Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F028102.152ON60960928980.0
NCAS0G024802.152ON59652418690.0
SAKL0E10956g2.152ON60053218020.0
Smik_14.2072.152ON61755517720.0
YNL121C (TOM70)2.152ON61755617570.0
Skud_14.2112.152ON61755017460.0
TDEL0B051402.152ON59952717420.0
Suva_14.2192.152ON61755017280.0
Kpol_1048.212.152ON59752517210.0
ZYRO0G06512g2.152ON60452217210.0
Kwal_33.147672.152ON59452717020.0
TPHA0I015102.152ON60353016920.0
KLTH0B05170g2.152ON59352416910.0
ABR131W2.152ON59452216460.0
Ecym_82042.152ON59752416440.0
TBLA0C055302.152ON61053116310.0
KLLA0F24046g2.152ON60452515780.0
KNAG0H035302.152ON61453815500.0
CAGL0L12936g2.152ON60054115400.0
NCAS0B070102.152ON62552715220.0
CAGL0L04048g2.152ON58751614920.0
KAFR0F007202.152ON60852214820.0
NDAI0B043402.152ON66453513311e-176
Skud_8.1782.152ON63853612911e-171
YHR117W (TOM71)2.152ON63953112881e-170
Suva_15.3142.152ON64453712831e-169
Smik_8.1952.152ON63553112671e-167
ACR005W6.21ON3271081516e-10
NDAI0I022406.21ON3501061526e-10
NCAS0G008105.617ON584861502e-09
TPHA0J003406.21ON3381001463e-09
Ecym_30256.21ON3181101436e-09
TBLA0E033005.617ON582891441e-08
Kpol_1037.266.21ON342921392e-08
SAKL0E01210g6.21ON323801373e-08
CAGL0H08195g5.617ON583851394e-08
Kwal_55.199355.617ON593861394e-08
SAKL0G07084g5.617ON585851369e-08
KLLA0D01155g6.21ON335761341e-07
AEL224W5.617ON580851332e-07
KLLA0B09966g8.506ON370961303e-07
Suva_8.805.617ON586851304e-07
KNAG0B032005.617ON579851305e-07
TPHA0D028805.617ON585851305e-07
Skud_15.1925.617ON5891141296e-07
Kpol_513.28.506ON3741441286e-07
Kpol_1032.86.21ON3431141268e-07
TDEL0G044806.21ON343891241e-06
Kwal_56.224336.21ON322891242e-06
YOR027W (STI1)5.617ON589851252e-06
Kpol_1018.695.617ON590851252e-06
NDAI0D008106.21ON349891232e-06
NDAI0F009105.617ON583851242e-06
Kwal_27.118908.506ON3341241214e-06
Smik_15.2055.617ON589851224e-06
KLTH0C11220g6.21ON327831195e-06
KLTH0F14542g3.481ON5131561216e-06
KLLA0A07062g5.617ON581861207e-06
Skud_2.2828.506ON3851311181e-05
CAGL0E02739g6.21ON343841152e-05
TBLA0A072706.21ON3731271162e-05
YBR155W (CNS1)8.506ON3851311152e-05
KAFR0C058905.617ON5751171153e-05
KLTH0E02178g5.617ON593861153e-05
TBLA0C039503.481ON5121261143e-05
KAFR0L004106.21ON331901124e-05
Ecym_55825.617ON584851144e-05
NCAS0A112003.367ON9071251144e-05
TDEL0A048405.617ON576851135e-05
Skud_15.1686.21ON348801125e-05
AGL294W7.412ON6563171135e-05
TDEL0C027207.412ON7002111136e-05
TBLA0G010506.21ON350891108e-05
Ecym_71427.412ON6752551128e-05
Ecym_20906.328ON172681068e-05
Smik_2.2958.506ON3851321101e-04
NCAS0H008306.21ON338821091e-04
TPHA0D032203.481ON5131461091e-04
Kwal_55.211753.481ON5111011091e-04
TDEL0B013108.506ON3801401082e-04
NCAS0D026706.21ON3511121082e-04
KNAG0A039508.506ON3861261072e-04
ZYRO0A05676g5.617ON572891082e-04
Suva_15.1826.21ON3461031072e-04
YOR007C (SGT2)6.21ON346801072e-04
KNAG0M011706.21ON339851062e-04
KAFR0E029808.506ON3801271063e-04
SAKL0H10934g8.506ON3801271053e-04
TBLA0H033808.506ON3751521054e-04
TPHA0M016303.367ON10431221064e-04
CAGL0D05060g3.481ON510991054e-04
TDEL0D055003.481ON512921045e-04
SAKL0F03102g3.481ON5131381037e-04
KNAG0A079003.481ON5121131037e-04
KNAG0I025206.328ON11790957e-04
CAGL0H07425g8.506ON380991027e-04
ZYRO0C07788g6.21ON334831028e-04
TPHA0L014208.506ON3741491010.001
NDAI0B057903.481ON523931010.001
Smik_15.1766.21ON345801000.002
AGL268C8.506ON37986990.002
CAGL0I02288g5.72ON6392281000.002
YCR060W (TAH1)6.328ON11191910.002
ZYRO0F08624g8.506ON37995980.002
NCAS0A00490singletonON62086980.003
Suva_4.4058.506ON38581970.004
AAR054C6.328ON13389910.004
NCAS0B024008.506ON380121960.005
Ecym_25598.506ON370107940.007
Ecym_44133.481ON51092930.011
SAKL0A01672g6.328ON12890870.011
NDAI0C052908.506ON37996920.015
Kpol_1050.1127.546ON136054920.017
Kpol_172.23.367ON41889910.018
ZYRO0D10186g5.352ON635114910.022
KAFR0B066103.481ON51197890.035
Suva_2.347.412ON763187890.036
Smik_2.2543.367ON1020116900.037
Suva_7.4083.481ON51394890.039
YBR112C (CYC8)3.367ON966116890.041
TBLA0H015203.367ON68997880.049
Skud_2.2403.367ON98486880.054
NCAS0E024907.412ON809115880.054
TPHA0D038606.328ON12088820.058
NDAI0C043205.352ON706119870.063
KLTH0E11748g8.506ON37895860.064
YBL084C (CDC27)7.412ON758187870.068
Skud_7.4323.481ON51390870.069
KLLA0B10912g3.481ON512106870.071
Kpol_1018.1067.412ON753183870.073
SAKL0D11110g1.456ON432150860.082
KLTH0E10934g8.470ON56889860.088
Smik_2.367.412ON751187860.098
NCAS0F034903.481ON512101850.11
Suva_4.3613.367ON96386860.11
SAKL0B07986g3.367ON880125850.11
KNAG0F040107.546ON141881860.11
TPHA0M002706.21ON37789840.12
TDEL0E027505.352ON564128850.12
Smik_6.2153.481ON513105840.13
KLLA0B09262g3.367ON941125850.13
KAFR0C018505.352ON646104840.14
ZYRO0B04224g3.481ON51392840.14
YGR123C (PPT1)3.481ON51394840.16
ZYRO0B03828g7.412ON727190840.17
Kpol_1006.43.367ON73257830.19
CAGL0B01375g3.5ON1110186840.19
Suva_3.956.328ON11175770.21
CAGL0D01364g3.367ON114857830.22
ZYRO0A03036g3.265ON867253820.27
NDAI0A051003.367ON100757820.28
CAGL0G10087g7.546ON1411122820.28
Kwal_27.117378.470ON57578810.31
TPHA0L012108.470ON588105810.31
NDAI0E040407.412ON783182810.32
KLTH0F10428g3.367ON795106810.35
Skud_2.247.412ON769187810.36
KLLA0E20857g7.412ON710199810.37
KLLA0B03520g7.546ON140169810.38
NDAI0G037103.5ON1121121810.44
KLTH0A00638g7.546ON141199800.45
KNAG0C055005.352ON585188800.45
KAFR0H008703.367ON88757800.46
ZYRO0C16522g3.367ON97457800.48
TDEL0B016608.470ON549104800.48
YDR320C (SWA2)5.352ON668111790.55
TDEL0C050903.367ON75957790.59
TBLA0I023106.328ON11661740.60
Kpol_339.135.352ON686113790.61
Smik_4.5795.352ON667111790.62
KNAG0H006103.367ON97357790.63
TBLA0F012303.367ON118957790.70
SAKL0G19712g2.665ON72178770.94
KLTH0H14872g5.352ON623129771.0
KAFR0B002507.546ON1420151771.1
ADL344W3.367ON91080771.2
Suva_2.4895.352ON659112761.4
TBLA0D004607.412ON835244761.4
TBLA0C015901.456ON408161751.4
CAGL0C01903g7.412ON769150761.5
KNAG0A045608.415ON84446761.6
NCAS0A084201.456ON39498741.8
SAKL0F16236g7.546ON140898751.9
TPHA0E011105.352ON693110751.9
NCAS0A153007.546ON139854752.1
Kpol_1057.142.665ON72478752.1
Suva_16.5217.546ON142454752.2
Kwal_23.36703.367ON802116742.2
NDAI0J001307.546ON140370752.2
Ecym_34593.367ON111557742.4
Kpol_1031.648.470ON60778742.4
YPR189W (SKI3)7.546ON143254742.5
ZYRO0E03300g1.456ON397131732.6
TPHA0E007407.412ON746150732.9
NDAI0C051308.470ON59077723.6
Kpol_1028.516.328ON11759684.0
Ecym_56372.665ON71795724.4
TPHA0G002407.546ON143059724.5
ACR168W2.665ON70795724.6
ZYRO0D00572g2.665ON78576724.7
NDAI0I004406.328ON12878684.8
Smik_4.4918.470ON61261714.8
YDR244W (PEX5)8.470ON61261714.9
Skud_4.5068.470ON61161714.9
Smik_16.4537.546ON141754715.3
Suva_2.4108.470ON61161715.3
YHR166C (CDC23)5.72ON626151715.4
CAGL0M05973g1.235ON410137715.5
KLLA0C08910g6.328ON11559665.6
NCAS0A136407.267ON42186705.6
TPHA0A052905.72ON66687715.9
TBLA0B049907.546ON141074716.1
Smik_8.2505.72ON62689716.1
TBLA0E042608.242ON120289706.8
CAGL0M05489g8.523ON426129707.0
KAFR0E022405.72ON623198707.0
KLTH0H14234g1.456ON395157707.0
Suva_15.3665.72ON626176707.3
Skud_8.2305.72ON626174707.5
NCAS0I016503.266ON49559697.8
KLLA0C15455g8.470ON56661698.3
ZYRO0F06182g8.625ON42894698.4
Smik_13.2022.591ON66351698.8
Kwal_23.54087.546ON141055708.9
Smik_3.1596.328ON11575659.2
ZYRO0G17358g7.458ON28856689.4
TBLA0H033008.415ON108179699.7
KAFR0A003702.400ON204119679.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F02810
         (609 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...  1120   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   724   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   698   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   687   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   681   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   677   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   675   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   670   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   667   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   667   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   660   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   656   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   655   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   638   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   637   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   632   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   612   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   601   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   597   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   590   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   579   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   575   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   517   e-176
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   501   e-171
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   500   e-170
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   498   e-169
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   492   e-167
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    63   6e-10
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    63   6e-10
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    62   2e-09
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    61   3e-09
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    60   6e-09
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    60   1e-08
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    58   2e-08
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    57   3e-08
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    58   4e-08
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    58   4e-08
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    57   9e-08
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    56   1e-07
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    56   2e-07
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    55   3e-07
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    55   4e-07
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    55   5e-07
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    55   5e-07
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    54   6e-07
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    54   6e-07
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    53   8e-07
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    52   1e-06
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    52   2e-06
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    53   2e-06
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    53   2e-06
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    52   2e-06
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     52   2e-06
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    51   4e-06
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    52   4e-06
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    50   5e-06
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    51   6e-06
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    51   7e-06
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    50   1e-05
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    49   2e-05
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    49   2e-05
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    49   2e-05
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    49   3e-05
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    49   3e-05
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    49   3e-05
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    48   4e-05
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    49   4e-05
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    49   4e-05
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    48   5e-05
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    48   5e-05
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    48   5e-05
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    48   6e-05
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    47   8e-05
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    48   8e-05
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    45   8e-05
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    47   1e-04
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    47   1e-04
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    47   1e-04
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    47   1e-04
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    46   2e-04
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    46   2e-04
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    46   2e-04
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    46   2e-04
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    46   2e-04
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    46   2e-04
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    45   2e-04
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    45   3e-04
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    45   3e-04
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    45   4e-04
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    45   4e-04
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    45   4e-04
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    45   5e-04
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    44   7e-04
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    44   7e-04
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    41   7e-04
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    44   7e-04
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    44   8e-04
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    44   0.001
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    44   0.001
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    43   0.002
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    43   0.002
CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {...    43   0.002
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    40   0.002
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    42   0.002
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       42   0.003
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.004
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    40   0.004
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    42   0.005
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    41   0.007
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    40   0.011
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    38   0.011
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    40   0.015
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    40   0.017
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    40   0.018
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...    40   0.022
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    39   0.035
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    39   0.036
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    39   0.037
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    39   0.039
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    39   0.041
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    39   0.049
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    39   0.054
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    39   0.054
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    36   0.058
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    38   0.063
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    38   0.064
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    38   0.068
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    38   0.069
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    38   0.071
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    38   0.073
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    38   0.082
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    38   0.088
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    38   0.098
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    37   0.11 
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    38   0.11 
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    37   0.11 
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    38   0.11 
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    37   0.12 
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    37   0.12 
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    37   0.13 
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    37   0.13 
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    37   0.14 
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    37   0.14 
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    37   0.16 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    37   0.17 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    37   0.19 
CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa] ...    37   0.19 
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    34   0.21 
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    37   0.22 
ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} simila...    36   0.27 
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    36   0.28 
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    36   0.28 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    36   0.31 
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    36   0.31 
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    36   0.32 
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    36   0.35 
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    36   0.36 
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    36   0.37 
KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} simil...    36   0.38 
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    36   0.44 
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    35   0.45 
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    35   0.45 
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    35   0.46 
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    35   0.48 
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    35   0.48 
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    35   0.55 
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    35   0.59 
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    33   0.60 
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    35   0.61 
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    35   0.62 
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    35   0.63 
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    35   0.70 
SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} simi...    34   0.94 
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    34   1.0  
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    34   1.1  
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    34   1.2  
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...    34   1.4  
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    34   1.4  
TBLA0C01590 Chr3 complement(370571..371797) [1227 bp, 408 aa] {O...    33   1.4  
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    34   1.5  
KNAG0A04560 Chr1 complement(645401..647935) [2535 bp, 844 aa] {O...    34   1.6  
NCAS0A08420 Chr1 complement(1667102..1668286) [1185 bp, 394 aa] ...    33   1.8  
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    33   1.9  
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    33   1.9  
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            33   2.1  
Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON} (25908....    33   2.1  
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    33   2.2  
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    33   2.2  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    33   2.2  
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    33   2.4  
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    33   2.4  
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    33   2.5  
ZYRO0E03300g Chr5 complement(259634..260827) [1194 bp, 397 aa] {...    33   2.6  
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    33   2.9  
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    32   3.6  
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    31   4.0  
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    32   4.4  
TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON...    32   4.5  
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    32   4.6  
ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp...    32   4.7  
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    31   4.8  
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    32   4.8  
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    32   4.9  
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    32   4.9  
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    32   5.3  
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    32   5.3  
YHR166C Chr8 complement(437170..439050) [1881 bp, 626 aa] {ON}  ...    32   5.4  
CAGL0M05973g Chr13 (627289..628521) [1233 bp, 410 aa] {ON} highl...    32   5.5  
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    30   5.6  
NCAS0A13640 Chr1 (2681868..2683133) [1266 bp, 421 aa] {ON} Anc_7...    32   5.6  
TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa] ...    32   5.9  
TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_...    32   6.1  
Smik_8.250 Chr8 complement(414141..416021) [1881 bp, 626 aa] {ON...    32   6.1  
TBLA0E04260 Chr5 (1083669..1087277) [3609 bp, 1202 aa] {ON} Anc_...    32   6.8  
CAGL0M05489g Chr13 (585392..586672) [1281 bp, 426 aa] {ON} simil...    32   7.0  
KAFR0E02240 Chr5 complement(451940..453811) [1872 bp, 623 aa] {O...    32   7.0  
KLTH0H14234g Chr8 (1236691..1237878) [1188 bp, 395 aa] {ON} simi...    32   7.0  
Suva_15.366 Chr15 complement(643222..645102) [1881 bp, 626 aa] {...    32   7.3  
Skud_8.230 Chr8 complement(408573..410453) [1881 bp, 626 aa] {ON...    32   7.5  
NCAS0I01650 Chr9 complement(303652..305139) [1488 bp, 495 aa] {O...    31   7.8  
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    31   8.3  
ZYRO0F06182g Chr6 complement(513327..514613) [1287 bp, 428 aa] {...    31   8.4  
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    31   8.8  
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    32   8.9  
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    30   9.2  
ZYRO0G17358g Chr7 complement(1428038..1428904) [867 bp, 288 aa] ...    31   9.4  
TBLA0H03300 Chr8 (805828..809073) [3246 bp, 1081 aa] {ON} Anc_8....    31   9.7  
KAFR0A00370 Chr1 (69584..70198) [615 bp, 204 aa] {ON} Anc_2.400 ...    30   9.9  

