/95 (56%), Positives = 69/95 (72%), Gaps = 3/95 (3%)

Query: 34  MFTVSSMSSLFKTGLLSMGLKGQSFNSLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRN 93
           M  +S++S LFK G  +  +   S   +++TR+LMKTHKGAAKRWRK+A GFKRGI+GR 
Sbjct: 1   MSFLSALSPLFKNGFAAWKIPSAS---MIVTRSLMKTHKGAAKRWRKNANGFKRGISGRK 57

Query: 94  HGNVGWSHRYLNKLTGRKEADPTHVKHLKRMLPYH 128
           HGN GWS R L  LTGR EA  + +K LK++LPYH
Sbjct: 58  HGNCGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92

>CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly
           similar to uniprot|P53921 Saccharomyces cerevisiae
           YNL122c
          Length = 95

 Score =  107 bits (266), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%)

Query: 48  LLSMGLKGQSFNSLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKL 107
           LLSM   G S   +V  R LMKTH+GA KRWR+++ GFKRGIAGR HGN+GWSHR L  L
Sbjct: 15  LLSMKTMGVSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSL 74

Query: 108 TGRKEADPTHVKHLKRMLPY 127
           TGR +A PT +K L+R++PY
Sbjct: 75  TGRTDAHPTQMKRLRRLMPY 94

>KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.151
           YNL122C
          Length = 92

 Score =  106 bits (265), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 53/86 (61%), Positives = 63/86 (73%), Gaps = 2/86 (2%)

Query: 44  FKTGLLSMG--LKGQSFNSLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSH 101
           F + L +MG  +  +   +L+I RNLMKTHKG AKRWRK+A GFKRGIAGRNHGN GWS 
Sbjct: 6   FFSALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGNGGWSR 65

Query: 102 RYLNKLTGRKEADPTHVKHLKRMLPY 127
           R L  LTGRK A P+  K LKR+LP+
Sbjct: 66  RSLKCLTGRKTATPSQAKRLKRLLPF 91

>KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} similar
           to uniprot|P53921 Saccharomyces cerevisiae YNL122C
           Hypothetical ORF
          Length = 95

 Score =  105 bits (263), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 59/79 (74%), Gaps = 2/79 (2%)

Query: 52  GLKGQSFN--SLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTG 109
           GL G   N  SL++TRNLMKTHKGAAKRWRK+A  FKRG AGRNHGN GWS   L  L+G
Sbjct: 17  GLLGSKTNVSSLILTRNLMKTHKGAAKRWRKTANSFKRGKAGRNHGNAGWSRNSLKSLSG 76

Query: 110 RKEADPTHVKHLKRMLPYH 128
           R  AD TH+  LKR+LPYH
Sbjct: 77  RSLADSTHMHRLKRLLPYH 95

>SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some
           similarities with uniprot|P53921 Saccharomyces
           cerevisiae YNL122C Hypothetical ORF
          Length = 95

 Score =  104 bits (259), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 48/69 (69%), Positives = 56/69 (81%)

Query: 60  SLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVK 119
           SLV+TRNLMKTHKGAAKRW+K+A  +KRG AGRNHGN GW+   L  L G+  A PTH+K
Sbjct: 27  SLVLTRNLMKTHKGAAKRWKKTANSYKRGRAGRNHGNAGWNKSTLKSLDGKTLAHPTHIK 86

Query: 120 HLKRMLPYH 128
           HLKR+LPYH
Sbjct: 87  HLKRLLPYH 95

>Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309
           bp, 103 aa] {ON} YNL122C (REAL)
          Length = 103

 Score =  103 bits (257), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 2/76 (2%)

Query: 55  GQSFNSL--VITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKE 112
           G  FN++  +  R LMKTHKG AKRWR++   FKRGIAGR HGN+GWSHR L  LTGRK 
Sbjct: 28  GILFNNVCTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKT 87

Query: 113 ADPTHVKHLKRMLPYH 128
           A P ++KHLKR+LPYH
Sbjct: 88  AHPAYLKHLKRLLPYH 103

>Smik_14.206 Chr14
           complement(377692..377997,378001..378009,378013..378036)
           [339 bp, 113 aa] {ON} YNL122C (REAL)
          Length = 113