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 1120 bits (2898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/609 (91%), Positives = 557/609 (91%)

Query: 1   MSSDNSIKGFVSRNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXENVRPXXXXXXXXXXXX 60
           MSSDNSIKGFVSRNR                            ENVRP            
Sbjct: 1   MSSDNSIKGFVSRNRTAIIATIAAGTTAVGAYYYYTQLQAQQQENVRPKEDTDKSTATKK 60

Query: 61  XXXXXXXXXXXXPQEDTPTTKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNEL 120
                       PQEDTPTTKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNEL
Sbjct: 61  EKKKSKGKESKKPQEDTPTTKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNEL 120

Query: 121 FKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVL 180
           FKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVL
Sbjct: 121 FKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVL 180

Query: 181 MRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQ 240
           MRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQ
Sbjct: 181 MRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQ 240

Query: 241 NLPSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAA 300
           NLPSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAA
Sbjct: 241 NLPSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAA 300

Query: 301 ELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQ 360
           ELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQ
Sbjct: 301 ELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQ 360

Query: 361 SLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDEN 420
           SLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDEN
Sbjct: 361 SLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDEN 420

Query: 421 NIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFD 480
           NIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFD
Sbjct: 421 NIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFD 480

Query: 481 KAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGL 540
           KAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGL
Sbjct: 481 KAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGL 540

Query: 541 AQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTI 600
           AQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTI
Sbjct: 541 AQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTI 600

Query: 601 EQMRSQMSM 609
           EQMRSQMSM
Sbjct: 601 EQMRSQMSM 609

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/524 (66%), Positives = 427/524 (81%), Gaps = 2/524 (0%)

Query: 83  PIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDD 142
           PIY +D+NGEP L D+D L ++TK EWA ALK+KGN LFK   FE+AIKYY +AL LK+D
Sbjct: 68  PIYPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKED 127

Query: 143 PIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISA 202
           P+YYSNISACY+SLL YEKVIE ATKAL LRP +SKVL+RRA AYE +GNFGDAMFD+S 
Sbjct: 128 PVYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSV 187

Query: 203 CSLNGDMNDASIEPILERILNKQAEFVLKEKISA-NKEQNLPSSTPLASFFRVFKPETSF 261
           CSLN DM+DASIEPILER LN+QA FVL  K+   +K+  LPS+T L SFF +FKPE SF
Sbjct: 188 CSLNTDMSDASIEPILERNLNQQAMFVLNTKLGVTDKKSQLPSNTALTSFFGIFKPELSF 247

Query: 262 ANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTA 321
           ANY+++ E D+EL+NGL NLY+ + EG++ AD SF KA E F  QLS+  D+E +KEKTA
Sbjct: 248 ANYDDTCEGDKELLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETVKEKTA 307

Query: 322 IALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKAL 381
           IALE+ GI  ++KN  L+AH+ IK A+ELHPR+NSYIY +LI +D   T  Y  N++KA+
Sbjct: 308 IALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFANYEKAM 367

Query: 382 ELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDC 441
           +L+  N A+YYHRGQ YFI QQYEKAG+DFDK KELD  NIF YIQLACL+YRE+KFDDC
Sbjct: 368 KLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDC 427

Query: 442 ETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLI 501
           ETLFSEARRKFP + EVPNF+AE+LAD+G+ + A+KE+++AIELE K  + +HVGIAPL+
Sbjct: 428 ETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQ-DAVHVGIAPLV 486

Query: 502 GKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAA 561
           GKATLL+  PTVENFVE   LL+EA  +DPRSEQA++ L QLKLQQEDIDEAI+LFE AA
Sbjct: 487 GKATLLVRTPTVENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEAIELFESAA 546

Query: 562 ELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRS 605
            LA+++EEKLQATTFAEAAKIQKRIRADP M AKI++TI  +R+
Sbjct: 547 TLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALRA 590

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/532 (64%), Positives = 421/532 (79%), Gaps = 4/532 (0%)

Query: 78  PTTKKPI---YLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYH 134
           PT+  P    Y VD NGEP L DID LT+E K ++AM LKDKGNE FK  KF+DAIKYY+
Sbjct: 67  PTSGSPTASAYPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYN 126

Query: 135 YALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFG 194
            AL+LK DP++YSN SACY S+ Q EKV+E  T ALKL+  +SK L+RRA A E++GN+ 
Sbjct: 127 LALELKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYA 186

Query: 195 DAMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRV 254
           DAMFD+SA SL GD N ASIEP+LER +NKQA  VLKEK+   K+  LPS+T LASFF +
Sbjct: 187 DAMFDLSALSLYGDFNGASIEPMLERNMNKQAMLVLKEKLEEKKDHRLPSNTSLASFFGI 246

Query: 255 FKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNE 314
           F+PETSF NY+ES EADR L+ GLTNLYK + EG+  AD+SF KAA  +K  L ++ +NE
Sbjct: 247 FEPETSFENYDESVEADRLLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLEESPENE 306

Query: 315 AIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYL 374
            +K+K AIALE+ GI  ++KN+ L AHD +K A+E HPRVNSYIY +LI +D    +EY 
Sbjct: 307 ILKQKAAIALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATEYF 366

Query: 375 QNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYR 434
           +NFDKALEL+PN  A+YYHRGQ YFI QQYE AGKDFDK KE +ENNIF YIQLACLAYR
Sbjct: 367 ENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYR 426

Query: 435 ESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIH 494
           E+KF+DCETLFSEARRKFPTAPEVPNF+AE+L+D+G+   A K+++ A +LE    + IH
Sbjct: 427 ENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLE-DALDGIH 485

Query: 495 VGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAI 554
           VGIAPL+GKATLL  +PTVENFVE  Q  +EAC+KDPRSEQA++GLAQLKLQQE++DEAI
Sbjct: 486 VGIAPLVGKATLLAREPTVENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEVDEAI 545

Query: 555 QLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
            LFEEAA+LA+S++EKLQATTFAEA KIQK+IRADP + AKI +T+   R+Q
Sbjct: 546 TLFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQ 597

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/555 (60%), Positives = 428/555 (77%), Gaps = 21/555 (3%)

Query: 75  EDTPTTKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYH 134
           E T  +  P+Y V SNG+P+ S+  + T E K+ +A+ALKDKGN+ F+  K++DAIKYY+
Sbjct: 64  ESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYN 123

Query: 135 YALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFG 194
           +AL+LKDDP++YSN+SACY S+   +KV+E +TKAL+L+P +SKVL+RRA A E +GNF 
Sbjct: 124 WALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFA 183

Query: 195 DAMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKIS------------------- 235
           DAMFD+S  SLNGD NDASIEP+LER LNKQA   LKEK                     
Sbjct: 184 DAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKE 243

Query: 236 -ANKEQNLPSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADK 294
             +K +NLPS T +ASFF +FKPE +FANY+ESNEAD++LMNGLTNLYK S E +  AD+
Sbjct: 244 LKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADE 303

Query: 295 SFLKAAELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRV 354
           SF KA +LF +QL +N ++E  KEK AI+LE++GI  ++KN+ L AH+ IK AIEL PRV
Sbjct: 304 SFTKAVKLFDEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRV 363

Query: 355 NSYIYQSLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKV 414
           NSYIY +LI +D   ++EY   FDKAL+L+ NN ++YYHRGQ  FI Q Y++AGKDFDK 
Sbjct: 364 NSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKA 423

Query: 415 KELDENNIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEK 474
           KELD  NIF YIQLACLAYRE+KFDDCETLFSEA+RKFP APEVPNFFAE+L D+ + EK
Sbjct: 424 KELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEK 483

Query: 475 AMKEFDKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSE 534
           A+K++D AIELE K  + I+VGIAPL+GKATLL   PTVENF+E   LL+EA   DPRSE
Sbjct: 484 ALKQYDLAIELENKL-DGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSE 542

Query: 535 QARLGLAQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDA 594
           QA++GLAQ+KLQQEDIDEAI LFEE+A+LA++ EEKLQA TFAEAAK+QKRIR+DP + A
Sbjct: 543 QAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAA 602

Query: 595 KIRQTIEQMRSQMSM 609
           KI++T+ ++R Q  M
Sbjct: 603 KIQETLAKLREQGLM 617

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/556 (60%), Positives = 431/556 (77%), Gaps = 21/556 (3%)

Query: 74  QEDTPTTKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYY 133
           ++ T  +  PIY V SNGEP+ S+  + T E K+++A+ALKDKGN+ F+  K++DAIKYY
Sbjct: 63  KKSTAPSNPPIYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYY 122

Query: 134 HYALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNF 193
           ++AL+LK+DP++YSN+SACY S+   +KV+E +TKAL+L+P +SKVL+RRA A E +G F
Sbjct: 123 NWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKF 182

Query: 194 GDAMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKIS------------------ 235
            DAMFD+S  SLNGD NDASIEP+LER LNKQA   LKEK                    
Sbjct: 183 ADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAK 242

Query: 236 --ANKEQNLPSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIAD 293
              +K++NLPS T +ASFF +FKPE +FANY+ESNEAD+ELMNGL+NLYK S E +  AD
Sbjct: 243 ERKDKQENLPSVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKAD 302

Query: 294 KSFLKAAELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPR 353
           +SF KAA LF++QL +N ++E +KEK AI+LE++GI  ++KN+ L AH+ IK AIEL PR
Sbjct: 303 ESFTKAARLFEEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPR 362

Query: 354 VNSYIYQSLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDK 413
           VNSYIY +LI +D   ++EY   FDKAL+L+ NN ++YYHRGQ  FI Q Y++AGKDFDK
Sbjct: 363 VNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDK 422

Query: 414 VKELDENNIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESE 473
            KELD  NIF YIQLACLAYRE+KFDDCETLFSEA+RKFP APEVPNFFAE+L D+ + +
Sbjct: 423 AKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFD 482

Query: 474 KAMKEFDKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRS 533
           KA+K++D AIELE K  + I+VGIAPL+GKATLL   PTVENF+E   LL++A   DPRS
Sbjct: 483 KALKQYDLAIELENKL-DGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRS 541

Query: 534 EQARLGLAQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMD 593
           EQA++GLAQ+KLQQEDIDEAI LFEE+A+LA++ EEKLQA TFAEAAK+Q+RIR+DP + 
Sbjct: 542 EQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLA 601

Query: 594 AKIRQTIEQMRSQMSM 609
            KI++T+ ++R Q  M
Sbjct: 602 KKIQETLAKLREQGLM 617

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/550 (60%), Positives = 429/550 (78%), Gaps = 21/550 (3%)

Query: 80  TKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL 139
           +K P+Y V SNGEP+ S   + T E K+++A+ALKDKGN+ F+  K++DAIKYY++AL+L
Sbjct: 69  SKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL 128

Query: 140 KDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFD 199
           K+DP++YSN+SACY S+   +KV+E +TKAL+++P +SKVL+RRA A E +GNF DAMFD
Sbjct: 129 KEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFD 188

Query: 200 ISACSLNGDMNDASIEPILERILNKQAEFVLKEKIS--------------------ANKE 239
           +S  SLNGD NDASIEP+LER LNKQA   LKEK                       +K+
Sbjct: 189 LSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQ 248

Query: 240 QNLPSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKA 299
           +NLPS T +ASFF +FKPE +FANY+E N+AD+ELM+GL NLYK S E +  AD+SF KA
Sbjct: 249 ENLPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKA 308

Query: 300 AELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIY 359
           A+LF++QL ++ ++E +KEK AI+LE++GI  ++KN+ L AH+ IK AIEL PRVNSYIY
Sbjct: 309 AKLFEEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIY 368

Query: 360 QSLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDE 419
            +LI +D   ++EY   FDKAL+L PNN ++YYHRGQ  FI Q Y++AGKDFDK KELD 
Sbjct: 369 MALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428

Query: 420 NNIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEF 479
            NIF YIQLACLAYRE+KFDDCETLFSEA+RKFP APEVPNFFAE+L D+ + +KA+K++
Sbjct: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488

Query: 480 DKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLG 539
           D AIELE K  + I+VGIAPL+GKATLL   PTVENFVE   LL++A   DPRSEQA++G
Sbjct: 489 DLAIELENKL-DRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIG 547

Query: 540 LAQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQT 599
           LAQ+KLQQEDIDEAI LFEE+A+LA++ EEKLQA TFAEAAK+Q++IR+DP + AKI++T
Sbjct: 548 LAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQET 607

Query: 600 IEQMRSQMSM 609
           + ++R Q  M
Sbjct: 608 LAKLREQGLM 617

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/527 (61%), Positives = 418/527 (79%), Gaps = 1/527 (0%)

Query: 83  PIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDD 142
           P+Y V  NGEP L +I+ L++E +  +A ALKD+GNE FK   +++A+KYY+YAL +K D
Sbjct: 74  PVYPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVVKKD 133

Query: 143 PIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISA 202
           P++YSNISACY SL Q +KV+E +TKAL+L+P +SK L+RRA A E++ N+ DAMFD+S 
Sbjct: 134 PVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDLSV 193

Query: 203 CSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPETSFA 262
            SLNGD N +SIEP+LER LNKQA FVLK+K+  N  Q LPS+T LASFF +F PET+FA
Sbjct: 194 LSLNGDFNGSSIEPMLERNLNKQAMFVLKDKLGNNVSQQLPSNTALASFFGIFPPETTFA 253

Query: 263 NYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAI 322
           NY E++EAD  L NGL +LYK S EG+++AD++F+K+A  F ++LS+  D+  +KEKTAI
Sbjct: 254 NYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASFFTNKLSEFPDDAVLKEKTAI 313

Query: 323 ALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALE 382
           ALE++GI  ++KN+ L+AHD I+ AI+LHPR+NSYIY +LI +D     EY Q FDKA+ 
Sbjct: 314 ALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQAEEYYQYFDKAIA 373

Query: 383 LEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCE 442
           L+PN    YYHRGQ Y+I  QYEKAGKDFDK KE DENNIF YIQLACLAYRE KFDDCE
Sbjct: 374 LDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLACLAYREDKFDDCE 433

Query: 443 TLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIG 502
           TLFSEA+RKFPTAPEVPNF+AE+L D+G+ E A+K+++ A  LE +  + IHVG+APL+G
Sbjct: 434 TLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLE-EALDGIHVGVAPLVG 492

Query: 503 KATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAE 562
           KATLL  +P+VENF E   LL+EAC +DP SEQA++GLAQLKLQQE++DEAI LFEEAA 
Sbjct: 493 KATLLARQPSVENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEVDEAINLFEEAAN 552

Query: 563 LAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQMSM 609
           LA++ +EKLQATTFAEAAK+QKRI+ADP + AKI +T+   R+Q  M
Sbjct: 553 LARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGMM 599

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/550 (59%), Positives = 425/550 (77%), Gaps = 21/550 (3%)

Query: 80  TKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL 139
           +K PIY V +NGEP+ S     T E K+++A+ALKDKGN+ F+  K++DAIKYY++AL+L
Sbjct: 69  SKPPIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALEL 128

Query: 140 KDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFD 199
           K+DP++YSN+SACY S+   +KV+E +TKAL+L+P +SKVL+RRA A E +GNF DAMFD
Sbjct: 129 KEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFD 188

Query: 200 ISACSLNGDMNDASIEPILERILNKQAEFVLKEKIS--------------------ANKE 239
           +S  SLNGD NDASIEP+LER LNKQA   LKEK                       +K+
Sbjct: 189 LSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQ 248

Query: 240 QNLPSSTPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKA 299
           ++LPS T +ASFF +FKPE +FAN +ESNEAD+ELMNGL NLYK S + +  AD+SF KA
Sbjct: 249 ESLPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKA 308

Query: 300 AELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIY 359
            +LF+DQL ++ ++E +KEK AI+LE++GI  ++KN+ L AH+ I  AI+L PRVNSYIY
Sbjct: 309 VKLFEDQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIY 368

Query: 360 QSLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDE 419
            +LI +D   ++EY   FDKAL+L+ NN ++YYHRGQ  FI Q Y++AGKDFDK KELD 
Sbjct: 369 MALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDP 428

Query: 420 NNIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEF 479
            NIF YIQLACLAYRE+KFDDCETLFSEA+RKFP APEVPNFFAE+L D+ + +KA+K++
Sbjct: 429 ENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQY 488

Query: 480 DKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLG 539
           D AIELE K  E I+VGIAPL+GKATLL   PTVENF+E   LL++A   DPRSEQA++G
Sbjct: 489 DLAIELENKL-EGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIG 547

Query: 540 LAQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQT 599
           LAQ+KLQQEDIDEAI LFEE+A+LA++ EEKLQA TFAEAAK+Q+RIR+DP +  KI++T
Sbjct: 548 LAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQET 607

Query: 600 IEQMRSQMSM 609
           + ++R Q  M
Sbjct: 608 LAKLREQGLM 617

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/525 (61%), Positives = 414/525 (78%), Gaps = 1/525 (0%)

Query: 82  KPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKD 141
           KP Y +DSNGEP+L D  + TEE K  +++ALKDKGN+ FK  K+EDA+KYY+YAL LK 
Sbjct: 71  KPCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQ 130

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDIS 201
           DP++YSNISACY SL   EKV+E +TKAL+L+P +SK L+RRA A E + NF +AMFD+S
Sbjct: 131 DPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLS 190

Query: 202 ACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPETSF 261
             SLNGD N+ASIEP+LER LNKQA  VLK+K+S++ +Q LPS+T LASFF +F PET+ 
Sbjct: 191 VLSLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTL 250

Query: 262 ANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTA 321
            N++ESNEAD EL+N L NLYK   E + IAD+SF KAAE +  QL  N D+E +KEKTA
Sbjct: 251 KNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTA 310

Query: 322 IALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKAL 381
            ALEY+GI  ++KN+ L +H+ I+ +IELHPRVN+YIY +LI +D   +  Y   FDKAL
Sbjct: 311 TALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKAL 370

Query: 382 ELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDC 441
           +++PN+  +YYHRGQ +F++QQYEKA  DF+K KE D +NIF YIQLACL Y E KFDDC
Sbjct: 371 DVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGKFDDC 430

Query: 442 ETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLI 501
           ETLFSEA+RKFPTAPEVPNF+AEVL D+G+ + A K++D A  LE ++ + IHVG++PL+
Sbjct: 431 ETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLE-ESLDAIHVGVSPLV 489

Query: 502 GKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAA 561
           GKATLL  +PTVEN +E   LL+EAC  D RSEQA++GLAQLKLQQE+IDEAI LFEEA+
Sbjct: 490 GKATLLARQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEAS 549

Query: 562 ELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
           +LA++ EEKLQATTFAEA+K+QK+IRADP ++AKI+ T+   R Q
Sbjct: 550 DLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQ 594

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/522 (61%), Positives = 410/522 (78%), Gaps = 1/522 (0%)

Query: 85  YLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI 144
           Y VD  GEP L ++  ++EE K  W+ ALKDKGNE FK   +++A+KYY YAL LK DP+
Sbjct: 81  YPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPV 140

Query: 145 YYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACS 204
           +YSNISACY S+ Q +KV+E +TKAL+L+P +SK L+RRA A E++ N+ DAMFD+S  S
Sbjct: 141 FYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLS 200

Query: 205 LNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPETSFANY 264
           LNGD   +SIEP+LER LNKQA  VLK+K+   K Q LPS T LASFF +F PET FANY
Sbjct: 201 LNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLLPSDTALASFFGIFTPETEFANY 260

Query: 265 EESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAIAL 324
           +E++EAD++L  GL NLYK S EG+Q AD+ F +A + +      N D+ A+KEK AIAL
Sbjct: 261 DETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIAL 320

Query: 325 EYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALELE 384
           E+ GI  ++KN+ L AH+ ++ AI+LHPRVNSYIY +LI +D     EY + FDKA++L+
Sbjct: 321 EHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLD 380

Query: 385 PNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETL 444
           P N A+YYHRGQ YFI  QYEKAG+DFDK K+L+E NIF YIQLACLAYRE+KFDDCETL
Sbjct: 381 PKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETL 440

Query: 445 FSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKA 504
           FSEA+RKF TAPEVPNFFAE+LAD+G+ EKA+K++D A  LE +  + IHVGI+PL+GKA
Sbjct: 441 FSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLE-EAVDGIHVGISPLVGKA 499

Query: 505 TLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAELA 564
           TLL  +P+VENF+E  +LL+EAC KDPRSEQ ++GLAQLKLQQEDID+AI+LFEEAA LA
Sbjct: 500 TLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLA 559

Query: 565 KSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
           ++ +EKLQATTFAEAAK+QKRIRADP + AKI +T+   ++Q
Sbjct: 560 RTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQ 601

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/527 (59%), Positives = 414/527 (78%), Gaps = 1/527 (0%)