 Score =  103 bits (256), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 54/69 (78%)

Query: 60  SLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVK 119
           S V  R LMKTHKG AKRWR++   FKRGIAGR HGN+GWSHR L  LTGRK A+  ++K
Sbjct: 45  STVTIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTANSAYLK 104

Query: 120 HLKRMLPYH 128
           HLKR+LPYH
Sbjct: 105 HLKRLLPYH 113

>YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to mitochondria;
           YNL122C is not an essential gene
          Length = 115

 Score =  102 bits (255), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 57/78 (73%), Gaps = 2/78 (2%)

Query: 53  LKGQSFN--SLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGR 110
           L G  FN  S +  R LMKTHKG AKRWR++   FKRGIAGR HGN+GWSHR L  LTGR
Sbjct: 38  LNGFLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGR 97

Query: 111 KEADPTHVKHLKRMLPYH 128
           K A P + KHLKR+LPYH
Sbjct: 98  KIAHPAYSKHLKRLLPYH 115

>Suva_14.218 Chr14
           complement(394669..394965,394969..394983,394990..395013)
           [336 bp, 112 aa] {ON} YNL122C (REAL)
          Length = 112

 Score =  102 bits (255), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 46/69 (66%), Positives = 55/69 (79%)

Query: 60  SLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVK 119
           S +  R LMKTHKG AKRWR++   FKRGIAGR HGN+GWSHR L  LTGRK A+ +++K
Sbjct: 44  STITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKVLTGRKTANSSYLK 103

Query: 120 HLKRMLPYH 128
           HLKR+LPYH
Sbjct: 104 HLKRLLPYH 112

>ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON}
           similar to uniprot|Q75D91 Ashbya gossypii ABR133W 50S
           ribosomal protein L35 and some similarites with YNL122C
           uniprot|P53921 Saccharomyces cerevisiae YNL122C
           Hypothetical ORF
          Length = 92

 Score =  100 bits (249), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 46/69 (66%), Positives = 56/69 (81%)

Query: 59  NSLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHV 118
           +SLV TRNLMKTHKG AKRW+K+A GFKRG AGRNHGNVGWS R L  L+G+  A  +H+
Sbjct: 24  SSLVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHI 83

Query: 119 KHLKRMLPY 127
           + L+R+LPY
Sbjct: 84  QRLRRLLPY 92

>TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}
           Anc_2.151 YNL122C
          Length = 93

 Score =  100 bits (249), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 51/93 (54%), Positives = 66/93 (70%), Gaps = 2/93 (2%)

Query: 34  MFTVSSMSSLFKTGLLSMGLKGQSFNSLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRN 93
           MF  S ++ +F+T L +         SL++TR+LMKTHKGAAKRWRK+A  FKRG AGR+
Sbjct: 2   MFFSSIINPIFRTCLNTFS--KVEAPSLILTRSLMKTHKGAAKRWRKTATSFKRGKAGRS 59

Query: 94  HGNVGWSHRYLNKLTGRKEADPTHVKHLKRMLP 126
           HGN GWS R L  L+G+  A  TH+KHLKR++P
Sbjct: 60  HGNAGWSRRSLKSLSGKTLAHETHIKHLKRLMP 92

>ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL122C
          Length = 96

 Score = 94.7 bits (234), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 53/69 (76%)

Query: 60  SLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVK 119
           SL++ R LMKTHKGAAKRWRK+A G+KR  AGR+HGN GW  R L +L+GR  A   H+K
Sbjct: 28  SLIMVRTLMKTHKGAAKRWRKTAGGYKRSKAGRSHGNTGWGQRALKQLSGRTMAASAHLK 87

Query: 120 HLKRMLPYH 128
            L+R+LPYH
Sbjct: 88  RLRRLLPYH 96

>KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some
           similarities with uniprot|P53921 Saccharomyces
           cerevisiae YNL122C Hypothetical ORF
          Length = 91

 Score = 94.0 bits (232), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 51/67 (76%)

Query: 61  LVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVKH 120
           ++ TRNLMKTHKG AKRWRK++  +KRG AGRNHGN GW    L  L G+  A PTH+KH
Sbjct: 24  MMQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKSLDGKTLAHPTHIKH 83

Query: 121 LKRMLPY 127
           LKR+LPY
Sbjct: 84  LKRLLPY 90

>Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON}
           YNL122C - Hypothetical ORF [contig 101] FULL
          Length = 91

 Score = 92.8 bits (229), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%)

Query: 64  TRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVKHLKR 123
           TRNLMKTHKG AKRWRK++  +KRG AGRNHGN GW    L  L G+  A  TH+KHLKR
Sbjct: 27  TRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKALDGKTLAHSTHIKHLKR 86

Query: 124 MLPYH 128
           +LPYH
Sbjct: 87  LLPYH 91

>Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON}
           similar to Ashbya gossypii ABR133W
          Length = 98

 Score = 89.4 bits (220), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 42/68 (61%), Positives = 52/68 (76%)

Query: 61  LVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVKH 120
           L+ +R+LMKTHKGAAKRWRK+A  FKRG AGR+HGN GWS   L  L+GR  A+ + +  
Sbjct: 31  LIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNR 90

Query: 121 LKRMLPYH 128
           LKR+LPYH
Sbjct: 91  LKRLLPYH 98

>Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..57013)
           [258 nt, 86 aa]
          Length = 85

 Score = 86.3 bits (212), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 45/81 (55%), Positives = 55/81 (67%), Gaps = 2/81 (2%)

Query: 49  LSMGLKGQSFNSLVITRNLMKTHKGAAKRWR--KSAQGFKRGIAGRNHGNVGWSHRYLNK 106
           ++ GL     + L ITR+LMKTHKG AKRW+  KS   FKRG +GR HGNVGWS R L  
Sbjct: 4   INTGLFNSKISILQITRSLMKTHKGTAKRWKFIKSLDTFKRGKSGRQHGNVGWSQRSLKH 63

Query: 107 LTGRKEADPTHVKHLKRMLPY 127
           L+GR  A  THV  L+++LPY
Sbjct: 64  LSGRTYAHTTHVSRLRKLLPY 84

>TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151
           YNL122C
          Length = 99

 Score = 80.1 bits (196), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 61  LVITRNLMKTHKGAAKRWR--KSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHV 118
           L   R LMKTHKG AKRW+       FKRG +GR HGN+GWS R L  L+GR  AD THV
Sbjct: 30  LDFRRTLMKTHKGTAKRWKYISKLDTFKRGKSGRQHGNIGWSQRSLKTLSGRTYADKTHV 89

Query: 119 KHLKRMLPY 127
             L+++LPY
Sbjct: 90  SKLRKLLPY 98

>TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}
           Anc_2.151 YNL122C
          Length = 97

 Score = 71.6 bits (174), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 45/67 (67%), Gaps = 7/67 (10%)

Query: 68  MKTHKGAAKRWRK-------SAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVKH 120
           +KTHKG  KRWR+       +A+ F R  AGRNHGN+GWSHR L  L+ R  A  THVK 
Sbjct: 31  LKTHKGTLKRWRRRVAPGGPAAEQFVRSKAGRNHGNIGWSHRALAALSRRVPAHSTHVKA 90

Query: 121 LKRMLPY 127
           L+++LPY
Sbjct: 91  LRKLLPY 97

>Kpol_2001.1 s2001 (2062..7368) [5307 bp, 1768 aa] {ON} (2062..7368)
           [5307 nt, 1769 aa]
          Length = 1768

 Score = 33.5 bits (75), Expect = 0.10,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 1   MENHTNHLGSLIYLAS-NIRYFQGNPKSYNLTPDMFTVSSMSSLFKTGLLS 50
           ME+ +N +    Y  S N        KS NLTPD+F +   +SLFK+ +L+
Sbjct: 394 MEDKSNLIDVFTYFISINEDLVISCLKSLNLTPDLFEIRLTTSLFKSNILN 444

>YMR031C Chr13 complement(332212..334743) [2532 bp, 843 aa] {ON}
           EIS1Component of the eisosome that is required for
           proper eisosome assembly; similarity to Ykl050cp and
           Uso1p; the authentic, non-tagged protein is detected in
           a phosphorylated state in highly purified mitochondria
           in high-throughput studies
          Length = 843