Query: 80  TKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL 139
           T+ P + VD  GEP+L  +D L+ E K+++AM LKDKGNE FK  +FEDA+KYY  A+++
Sbjct: 66  TQGPSFPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEV 125

Query: 140 KDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFD 199
           K+DP++YSN SACY SL Q EKV+E  T ALKL+P +SK L+RRA A E++G F DAMFD
Sbjct: 126 KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFD 185

Query: 200 ISACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPET 259
           +SA SL GD N +SIEP+LER +NKQA  VLKEK+   +E  LPS+T LASFF +F+PET
Sbjct: 186 LSAVSLYGDFNGSSIEPLLERNMNKQAMLVLKEKLEKQQEYKLPSNTSLASFFGIFQPET 245

Query: 260 SFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEK 319
           SF NY+E++EAD+ L++GLTNLYK +  G++ AD +F KA + +K  L  N ++ ++K+K
Sbjct: 246 SFENYDENSEADKALLDGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSEDASLKQK 305

Query: 320 TAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDK 379
            AIALE+ GI  ++KN+ + AH+ +K A+E  PR N+YIY +LI +D    +EY  NF+K
Sbjct: 306 AAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEK 365

Query: 380 ALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFD 439
           ALEL+PN  A+YYHRGQ +FI QQ+E+AGKDF+K KEL+E+NIF YIQLACL YRE KF 
Sbjct: 366 ALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREGKFS 425

Query: 440 DCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAP 499
           D ETLFSEARRKFPT+PEVPNF+AE L+D+G+   A KE+D A +LE+   + IHVG++P
Sbjct: 426 DSETLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESAL-DGIHVGVSP 484

Query: 500 LIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEE 559
           LIGKATLL  +P+VENF+E  +L ++AC+ DPRSEQA++GLAQLKLQQEDIDEAI LFEE
Sbjct: 485 LIGKATLLSREPSVENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDEAIALFEE 544

Query: 560 AAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
           AA+LA+S++EKLQATTFAEA KIQK+IRADP + AKI +T+   R+Q
Sbjct: 545 AADLARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQ 591

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/530 (62%), Positives = 419/530 (79%), Gaps = 1/530 (0%)

Query: 80  TKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL 139
           T K IY V SNGEP+LS  DS ++E K ++AMALKDKGN+ FK   FE+A+KYY+YAL L
Sbjct: 75  TAKVIYPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTL 134

Query: 140 KDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFD 199
           K DP++YSNISACY SL Q EKV+E +T+ALKL+  +SK L+RRA AYE++ N+ DAM D
Sbjct: 135 KQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAMVD 194

Query: 200 ISACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPET 259
           +S  SLNGD N ASIEP+LER LNKQA  VLKEKI+ NK Q LPS+T LASFF VFKPE 
Sbjct: 195 LSVLSLNGDFNGASIEPMLERNLNKQAMQVLKEKIAENKPQLLPSNTSLASFFGVFKPEV 254

Query: 260 SFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEK 319
           S  N+ E++E+++EL+NGLTNLY  + +G+ +AD+SF KA +L + +  +NK+N  IKEK
Sbjct: 255 SLNNFNENSESEKELLNGLTNLYSRTNDGYLVADESFQKAVKLLEKEYEENKENNDIKEK 314

Query: 320 TAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDK 379
            AIALEY+GIL ++KN+ L AH+ I+ AI + PRVNSYIY SLI +D   T E ++NFD 
Sbjct: 315 YAIALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILADKGETEESIKNFDA 374

Query: 380 ALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFD 439
           A+ L+  N A YYHRGQ YF+ QQYEKAG DFDK KELDE+NI  YIQLACLAY+E+KF+
Sbjct: 375 AINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLAYKENKFN 434

Query: 440 DCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAP 499
           DCETLFSEARRKFPTAPEVPNF+A+VL +R E +KA+K++D + +LE +  E IHVGIAP
Sbjct: 435 DCETLFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKLE-EAVEGIHVGIAP 493

Query: 500 LIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEE 559
           +IGKATLL   P VEN +E  +L +EAC  DPRSEQA++GLAQLKLQQE++DEAI LFEE
Sbjct: 494 MIGKATLLARNPIVENLLESTELFEEACKLDPRSEQAKIGLAQLKLQQEEVDEAIALFEE 553

Query: 560 AAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQMSM 609
           AA LA++ +EKLQATTFAEA+K+QK++R+DP ++ KI++T+   + Q  M
Sbjct: 554 AAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQGLM 603

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/524 (60%), Positives = 413/524 (78%), Gaps = 1/524 (0%)

Query: 83  PIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDD 142
           P Y V+  GEP+LS++  L++E K+++AM LKDKGNE FK  K+++AI+YY +A+++K+D
Sbjct: 68  PSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKED 127

Query: 143 PIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISA 202
           P++YSN SACY SL Q EKV+E  T ALKL+P +SK L+RRA A E++GNF DAMFD+SA
Sbjct: 128 PVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSA 187

Query: 203 CSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPETSFA 262
            SL GD + ASIEP+LER +NKQ+  VLKEK+   +E  LPS+T LASFF +F+PET+F 
Sbjct: 188 VSLYGDFSGASIEPLLERNMNKQSMLVLKEKLEKQQEYKLPSNTSLASFFGIFQPETTFE 247

Query: 263 NYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAI 322
           NY++++EAD+ L+ GLTNLYK + +G++ AD SF KA + FK  L QN ++  +K K AI
Sbjct: 248 NYDDNSEADKYLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDADLKRKAAI 307

Query: 323 ALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALE 382
           ALE+ GI  ++KN+ + AH+ +K A+E  PR N+YIY +LI +D    +EY  NF+KAL+
Sbjct: 308 ALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALK 367

Query: 383 LEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCE 442
           L+P+  A+YYHRGQ YFI QQ+E+AGKDF+K KEL E+NIF YIQLACL YRE KFDD E
Sbjct: 368 LDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREGKFDDSE 427

Query: 443 TLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIG 502
           TLFSEARRKFPTAPEVPNF+AE L+D+G+   A K++D A +LE    + IHVG++PLIG
Sbjct: 428 TLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLE-DALDGIHVGVSPLIG 486

Query: 503 KATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAE 562
           KATLL  +P+VENFVE  QL ++AC  DPRSEQA++GLAQLKLQQEDIDEAI LFEEAA+
Sbjct: 487 KATLLSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAAD 546

Query: 563 LAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
           LA+S++EKLQATTFAEA KIQK+IRADP + AKI +T+   R+Q
Sbjct: 547 LARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQ 590

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/522 (59%), Positives = 402/522 (77%), Gaps = 1/522 (0%)

Query: 85  YLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI 144
           Y VD NGEP+LS + + TEE K ++AMALKDKGNE FK  ++E+AIK+Y  ALKLK+DP+
Sbjct: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129

Query: 145 YYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACS 204
           +YSN SACY  L + EKV+E  T ALKL+P +SK L+RRA A E++GN+ DAM D+SA S
Sbjct: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189

Query: 205 LNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPETSFANY 264
           L G  +  +IEP+LER +NKQA  VLK+K+S  ++  LPS+T LASFFR+F  ETS  NY
Sbjct: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFFRIFPSETSLENY 249

Query: 265 EESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAIAL 324
           +E++EADR L+ GL  L+      ++IAD++F  A E F      N DN A+K+K AIAL
Sbjct: 250 DETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAIAL 309

Query: 325 EYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALELE 384
           E+ GIL ++KNE L+AH+ ++ AI+L PR NSYIY  LI +D     EY QNF+KALEL+
Sbjct: 310 EHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALELD 369

Query: 385 PNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETL 444
           P + A YYHR Q  F+ QQ+++AGKDFDK KE D + ++ YIQLACLAYRE KFDDCETL
Sbjct: 370 PKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCETL 429

Query: 445 FSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKA 504
           FSEARR+FPTAPEVPNF+AE+L+D+G+ E A+KE+D A +LE    E IHVG+APL+GKA
Sbjct: 430 FSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLE-DAQEGIHVGVAPLVGKA 488

Query: 505 TLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAELA 564
            LL  +P+  NF E  +L + AC+KDPRSEQA++GLAQLKLQQE++DEAI+LFE AA+L+
Sbjct: 489 ALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADLS 548

Query: 565 KSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
           +++EEKLQATTFAEAAKIQKRIRADP M AKI++T++  R+Q
Sbjct: 549 RAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQ 590

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/524 (60%), Positives = 403/524 (76%), Gaps = 5/524 (0%)

Query: 85  YLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI 144
           Y VDSNGEP+LS +DS TEE K  ++MA+KDKGNE FK  K+E+AIKYY  AL+LK DP+
Sbjct: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLKKDPV 132

Query: 145 YYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACS 204
           +YSN SAC+  L + EKV+E  T AL+L+P +SK L+RRA A E++GNF DAM D+SA S
Sbjct: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192

Query: 205 LNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPETSFANY 264
           L G  N  SIEP+LER +NKQA  VLK K++   +  LPS+T LASFF +F  ETSFANY
Sbjct: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFFGIFPSETSFANY 252

Query: 265 EESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNE--AIKEKTAI 322
           +E +EAD  L+ GL  L +     ++++D+ F KAA+L    LS   D+E  A++ K AI
Sbjct: 253 DEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLL--SLSHQADSEDPALRMKLAI 310

Query: 323 ALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALE 382
           ALE+ GI  ++KNE L+A+  ++ A++LHPR NSYIY +LI +D   T EYLQ FDKALE
Sbjct: 311 ALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALE 370

Query: 383 LEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCE 442
           L PN+ A+YYHRGQ YF+ QQ+EK+GKDFDK KE + +NIF YIQLACLAYRE+KF+DCE
Sbjct: 371 LAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCE 430

Query: 443 TLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIG 502
           TLFSEARRKFPTAPEVPNF+AE+L+D+G+ E A+KE++ A +LE    E IHVG+APL+G
Sbjct: 431 TLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLE-DAQEGIHVGVAPLVG 489

Query: 503 KATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAE 562
           KAT+L  +    +F E   L +EAC KDPRSEQA++GLAQLKLQQE +DEAIQLFEEA +
Sbjct: 490 KATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATD 549

Query: 563 LAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
           LA+++EEKLQATTFAEAAKIQKRIRADP M AKI++T+E  R Q
Sbjct: 550 LARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQ 593

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/531 (58%), Positives = 408/531 (76%)

Query: 79  TTKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALK 138
           T  KPIY V  NGEPNL + D  TEE K ++++ALKDKGN LFK  KFE+AIKYY++A++
Sbjct: 80  TDGKPIYPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIE 139

Query: 139 LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMF 198
           LK++PI+YSN+SACY SL + E++I+Y  KAL+L+P +SKVL+RRA A E + N+ DAMF
Sbjct: 140 LKENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMF 199

Query: 199 DISACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPE 258
           D+S  SLNGD N ASIEPILER LNKQA  VLK+K+  +K+  LPS T L++FF +FKPE
Sbjct: 200 DLSVLSLNGDYNGASIEPILERNLNKQAMSVLKDKLKNSKDDQLPSDTSLSAFFGIFKPE 259

Query: 259 TSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKE 318
            SF NY+E+N+AD+EL+NGLT+L+K   E + IADKSF+ A EL+  QL +  D+  +K 
Sbjct: 260 LSFENYDETNDADKELLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEETPDDTDLKV 319

Query: 319 KTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFD 378
           K +IA EY+GI  ++KN+   A ++I  +I+L+PR+NSYIY++LI +D   + +YL  FD
Sbjct: 320 KASIAYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLDYFD 379

Query: 379 KALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKF 438
           KAL+L+  + A+YYHR Q  F+ Q + KA  DF+K KE D  NIF YIQLACL YRE+KF
Sbjct: 380 KALKLDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRENKF 439

Query: 439 DDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIA 498
           DDCETLFSEA+RKFPT PEVPNF+AEVL D+G+ + AMK ++ A  LE  + + IHVG+A
Sbjct: 440 DDCETLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEASKDGIHVGVA 499

Query: 499 PLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFE 558
           PLIGKATLL  +PT+EN     +LL+EA   DPRSEQA++GLAQLKLQ+E+IDE+I+LFE
Sbjct: 500 PLIGKATLLAREPTLENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEEIDESIRLFE 559

Query: 559 EAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQMSM 609
           E+A+LA++ EEKLQATTFAEAAK+QK IRADP +  KI +T+   R+Q S 
Sbjct: 560 ESADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQNSF 610

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/525 (57%), Positives = 398/525 (75%), Gaps = 3/525 (0%)

Query: 84  IYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDP 143
           +Y VD+NG+P+LS  D  T E  +++A+ALKDKGNE FK   FE AI+YY  A+ LK+DP
Sbjct: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137

Query: 144 IYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISAC 203
           ++YSN SA Y S+  +EKV+E  T ALKL+P +SK  +RRA AYE +G F DAMFD+SA 
Sbjct: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197

Query: 204 SLNGDMNDASIEPILERILNKQAEFVLKEKISAN--KEQNLPSSTPLASFFRVFKPETSF 261
           SL G+ +  S+E +LER +NKQA  VL EK+  N  KE  LPS+T LASFF +F PETSF
Sbjct: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSF 257

Query: 262 ANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTA 321
            +Y+  NEAD EL  GL NLYK     +++AD+ F KAAEL+K +L  + DNE++K+K A
Sbjct: 258 DDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAA 317

Query: 322 IALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKAL 381
           IA E+ GI  + KN+ + AH +++ ++ L+PR ++YIY +LI +D    ++Y + FDKAL
Sbjct: 318 IAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKAL 377

Query: 382 ELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDC 441
           EL+PN  A+YYHRGQ +F+ + +++AG DFDK KEL+  NIFAYIQ ACLA+R+ +FDDC
Sbjct: 378 ELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDC 437

Query: 442 ETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLI 501
           ETLFSEARRKFPTAPEVPNF+AE+LA +   + A+K++D AI+LE   P  IHVGIAP+I
Sbjct: 438 ETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALP-GIHVGIAPMI 496

Query: 502 GKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAA 561
           GKAT LI  PTVENFVE  +L +EAC  DPRSEQA++GLAQLKLQQE+ID+AIQLFE+AA
Sbjct: 497 GKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAA 556

Query: 562 ELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
           +L++S++EKLQATTFAEA K+QK+IRADP +  KI + I   R+Q
Sbjct: 557 DLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQ 601

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/538 (56%), Positives = 390/538 (72%), Gaps = 13/538 (2%)

Query: 80  TKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL 139
           T+ P+Y + ++GEP+LS +DS T E +  +A+ALKDKGNELFK    E+AIKYY +AL+ 
Sbjct: 76  TETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF 135

Query: 140 KDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFD 199
           K DP++Y+NISACY SL  +EKV+E   KAL+L+P +SKVL+RRA  YE M NF DAMFD
Sbjct: 136 KKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFD 195

Query: 200 ISACSLNGDMNDASIEPILERILNKQAEFVLKEKISANK---EQNLPSSTPLASFFRVFK 256
           +S  SLN D + ASIEP+LER LNKQA  +LKE++   +   EQ LPS T +ASFF +FK
Sbjct: 196 LSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFK 255

Query: 257 PETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAI 316
           PET F  Y+E+ EADR L  GL  L+  +  GF  AD  F +A   +++  S+  D E +
Sbjct: 256 PETEFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKL 315

Query: 317 ----KEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSE 372
                EK AIALEYSGI  ++KN+ + A  ++  AI+L PRVNSYIY +L  +D+  +SE
Sbjct: 316 AQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSE 375

Query: 373 YLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLA 432
           Y+ NFDKALEL PN+ A YYHRGQ YFI Q Y+KA  DF K KELD +NIFAYIQLACL 
Sbjct: 376 YVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLC 435

Query: 433 YRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELE----AK 488
           YRE   D+C+ LF EAR KFP APEVP F+AE+LAD+G+   A K++D A  LE    AK
Sbjct: 436 YREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAK 495

Query: 489 TPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQE 548
           T   I VG+APL+GKAT+L  +P+ ENF E   L +EAC +DPRSEQA++GLAQL LQQE
Sbjct: 496 TG--IRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQE 553

Query: 549 DIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
           D+D AI++FEEAA+LA++ +EKLQA TFAEAAK+QK+IRADP + AK+ + + + R+Q
Sbjct: 554 DVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQ 611

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/541 (54%), Positives = 400/541 (73%), Gaps = 14/541 (2%)

Query: 78  PTTKKPIYLVDSNGE--PNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHY 135
           P T    YL  +  E  P+++ + + +E+ K  +A ALKDKGN LFK  +FEDAI++Y++
Sbjct: 59  PATSDKAYLTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNH 118

Query: 136 ALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGD 195
           A+KL +DP+++SNISACY SL   +KV+E +T+AL+L+P +SK L+RRA AYE MG + D
Sbjct: 119 AIKLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQD 178

Query: 196 AMFDISACSLNGDMNDASIEPILERILNKQAEFVLKEKISAN----------KEQNLPSS 245
           AMFDIS  SLNGD N +SIEP+LER LNKQA  VLKE +  +          + Q LPS+
Sbjct: 179 AMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSN 238

Query: 246 TPLASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKD 305
           T L+SFF +FKPET    Y+ESNEAD  L+ GL  LY  + +G+Q+AD+ F KAA+L+++
Sbjct: 239 TSLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYRE 298

Query: 306 QLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGS 365
           QL+ N D  A KEK A ALEY GI  ++KN+   +  ++K A+ LHPRVN+YIY +L  +
Sbjct: 299 QLANNND-AAFKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMA 357

Query: 366 DSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAY 425
           D   + +Y   F+KA+ L+PNN A+YYHRGQ YFI Q YEKAG+DF K KE D  NIF Y
Sbjct: 358 DRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPY 417

Query: 426 IQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIEL 485
           IQLACLAYRE+K  +CE LF EAR+ FPTAPEVPNF+AE+LAD+G+ ++A+K+++ A  L
Sbjct: 418 IQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRL 477

Query: 486 EAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKL 545
           E+   ++IHVGIAPL+GKAT+L  +PT ENF    QLL++AC  DPRSEQA++GLAQL+L
Sbjct: 478 ES-LQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRL 536

Query: 546 QQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRS 605
           QQE +DEAI+LFEEAA++A++ +EKLQA TFAEA K+QKRIRADP +  K+ +T+   ++
Sbjct: 537 QQEKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQA 596

Query: 606 Q 606
           Q
Sbjct: 597 Q 597

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/527 (55%), Positives = 396/527 (75%), Gaps = 6/527 (1%)

Query: 85  YLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI 144
           Y  + + +P++  I SL  E + + +M LKDKGN+ FK   + +AIKYY+ AL L  DPI
Sbjct: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156

Query: 145 YYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACS 204
           +YSNISACY SL Q +KVIE +TKAL+L P +SK L+RRA A E++ N+ DA+FD+S  S
Sbjct: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216

Query: 205 LNGDMNDASIEPILERILNKQAEFVLKEKIS----ANKEQNL-PSSTPLASFFRVFKPET 259
           LNGD + ASIEPILER LNKQA  VL E+++    +NKEQ L PS+T L SFF +F PE 
Sbjct: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276

Query: 260 SFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEK 319
           +F NY E+++AD EL+ GLTNL+K +++G+  ADK+F+KA+ LF ++L++N  ++ + EK
Sbjct: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEK 336

Query: 320 TAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDK 379
           TAIALEY+GI  ++KN+ L A   I+ AI   PRVNSY+Y +LI +D +T+ EY + FDK
Sbjct: 337 TAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDK 396

Query: 380 ALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFD 439
           ALEL P++ ++YYHRGQ YFI Q Y KA  +F+K KELDE NIF YIQLACLAYRE+ FD
Sbjct: 397 ALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFD 456

Query: 440 DCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAP 499
            C+ LF E R+KFPT PEVP F+AE+LAD+G+   A+K++D A  LE K  + IHVGIAP
Sbjct: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLE-KAQKNIHVGIAP 515

Query: 500 LIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEE 559
           L+GKAT+L  +P + N  E  QL+++AC+ DPRSEQA +GLAQLKLQ E++D AI+LFE+
Sbjct: 516 LVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEK 575

Query: 560 AAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
           AA+L+++ +EK+QA TFAEAAKIQKRIRADP + AK+ + +   RSQ
Sbjct: 576 AADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQ 622

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/516 (54%), Positives = 379/516 (73%), Gaps = 2/516 (0%)

Query: 90  NGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNI 149
           N EP++  +       KNE+A  LK +GN  FK   +E+AI YY +AL+LK+DP++YSN+
Sbjct: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125

Query: 150 SACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDM 209
           +ACY SL   ++ IE  +KAL+L P +SKVL++RA  YE +G F DA+ D++A SLNGD 
Sbjct: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185

Query: 210 NDASIEPILERILNKQAEFVLKEKISAN-KEQNLPSSTPLASFFRVFKPETSFANYEESN 268
           NDA+I+PI+ER+LNKQA   LK+ + A+ K + LPS T +A+FF VF  ET    ++ + 
Sbjct: 186 NDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATE 245

Query: 269 EADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAIALEYSG 328
           E+D+ L + LT+LY  ++EG+   D  F KA EL+K +L  ++ N    EK AIA E++ 
Sbjct: 246 ESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTA 305

Query: 329 ILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALELEPNNP 388
           IL ++KN+ L A + +  AI+LHPR  SYIY  L+ +D     EY  NF KA++L+PN  
Sbjct: 306 ILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMA 365

Query: 389 AIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETLFSEA 448
           AIYYHRGQ  FI Q+YEKAG+DFDK KE D  NIF YIQLAC++YRE  FDDCETLFSEA
Sbjct: 366 AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA 425

Query: 449 RRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKATLLI 508
           RRKFP APEVPNFFAE+L+D+GE EKA  E+DKAIELE+K+ E IHVGIAPL+GKAT L+
Sbjct: 426 RRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKS-ENIHVGIAPLVGKATTLL 484

Query: 509 SKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAELAKSYE 568
             PTVENF+E   L ++A ++DPRSE+A++GLAQ KLQQED+D+AI+LFEEAA L ++ +
Sbjct: 485 KYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLD 544

Query: 569 EKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMR 604
           EKLQATTFAEA K+Q R+RAD  + AK  + ++++R
Sbjct: 545 EKLQATTFAEATKVQMRVRADERLQAKTMKALDEIR 580

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/522 (55%), Positives = 379/522 (72%), Gaps = 3/522 (0%)

Query: 90  NGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNI 149
           NGEP+ + +D+LT + K++WA+ LKDKGNE FK   +E+A+K+Y +AL LK DP++YSN+
Sbjct: 88  NGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPVFYSNM 147

Query: 150 SACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDM 209
           SACY SL + +KVIE +TKAL+L+P +SK L+RRA A E + N+ DAMFD+S  SLN D 
Sbjct: 148 SACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLSLNNDF 207

Query: 210 NDASIEPILERILNKQAEFVL--KEKISANKEQNLPSSTPLASFFRVFKPETSFANYEES 267
           N A+IEP+LER LNKQA  VL  K K  +  E  LPS+T +ASFF +F PE SF +Y+E 
Sbjct: 208 NGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFDSYDEE 267

Query: 268 NEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAIALEYS 327
           ++AD+EL+NGL  LY      ++IA+ SF K+ EL+K  L   +D E I +K AIALEY 
Sbjct: 268 SDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAIALEYV 327

Query: 328 GILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALELEPNN 387
           GI  +++N+ + A D    +I   PRVNSYIY +LI +D     E  + FD+AL+L+PN 
Sbjct: 328 GIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALKLDPNC 387

Query: 388 PAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETLFSE 447
             IYYHRGQ  F+ Q Y  A  DF K KELDENNIF YIQLACL+YRE  F+DC+  F  
Sbjct: 388 SPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQNQFEL 447

Query: 448 ARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKATLL 507
           AR+KFP APE+P F  E+LAD+G+ + A K+++  I LE  T + IHVGIAPLIGKAT L
Sbjct: 448 ARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLE-NTQKSIHVGIAPLIGKATAL 506

Query: 508 ISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAELAKSY 567
             +PT ENF E  +LLQ+A +KDPRSEQA +GLAQLKLQ+ED+D AI+LFE+A++ ++S 
Sbjct: 507 ARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDYSRSM 566

Query: 568 EEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQMSM 609
           +EKLQATTFAEAAK+QKRIRADP + AK+ +T+ Q  +Q  M
Sbjct: 567 DEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  517 bits (1331), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 273/535 (51%), Positives = 371/535 (69%), Gaps = 12/535 (2%)

Query: 82  KPIYLVDSNGEPNLSDIDSL---TEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALK 138
           KP Y +DS  +P+ ++I+ L    E  K+++A  LK+KGN+ FK+   E+AIKYY YAL+
Sbjct: 127 KPSYPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALR 186

Query: 139 LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMF 198
           L  DP++YSNISACY ++ Q +KVIE + KAL+L+P +SK L+RRA AYEA+GN  +A++
Sbjct: 187 LDQDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALY 246

Query: 199 DISACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQN--LPSSTPLASFFRVFK 256
           D S  SL G+ +   +EP+L RIL+K +  VL+ K+   K  N  L S + L SFF +F 
Sbjct: 247 DFSILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDNKKTDNFILLSDSALVSFFGIFP 306