 Score = 29.6 bits (65), Expect = 2.6,   Method: Composition-based stats.
 Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 21/108 (19%)

Query: 26  KSYNLTPDMFTVSSMS-----SLFKTGLLSMGLKGQSFNSLV----ITRNLMKTHKGAAK 76
           K+Y++T +  ++SS +     S+     +  G  G SFNS V     T NL K   GA K
Sbjct: 158 KAYSMTMETTSLSSQTNSRSYSITSASSVLSGASG-SFNSTVNPKPKTLNLEKVLVGAEK 216

Query: 77  --------RWRKSAQGFKRGIAGRNHGNV---GWSHRYLNKLTGRKEA 113
                   RW      F+ G+    HGN+    +S+  +N +  + +A
Sbjct: 217 KAESRIKERWEPEKTNFQYGVKTDEHGNLNQFSFSNEMMNNIMAKVDA 264

>TDEL0F01440 Chr6 (255662..260524) [4863 bp, 1620 aa] {ON} Anc_2.191
            YOR093C
          Length = 1620

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 50/120 (41%), Gaps = 28/120 (23%)

Query: 4    HTNHLGSL------IYLASNIRYFQ-----GNPKSYNLTPDMFTVSSMSSLFKTGLLSMG 52
            HTN +G +      IY+    R F       +P+S+ L            L  +G+  + 
Sbjct: 1200 HTNGMGFIMSCLLGIYVGCTTRLFSLPDVISDPRSFLL-----------GLQNSGVKDLY 1248

Query: 53   LKGQSFNSLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKE 112
            LK  +F+ L+   N + T+K  AK  +KSA    R    ++  N+      +   TGR E
Sbjct: 1249 LKPDTFHILIEKANSLVTNKTTAKATKKSASTVLRPDIFKSVANI------MLPFTGRPE 1302

>TDEL0D04480 Chr4 (818876..822682) [3807 bp, 1268 aa] {ON} Anc_3.175
           YAR042W
          Length = 1268

 Score = 29.3 bits (64), Expect = 3.0,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 20/39 (51%)

Query: 48  LLSMGLKGQSFNSLVITRNLMKTHKGAAKRWRKSAQGFK 86
           LLS   K QS   +    N   T+KG  K+W   AQG+K
Sbjct: 288 LLSKAAKEQSVIDVTNNLNEAPTYKGYLKKWTNFAQGYK 326

>TDEL0A00450 Chr1 complement(80330..81598) [1269 bp, 422 aa] {ON}
           Anc_3.26 YOL136C
          Length = 422

 Score = 28.1 bits (61), Expect = 7.4,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 3/63 (4%)

Query: 15  ASNIRYFQGNPKSYNLTPDMFT---VSSMSSLFKTGLLSMGLKGQSFNSLVITRNLMKTH 71
           A  IR+ Q NP +++L   +F    V    S    G LSM L   S + L   +N  K  
Sbjct: 126 AQLIRFLQSNPATHSLRCSVFNAGKVRRKMSFKNLGKLSMELANNSSDDLFNPKNTEKKE 185

Query: 72  KGA 74
           K A
Sbjct: 186 KYA 188

>Skud_4.230 Chr4 complement(410772..414656) [3885 bp, 1294 aa] {ON}
           YDL019C (REAL)
          Length = 1294

 Score = 28.1 bits (61), Expect = 8.1,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 27  SYNLTPDMFTVSSMSSLFKTGLLSMGLKGQSFNSLVITRNLMKTHKGAAKRWRKSAQGFK 86
           S N+TP+M     + SLF+  L     K Q+     +  N   T+KG  K+W   A G+K
Sbjct: 257 SNNVTPEM----KLKSLFEKKL-----KEQATVHENVASNKPPTYKGFLKKWTNFAHGYK 307

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,338,182
Number of extensions: 459006
Number of successful extensions: 1155
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1152
Number of HSP's successfully gapped: 27
Length of query: 128
Length of database: 53,481,399
Length adjustment: 96
Effective length of query: 32
Effective length of database: 42,473,463
Effective search space: 1359150816
Effective search space used: 1359150816
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)