Query: 257 PETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNE-- 314
           PET+  NY   +EAD+EL+ GL  L K + EGF  ADK F+KA ELF ++L  ++DN+  
Sbjct: 307 PETTITNYNPDDEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDEN 366

Query: 315 -AIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTS-- 371
             + EK AIALEYSG+  ++K + L +   ++ AI+L+PR NSYIY +++ +D       
Sbjct: 367 SGLLEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKND 426

Query: 372 -EYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLAC 430
            +Y + FDKA  L PN    YYHRGQ   + Q++++A   F K KELD++N++ YIQLAC
Sbjct: 427 LDYFKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLAC 486

Query: 431 LAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTP 490
           +AY  S F  C+ LF EAR KFPT PEVP F+AE+LAD+GE E AMK++D A  LE    
Sbjct: 487 VAYYNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETAY- 545

Query: 491 EEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDI 550
           + IHVGIAPLIGKA  L   PT ENF    +LL++AC+ DPRSEQA++ LAQLKLQ EDI
Sbjct: 546 KYIHVGIAPLIGKAAALARIPTQENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDI 605

Query: 551 DEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRS 605
           D AI LFEE A+LA++Y++KLQATTFAEAAKIQKRI+ +P   AKI +T+   R+
Sbjct: 606 DTAIALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRA 660

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  501 bits (1291), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 260/536 (48%), Positives = 357/536 (66%), Gaps = 16/536 (2%)

Query: 85  YLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK-DDP 143
           Y + S+GEP+++ +  L    + E+A+ LKDKGN  F +  F+DAIKYY +A++L  +DP
Sbjct: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159

Query: 144 IYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISAC 203
           ++YSN+SACY S     KV+EY TKAL+++P  SK L+RRA A E++GNF DAMFD+S  
Sbjct: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219

Query: 204 SLNGDMNDASIEPILERILNKQAEFVLKEKISANK----EQNLPSSTPLASFFRVFKPE- 258
           SLNGD + ASIEP+LER LNKQA  VL   +S N      + LPS+T LASFF +F P+ 
Sbjct: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279

Query: 259 --TSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAI 316
             +  ++    + A   L+  L  LY  + EG+ IA+  F KA + +   LS ++ + AI
Sbjct: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339

Query: 317 KEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQN 376
           +   A+A  Y GI  ++KN+ L A   ++ +I LHP  NSYI+ +L  +D   + E+   
Sbjct: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399

Query: 377 FDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRES 436
           F KA++L+P     YYHRGQ YFI Q Y  A  DF K + L+  NI+ YIQLACL Y++ 
Sbjct: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459

Query: 437 KFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVG 496
           KF + E LF+E + KFPT PEVP FFAE+L D+G+   A+K++D A  L+ +   +IHVG
Sbjct: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQ-EVQRKIHVG 518

Query: 497 IAPLIGKATLLISKPTV-------ENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQED 549
           I PLIGKAT+L  + T        E F   I+LL EACD DPRSEQA++GLAQLKLQ E 
Sbjct: 519 IGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEK 578

Query: 550 IDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRS 605
           ID+AI+LF+++A LA++ +EKLQATTFAEAAKIQKR+RADP + AK+ QT+   R+
Sbjct: 579 IDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRA 634

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  500 bits (1288), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 258/531 (48%), Positives = 362/531 (68%), Gaps = 15/531 (2%)

Query: 90  NGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSN 148
           NGEP+++ +  L+   +  +A+ LK++GN  F    F +AIKYY YA++L  ++P++YSN
Sbjct: 107 NGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSN 166

Query: 149 ISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGD 208
           ISACY S    EKVIE+ TKAL+++P  SK L+RRA A E++GNF DAMFD+S  SLNGD
Sbjct: 167 ISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 226

Query: 209 MNDASIEPILERILNKQAEFVLKEKISANK---EQNLPSSTPLASFFRVFKPETSFANYE 265
            + ASIEP+LER LNKQA  VL E +S ++    Q LPS+T LASFF +F      ++  
Sbjct: 227 FDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVN 286

Query: 266 ESNEADRE---LMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAI 322
            S+  D     L + L  LY  ++EG+ +A+    K+ +++   LS N  ++ ++E  A+
Sbjct: 287 TSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAAL 346

Query: 323 ALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALE 382
           AL Y+GI +++KN  L A   ++ +I LHP  NSYI+ +L  +D   + E+ + F KA++
Sbjct: 347 ALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVD 406

Query: 383 LEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCE 442
           L P  P  YYHRGQ YFI Q Y+ A +DF K + L+  N++ YIQLACL Y++ KF + E
Sbjct: 407 LNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESE 466

Query: 443 TLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIG 502
             F+E + KFPT PEVP FFAE+L DRG+ + A+K++D A  LE +  E+IHVGI PLIG
Sbjct: 467 AFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLE-EVQEKIHVGIGPLIG 525

Query: 503 KATLLISK----PTV---ENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQ 555
           KAT+L  +    PT    E F   I+LL +AC+ DPRSEQA++GLAQLKLQ E IDEAI+
Sbjct: 526 KATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIE 585

Query: 556 LFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
           LFE++A LA++ +EKLQATTFAEAAKIQKR+RADP + AK+  T+ + R++
Sbjct: 586 LFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAK 636

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  498 bits (1283), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 263/537 (48%), Positives = 358/537 (66%), Gaps = 16/537 (2%)

Query: 85  YLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK-DDP 143
           Y +  +GEP++  +  L+   +  +A+ LKDKGN  F    F DAIKYY YA++L  +DP
Sbjct: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165

Query: 144 IYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISAC 203
           ++YSNISACY S    +KV+EY TKAL+++P  SK L+RRA A E++GNF DAMFD+S  
Sbjct: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225

Query: 204 SLNGDMNDASIEPILERILNKQAEFVLKEKISANKE----QNLPSSTPLASFFRVFKP-- 257
           SLNGD +  SIEP+LER LNKQA  VL E +  N +    Q LPS+T LASFF +F P  
Sbjct: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285

Query: 258 ETSFANYEES-NEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAI 316
           ETS  N     + A   L   L +LY  + EG+ IAD    KA + +   L  NK++  I
Sbjct: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345

Query: 317 KEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQN 376
           +E  A+A  Y+GI  ++KN+ L A   ++ +I LHP  NSY++ +L  +D   + E+ + 
Sbjct: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405

Query: 377 FDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRES 436
           F  A++L+P  P  YYHRGQ YFI Q Y  A  DF K + L+  N++ YIQLACL Y++ 
Sbjct: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465

Query: 437 KFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVG 496
           KF + E+LF+EA+ KFP  PEVP F+AE+L D+G+   A+K++D A  LE +  ++IHVG
Sbjct: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLE-EVQKKIHVG 524

Query: 497 IAPLIGKATLLISK----PTV---ENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQED 549
           I PLIGKAT+L  +    PT    E F   I+LL +AC+ DPRSEQA++GLAQL+LQ E 
Sbjct: 525 IGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEK 584

Query: 550 IDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
           ID AI+LF+E+A LA++ +EKLQATTFAEAAKIQKR+RADP + AK+ QT+   R+Q
Sbjct: 585 IDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQ 641

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  492 bits (1267), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 262/531 (49%), Positives = 349/531 (65%), Gaps = 16/531 (3%)

Query: 90  NGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSN 148
           NGEP++S +  LT   K  +A+ LK+KGN  F T  F +AIKYY  A++L  +DP++YSN
Sbjct: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163

Query: 149 ISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGD 208
           ISACY S     KV+EY TKAL+++P  SK L+RRA A E++GNF DAMFD+S  SLNGD
Sbjct: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223

Query: 209 MNDASIEPILERILNKQAEFVLKEKIS---ANKEQNLPSSTPLASFFRVFKPETSFANYE 265
            + ASIEP+LER LNKQA  VL E +S       Q LPS+T L SFF +F P+   +   
Sbjct: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283

Query: 266 ESNEADRE---LMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAI 322
            S+  D     L + L  LY  + EG+  ADK F  A + +   L+   D   +KE  A+
Sbjct: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDG-PLKENAAL 342

Query: 323 ALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALE 382
           A  Y+GI +++KN  L A   ++ +I LHP  NSYI+ +L  +D   + E+ + F KA++
Sbjct: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402

Query: 383 LEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCE 442
           L+   P  YYHRGQ YFI Q Y  A  DF K + L   NI+ YIQLACL Y++ KF + E
Sbjct: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462

Query: 443 TLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIG 502
            LF+E + KFPT PEVP FFAE+L D+G+   A+K++D A  LE +  E+IHVGI PLIG
Sbjct: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLE-EVQEKIHVGIGPLIG 521

Query: 503 KATLLISK----PTV---ENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQ 555
           KAT+L  +    PT    E F   I LL +AC+ DPRSEQA++GLAQLKLQ E ID+AI+
Sbjct: 522 KATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIE 581

Query: 556 LFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606
           LF+++A LA++ +EKLQATTFAEAAKIQKR+RADP + AK+  T+   R++
Sbjct: 582 LFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAK 632

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 61/108 (56%), Gaps = 7/108 (6%)

Query: 91  GEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNI 149
           GEP ++      EE K E A ALK +GN       +E AI+ Y  A++ L  D +YY+N 
Sbjct: 77  GEPKVA-----AEELKKE-AEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANR 130

Query: 150 SACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197
           +A Y+SL QYEK +E A KA K+  ++SK   R   A  A+G   +A+
Sbjct: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEAL 178

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%)

Query: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAY 433
           +Q +  A+E+ P +   Y +R  +Y   QQYEKA +D +K  ++D +    + +L    Y
Sbjct: 110 IQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKY 169

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 58/106 (54%), Gaps = 1/106 (0%)

Query: 92  EPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISA 151
           + NL+ +++ T++  NE A ALK +GNE     ++E+AIK Y  A++   +  YYSN S 
Sbjct: 65  QENLNTLEA-TQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSL 123

Query: 152 CYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197
            Y+ L +YE  +  AT A+ + P+FSK   R   A        D M
Sbjct: 124 AYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGM 169

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (55%), Gaps = 2/86 (2%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKAL 170
           LK KGN  F +  F  AI+Y+  A+     P  + YSN SACY SL Q+++ +  A + +
Sbjct: 7   LKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCV 66

Query: 171 KLRPTFSKVLMRRALAYEAMGNFGDA 196
           K+ P +SK   R   A+  +G+  DA
Sbjct: 67  KINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 117 GNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G E F  S + +A+K Y   +K   +D   YSN +A  A L+ + + I+   KA++  P 
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 176 FSKVLMRRALAYEAMGNFGDAM 197
           F +  +R+A A  A+ +F  A+
Sbjct: 457 FVRAYLRKATAQIAIKDFVKAL 478

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 117 GNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKAL----KL 172
           GN+L+K+ KF++AI  Y+ A  L  D  Y +N SA       +E  +    +A+    +L
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAWDLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGREL 322

Query: 173 RPTF---SKVLMRRALAYEAMGNFGDAM 197
           R  +   +K   R   AY    N   A+
Sbjct: 323 RADYKLIAKSFARMGNAYSKQKNLKKAI 350

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 99  DSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLL 157
           D   +E +   A  LK +GN+   T  +E AIK Y  A++ L  + +YY+N +A Y+SL 
Sbjct: 82  DDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLK 141

Query: 158 QYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197
           +Y+  +  A  A+K+ PT+SK   R   A  A G   DA+
Sbjct: 142 KYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 63/110 (57%), Gaps = 2/110 (1%)

Query: 89  SNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL-KDDPIYYS 147
           S+ EP  ++ D+   E   E A  LK +GN+ F    FE A+K Y  A++L  ++ ++Y 
Sbjct: 76  SSSEPTGNNTDAHAPEVA-ERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYG 134

Query: 148 NISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197
           N +A Y+S  ++E+ +  A  A+++ P++S+   R  LA  A+G   +AM
Sbjct: 135 NRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAM 184

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 32/60 (53%)

Query: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAY 433
           ++ + +A+EL PNN   Y +R  +Y   +++E+A +D +    ++ +    Y +L    Y
Sbjct: 116 VKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKY 175

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 52/89 (58%), Gaps = 2/89 (2%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYAT 167
           A   KD+GN  F    +++AI+ +  A+++ + P  + YSN SACY S  Q+ K +E A 
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDAN 64

Query: 168 KALKLRPTFSKVLMRRALAYEAMGNFGDA 196
           + +K+ PT+SK   R   A+  MG+  +A
Sbjct: 65  ECVKINPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 37/61 (60%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKA 169
           A A K +GN+L+K  KF++AI++Y+ A +L +D  Y +N SA       Y+  IE   +A
Sbjct: 255 ADAEKAEGNKLYKAHKFDEAIEHYNKAWELHNDITYLNNRSAAEFEKGDYQTAIETLHEA 314

Query: 170 L 170
           +
Sbjct: 315 V 315

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 66/154 (42%), Gaps = 25/154 (16%)

Query: 117 GNELFKTSKFEDAIKYYHYAL-KLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G E F    + +A+K Y   + +   D   YSN +A  + L+ + + I     A++  P 
Sbjct: 396 GKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPN 455

Query: 176 FSKVLMRRALAYEAMGNFGDAMFDISA-----CSLNGDMNDASIEPILERILNKQAEFVL 230
           F +  +R+A A  A+ +F  A+  + A       LN   N   I+ +             
Sbjct: 456 FIRAYIRKATAQIAIKDFVPAIETLDAARTKDAELNNGANSREIDQLY------------ 503

Query: 231 KEKISANKEQNLPSS---TPLASFFRVFK-PETS 260
              + AN+++  PS+   TP  ++ R  K PE +
Sbjct: 504 ---LKANQQRFQPSNANETPEQTYERAMKDPEVA 534

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 54/92 (58%), Gaps = 1/92 (1%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYAL-KLKDDPIYYSNISACYASLLQYEKVIEY 165
           +E A ALK +GN+      +E AIK Y  A+  L  + +Y++N +A Y+SL +Y++ +E 
Sbjct: 97  SEAAEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVED 156

Query: 166 ATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197
           A  A+K+ PT+SK   R   A  A G   DA+
Sbjct: 157 ANSAIKINPTYSKGYSRLGFAKFAQGKAEDAL 188

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 50/80 (62%), Gaps = 1/80 (1%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALK 171
           LK +GN+   +  FE AIK Y  A++ L  + +YY+N +A Y+SL +YE+ ++ A  A+K
Sbjct: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIK 159

Query: 172 LRPTFSKVLMRRALAYEAMG 191
           + P++SK   R   A  A+G
Sbjct: 160 VNPSYSKGYSRLGFAKYALG 179

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F    +E AI  +  A+++ + P  ++YSN SACYASL ++ + +  A + +K
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDA 196
           + PT+SK   R   A+  +G+  +A
Sbjct: 68  INPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 1/88 (1%)

Query: 117 GNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G + F    + +A+K Y   +K   +D   YSN +A  + L+ + + IE   KA++  P 
Sbjct: 397 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPN 456

Query: 176 FSKVLMRRALAYEAMGNFGDAMFDISAC 203
           F +  +R+A A  A+  F  A+  + A 
Sbjct: 457 FIRAYIRKATAQIAVKEFAAAIETLDAA 484

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 3/99 (3%)

Query: 391 YYHRGQSYFIAQQYEKAGKDFDKVKELDE--NNIFAYIQLACLAYRESKFDDCETLFSEA 448
           Y  +G + F+A+ YEKA   F K  E+ E  N++F   + AC A  + KF +      E 
Sbjct: 7   YKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLK-KFPEALNDAEEC 65

Query: 449 RRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEA 487
            +  PT  +  N         G+ ++A   + KA+EL+ 
Sbjct: 66  VKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDG 104

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (55%), Gaps = 2/86 (2%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKAL 170
            K +GN  F    FE A + +  A++  + P  + YSN SACY SL ++++ +E A + +
Sbjct: 6   FKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECV 65

Query: 171 KLRPTFSKVLMRRALAYEAMGNFGDA 196
           K+ PT+SK   R   A   +GN  DA
Sbjct: 66  KINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 7/95 (7%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKA 169
           A A K +GN+ +K  KF++AI++Y+ A  L  D  Y +N SA       YE+ I+  T+A
Sbjct: 267 ADAEKAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEKGDYEQAIKTLTEA 326

Query: 170 L----KLRPTF---SKVLMRRALAYEAMGNFGDAM 197
           +    ++R  +   SK   R   AY  M +   A+
Sbjct: 327 VDQGREMRADYKLISKSFARIGNAYLKMDDLKKAI 361

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

Query: 116 KGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRP 174
           +G E F    +  A+  Y   +K   +D   YSN +A  A L+ +   I+    A+   P
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 175 TFSKVLMRRALAYEAMGNFGDAMFDISAC 203
            F +  +R+A A  A+  F  AM  + A 
Sbjct: 467 NFVRAYIRKASAQIAVREFAPAMETLDAA 495

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F    FE AI+ +  A+++ + P  + YSN SACY S  Q+ K +E A + + 
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDA 196
           + P +SK   R   A+  +G+  +A
Sbjct: 67  INPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKA 169
           A A K +GN+ +K  KF++AI++Y  A +L  D  Y +N +A      +YE  I+  T+A
Sbjct: 259 ADAEKAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTLTEA 318

Query: 170 L 170
           +
Sbjct: 319 V 319

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 116 KGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRP 174
           +G E F    + +A+K Y   +K   +D   YSN +A  + L+ + + I+    A+   P
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 175 TFSKVLMRRALAYEAMGNF 193
            F +  +R+A A  A+  F
Sbjct: 459 NFIRAYIRKATAQIAVREF 477

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 49/76 (64%), Gaps = 1/76 (1%)

Query: 116 KGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRP 174
           +GN+     KF++AI+ Y  A+++   + +YYSN +A Y+SL QYE+ ++ A +A+++ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 175 TFSKVLMRRALAYEAM 190
           T+SK   R   A  A+
Sbjct: 161 TYSKGFSRLGFAKYAL 176

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%)

Query: 372 EYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELD 418
           E ++ +  A+E+ P+N   Y +R  +Y   +QYE+A KD ++  E+D
Sbjct: 113 EAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVD 159

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F    FE AI+ +  A+++ + P  + YSN SACYAS+ ++ + +  A + ++
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDA 196
           ++P +SK   R   A+  +G+  +A
Sbjct: 68  IKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 62/130 (47%), Gaps = 11/130 (8%)

Query: 95  LSDIDSLTEETKNEWAMALKD---------KGNELFKTSKFEDAIKYYHYALK-LKDDPI 144
           L+ + SL +E K   A A  D         +G E F  + + +A+K Y   +K   +D  
Sbjct: 364 LNKLRSLEKEQKKREAEAYIDPEKAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDAR 423

Query: 145 YYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDI-SAC 203
            YSN +A  A L+ +   I+    A++  P F +  +R+A A  A+  +  A+  + +A 
Sbjct: 424 GYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRKATAQIAVQEYAAAIETLDTAR 483

Query: 204 SLNGDMNDAS 213
             + ++N+ S
Sbjct: 484 EKDAEVNNGS 493

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKAL 170
           K KGNEL+K  +F++AI  Y  A  L  D  Y +N +A       YE  I+   KA+
Sbjct: 258 KAKGNELYKKRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEKGDYESAIKTLEKAV 314

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 49/96 (51%), Gaps = 5/96 (5%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI-----YYSNISACYASLLQYEK 161
           +E A   K++GN+L+K  +F+DA   Y  AL +K D +      Y N++AC   +  Y  
Sbjct: 67  HEIATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRS 126

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197
            I Y  +ALKL     K   R   AY  +G F D++
Sbjct: 127 CINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F    +  AI  +  A+++ + P  + YSN SACY SL ++   +  AT+ +K
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDA 196
           + P++SK   R   A+  +G+  DA
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 1/88 (1%)

Query: 117 GNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G E F  S + +A+K Y   +K   +D   YSN +A  A L+ + + I    KA++  P 
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 176 FSKVLMRRALAYEAMGNFGDAMFDISAC 203
           F +  +R+A A  A+  F  A+  + A 
Sbjct: 460 FVRAYIRKATAQIAVQEFAGALETLDAA 487

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 7/87 (8%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKAL--- 170
           K +GN+ +K  +FE+AI++Y+ A +L  D  Y +N +A       YE  I   T A+   
Sbjct: 263 KAEGNKFYKARQFEEAIEHYNKAWELHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQG 322

Query: 171 -KLRPTF---SKVLMRRALAYEAMGNF 193
            ++R  +   SK   R   AY  +G+ 
Sbjct: 323 REMRADYKVISKSFARIGNAYHKLGDL 349

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F   K+++A+  +  A+++ + P  + YSN SA YAS  ++ + ++ A +  K
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDA 196
           + P+++K   R   A+  MGN  DA
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 6/105 (5%)

Query: 117 GNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G E F    +  A+K Y   +K   +D   YSN +A  + L+ +   I    KA++  P 
Sbjct: 392 GKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPN 451

Query: 176 FSKVLMRRALAYEAMGNFGDAMFDISA-----CSLNGDMNDASIE 215
           F +  +R+A A  A+ +F  A+  + A       +NG  N   I+
Sbjct: 452 FVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGANAREID 496

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F   ++E A+  +  A+++  +P  + YSN SACY SL ++   +  A +  K
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDA 196
           + PT+SK   R   A+  +G+  +A
Sbjct: 69  INPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 4/101 (3%)

Query: 116 KGNELFKTSKFEDAIKYYHYAL-KLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRP 174
           +G + F   ++ DA+K Y   + +  DD   YSN +A  + L+ + + I    KAL+  P
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 175 TFSKVLMRRALAYEAMGNFGDAM--FDISACSLNGDMNDAS 213
            F K  +R+A A  A+  +  A+   DI A S + ++N+ S
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALETLDI-ARSKDTELNNGS 497

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 7/94 (7%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKA 169
           A A KD+GN+L+K  KF++AI++Y  A +L +D  Y +N +A       YE  I+    A
Sbjct: 258 ADAEKDEGNKLYKAHKFDEAIEHYDKAWELHNDITYLNNKAAAQYEKGDYETTIKTLEDA 317

Query: 170 L----KLRPTF---SKVLMRRALAYEAMGNFGDA 196
           +    +LR  +   +K   R   AYE + +   A
Sbjct: 318 IEKGRELRADYKIIAKAFTRMGNAYEKLNDLKKA 351

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 3/99 (3%)

Query: 391 YYHRGQSYFIAQQYEKAGKDFDKVKEL--DENNIFAYIQLACLAYRESKFDDCETLFSEA 448
           Y  +G + F A++YEKA   F K  E+  + N++    + AC    + KF D     +E 
Sbjct: 8   YKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLK-KFTDALNDANEC 66

Query: 449 RRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEA 487
            +  PT  +  N         G+ ++A K + KA+EL+A
Sbjct: 67  TKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDA 105

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 3/114 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F    ++ AI+ +  A+++ + P  + +SN SACY SL ++   +  A + +K
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERILNKQ 225
           + P++SK   R   A+  +G+  +A  D    +L  D N+ + +  LE++   Q
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESDYKK-ALELDANNKAAKDGLEQVHRTQ 121

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 117 GNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G E F  S + +A+K Y   +K   +D   YSN +A  A L+ + + I    KA++  P 
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 176 FSKVLMRRALAYEAMGNFGDAM 197
           F +  +R A A  A+  F  A+
Sbjct: 463 FVRAYIRMAAAQIAVKEFAAAL 484

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 71/144 (49%), Gaps = 11/144 (7%)

Query: 87  VDSNGEPNLSDIDSLT----EETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK-- 140
            D +G  N++ +D+L     E   +E A   K++GN+L+K  +F DA + Y+ A+ +K  
Sbjct: 48  TDGDGGSNVT-LDALKALAYEGEPHEIAGNFKNQGNDLYKVKRFRDARELYNKAIDVKCD 106

Query: 141 DDPI---YYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197
           DD I    Y+N +AC   L  Y + I     AL L P   K   R A A+ A+  F D  
Sbjct: 107 DDKINESLYANRAACELELKNYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDCK 166

Query: 198 FDISACSLNGDMNDASIEPILERI 221
             I    L  D+ + S+  +LE +
Sbjct: 167 EAIQF-GLKFDLENKSLLNLLEVV 189

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 57/114 (50%), Gaps = 7/114 (6%)

Query: 91  GEPNLSDIDSL------TEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL-KDDP 143
           G  N+SD+  L        E K + A ALK +GN+      ++ AI  Y  A+++   +P
Sbjct: 73  GLQNVSDVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNP 132

Query: 144 IYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197
            YYSN +A Y  +  +   +  A  A+KL PT+SK   R   A  A GN  DA+
Sbjct: 133 FYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAV 186

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%)

Query: 377 FDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRES 436
           + KA+E+ P+NP  Y +R  +Y + + +  A  D +   +LD     AY +L      E 
Sbjct: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180

Query: 437 KFDDCETLF 445
             +D    F
Sbjct: 181 NNEDAVHAF 189

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATK 168
           A  LK +GN+      F+ AIK Y  A++ L  + +YY+N +A ++S+  YE+ I+ A  
Sbjct: 97  AETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAES 156

Query: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAM 197
           A+K  PT+SK   R   A  A+G   DA+
Sbjct: 157 AIKTDPTYSKGYSRLGYAKFALGQAEDAL 185

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 54/89 (60%), Gaps = 2/89 (2%)

Query: 104 ETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKV 162
           ETK + A +LK +GN+      FE A+  Y  A++ L  + +YY+N +A ++SL +YE+ 
Sbjct: 92  ETKAK-AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEA 150

Query: 163 IEYATKALKLRPTFSKVLMRRALAYEAMG 191
           ++ A  A+K+ P++SK   R   A  A+G
Sbjct: 151 VKDAEDAIKVNPSYSKGYSRLGFAQYALG 179

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F    ++ AI+ +  A+++ + P  + YSN SACY SL ++   +  A + +K
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDA 196
           + P++SK   R   A+  +G+  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 117 GNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G E F  S + +A+K Y   +K   +D   YSN +A  A L+ + + I    KA++  P 
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 176 FSKVLMRRALAYEAMGNFGDAMFDISAC-SLNGDMNDAS 213
           F +  +R+A A  A+  +  A+  + A  + + ++N+ S
Sbjct: 463 FVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGS 501

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 59/133 (44%), Gaps = 17/133 (12%)

Query: 73  PQEDTPTTKK-----PIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFE 127
           PQ D+ T+K+     P        EP   D D    E   E     K +GN+ +K  +F+
Sbjct: 225 PQSDSTTSKENSSKAPQKEESKESEPMEVDEDDSKIEADKE-----KAEGNKFYKARQFD 279

Query: 128 DAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKAL----KLRPTF---SKVL 180
           +AI++Y+ A +L  D  Y +N +A      +YE  I     A+    ++R  +   SK  
Sbjct: 280 EAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQGREMRADYKVISKSF 339

Query: 181 MRRALAYEAMGNF 193
            R   AY  +G+ 
Sbjct: 340 ARIGNAYHKLGDL 352

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F    ++ AI  +  A+ + + P  + YSN SACY SL ++   ++ A + +K
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDA 196
           + P++SK   R   A+  MG+  +A
Sbjct: 69  INPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 67/132 (50%), Gaps = 12/132 (9%)

Query: 74  QEDTPTTKK-PIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKY 132
           +E+TP  K+ P+   D   EP   D+DS  +E   + A A K +GN+L+K  +F++A+  
Sbjct: 229 KEETPVKKEEPVVQAD---EPEQMDVDSNEDENAKKRAEAAKAEGNKLYKARQFDEAVAK 285

Query: 133 YHYALKLKDDPIYYSNISACYASLLQYEKVI----EYATKALKLRPTFSKVLMRRALAYE 188
           Y+ A +  +D  Y +N SA       YE  I    E   K  ++R  + KV+   A ++ 
Sbjct: 286 YNEAWEAHNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGREMRADY-KVI---AKSFA 341

Query: 189 AMGNFGDAMFDI 200
            MGN    + D+
Sbjct: 342 RMGNCYTKLNDL 353

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 1/88 (1%)

Query: 117 GNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G + F    + +A+K Y   +K   +D   YSN +A  + L+ + + I+   KA++  P 
Sbjct: 404 GKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPN 463

Query: 176 FSKVLMRRALAYEAMGNFGDAMFDISAC 203
           F +  +R+A A  A+  F  A+  + A 
Sbjct: 464 FVRAYIRKATAQIAVREFSSALETLDAA 491

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATK 168
           A A K +GN+      F  A++ Y  A+K L  + IYY+N +A ++SL ++E+ I+ A  
Sbjct: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160

Query: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAM 197
           A+K+ P++SK   R A A   +G   +A+
Sbjct: 161 AIKIDPSYSKGYSRLAFAKYGLGKHEEAL 189

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F +  F  AI+ +  A+++   P  + YSN SA Y S  Q+++ +  AT+ +K
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDA 196
           + PT+SK   R   A   +GN  +A
Sbjct: 69  INPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 117 GNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G E F    + +A+K Y   +K   +D   YSN +A  + L+ + + I+    A+K  P 
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPN 455

Query: 176 FSKVLMRRALAYEAMGNFGDAM 197
           F +  +R+A A  A+  + +A+
Sbjct: 456 FVRAYIRKATAQIAIKEYANAL 477

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVI----EYATKA 169
           K +GN+L+K  KF++AI+ Y+ A  L  D  Y +N SA       +E  I    E   + 
Sbjct: 259 KVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQG 318

Query: 170 LKLRPTF---SKVLMRRALAYEAMGNF 193
            +LR  +   +K   R   AY   G+ 
Sbjct: 319 RELRADYKIIAKSFARIGNAYHKKGDL 345

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 64/124 (51%), Gaps = 6/124 (4%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDP-----IYYSNISACYASLLQYEK 161
           +E A   K++GNEL+K  +++DA + Y+  +++K D        +SN +AC   L  Y +
Sbjct: 75  HEVAENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRR 134

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERI 221
            +    +AL+  PT  K   R A A+  +    DA   I    L  D   A+++ +L+++
Sbjct: 135 CVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIEF-GLKLDSESAALKALLQKV 193

Query: 222 LNKQ 225
           + ++
Sbjct: 194 IKRE 197

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F    ++ AI+ +  A+++   P  + YSN SACYASL ++   +  A + + 
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDA 196
           + P++SK   R   A+  +G+  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 117 GNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G + F  S + +A+K Y   +K   +D   YSN +A  A L+ + + I    KA++  P 
Sbjct: 403 GKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 176 FSKVLMRRALAYEAMGNFGDAMFDISAC-SLNGDMNDAS 213
           F +  +R+A A  A+  +  A+  + A  + + D+N+ +
Sbjct: 463 FVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGA 501

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 50/83 (60%), Gaps = 1/83 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATK 168
           A ALK +GN+   T  FE AI  Y  A++ L  + +Y++N +A Y+SL +Y + +E A  
Sbjct: 98  AEALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEA 157

Query: 169 ALKLRPTFSKVLMRRALAYEAMG 191
           A+K+ P++SK   R   A  A+G
Sbjct: 158 AIKVNPSYSKGYSRLGFAQYALG 180

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 75/156 (48%), Gaps = 5/156 (3%)

Query: 100 SLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASLLQ 158
           S+  E   + A+  K++GN   K  K+ +A++YY  A++L D   I++SN +     L  
Sbjct: 2   SIVSEEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDN 61

Query: 159 YEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPIL 218
           +   +E   K+++L P   K + RR L+Y  +  F  A  D+    L    N+ S    L
Sbjct: 62  FLTALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI-LQVKPNEQSALKAL 120

Query: 219 ERILNKQAEFVLKEKISANKEQ---NLPSSTPLASF 251
           E       E   K+ IS + E+   N+ +S  L+SF
Sbjct: 121 EVCERFIREERFKKAISGDGEESKVNVCASLQLSSF 156

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%)

Query: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDEN 420
           L++ +K++EL+P N    + RG SY    ++ KA KD   + ++  N
Sbjct: 66  LEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPN 112

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 50/86 (58%), Gaps = 2/86 (2%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKAL 170
            K +GN+ F +  +  AI+ +  A+++ + P  + +SN SACYAS   + K ++ A + +
Sbjct: 6   FKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECV 65

Query: 171 KLRPTFSKVLMRRALAYEAMGNFGDA 196
           K+ P+++K   R   A+  +G+  +A
Sbjct: 66  KINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 50/95 (52%), Gaps = 7/95 (7%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKA 169
           A A K +GN+L+K  KF++AI+ Y+ A +  +D  Y +N +A       YE  IE  TKA
Sbjct: 255 AEAAKAEGNKLYKQRKFDEAIEKYNEAWETHNDITYLNNRAAAEYEKGDYEAAIETLTKA 314

Query: 170 L----KLRPTF---SKVLMRRALAYEAMGNFGDAM 197
           +    +LR  +   SK   R   +Y  +G+   A+
Sbjct: 315 VEQGRELRADYKVISKSFARMGNSYHKLGDLKKAI 349

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 50/100 (50%), Gaps = 2/100 (2%)

Query: 116 KGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRP 174
           +G E F  + +  A++ Y   +K   +D   YSN +A  + L+ +   I    KA++  P
Sbjct: 395 QGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDP 454

Query: 175 TFSKVLMRRALAYEAMGNFGDAMFDI-SACSLNGDMNDAS 213
            F +  +R+A    A+ ++  A+  + SA + + ++N  +
Sbjct: 455 NFVRAYIRKATGQIAIKDYAGAIETLDSARTKDAEVNSGA 494

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 63/131 (48%), Gaps = 5/131 (3%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIY-----YSNISACYASLLQYEK 161
           +E A   K +GNEL+K  +F+DA + Y   L ++ +  +     ++N +AC   L  Y +
Sbjct: 80  HEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRR 139

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERI 221
            IE  +KAL + P  +K   R + A+  +    +A       +   D  + SI  +L  I
Sbjct: 140 CIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEAKSAALFANQRIDPENKSILNMLSVI 199

Query: 222 LNKQAEFVLKE 232
             K+ E  LKE
Sbjct: 200 EKKEQELKLKE 210

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 2/84 (2%)

Query: 104 ETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKV 162
           ETK + A ALK +GN+      FE AI  Y  A++ L  + IYY+N +A ++SL QY++ 
Sbjct: 88  ETKAK-AEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEA 146

Query: 163 IEYATKALKLRPTFSKVLMRRALA 186
           +  A KA+++ P +SK   R   A
Sbjct: 147 VVDAEKAIEIDPAYSKGYSRLGFA 170

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (48%), Gaps = 16/127 (12%)

Query: 74  QEDTPTTKKPIYLVDS--NGEPNLSDIDS------LTEETKNEW-------AMALKDKGN 118
           +E TP T +P  L +S    + N+S+ ++      L + +KN +       A   KD+GN
Sbjct: 86  KETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNNFSDKDKQIADTFKDEGN 145

Query: 119 ELFKTSKFEDAIKYYHYAL-KLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFS 177
            L  +  ++ AI+ Y  A+ K   DPIYYSN S  Y  +  YE  I  A   + +   FS
Sbjct: 146 RLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFS 205

Query: 178 KVLMRRA 184
           K  +R A
Sbjct: 206 KAYIRLA 212

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 63/131 (48%), Gaps = 5/131 (3%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYH--YALKLKDDPI---YYSNISACYASLLQYEK 161
           +E A   K +GNEL+K  +F+DA + Y    A++ +D  I    Y+N +AC   L  Y +
Sbjct: 80  HEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRR 139

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERI 221
            IE  +KAL + P   K   R + A+  +    +A    +  +   D  + SI  +L  I
Sbjct: 140 CIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAATFANQRIDPENKSILNMLSVI 199

Query: 222 LNKQAEFVLKE 232
             K+ E   KE
Sbjct: 200 DRKEQELKAKE 210

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 61/117 (52%), Gaps = 9/117 (7%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F    ++ AI  +  A+++ + P  + YSN SA Y S  QYE+ +  A + +K
Sbjct: 9   KQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIK 68

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDAMFDISAC---SLNGDMNDASIEPILERILNKQ 225
           + P+++K   R+  A + +  + +A      C   +L  D N+A  +  L +I++ Q
Sbjct: 69  INPSWAKGYTRKGAALQGLHKYEEA----EQCYNETLKIDPNNAIAKDSLAQIVSAQ 121

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 117 GNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G E F  + + +A+K Y   +K   DD   YSN +A  A L+ +   I    KA++  P+
Sbjct: 392 GKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPS 451

Query: 176 FSKVLMRRALAYEAMGNFGDAM 197
           F +  +R+A    A+  F  A+
Sbjct: 452 FIRAYLRKATCQIAVKEFAGAI 473

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 54/113 (47%), Gaps = 2/113 (1%)

Query: 319 KTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIY--QSLIGSDSTTTSEYLQN 376
           KTA   +  G   ++  +  KA D+   AIE+    N  +Y  +S   + S    + L +
Sbjct: 3   KTADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSD 62

Query: 377 FDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLA 429
            D+ +++ P+    Y  +G +     +YE+A + +++  ++D NN  A   LA
Sbjct: 63  ADECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNAIAKDSLA 115

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKAL 170
            K +GN  F    +E A + +  A++  + P  + YSN SAC+ SL ++ + +  A + +
Sbjct: 6   FKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECV 65

Query: 171 KLRPTFSKVLMRRALAYEAMGNFGDA 196
           K+ P +SK   R   AY  +G   +A
Sbjct: 66  KINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 7/95 (7%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKA 169
           A A K +GN+ +K  KF++AI++Y+ A  L  D  Y +N SA       YE+ I+  T+A
Sbjct: 267 ADAEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQAIKTLTEA 326

Query: 170 L----KLRPTF---SKVLMRRALAYEAMGNFGDAM 197
           +    ++R  +   SK   R   AY  + +F  A+
Sbjct: 327 VEQGREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 64/152 (42%), Gaps = 19/152 (12%)

Query: 116 KGNELFKTSKFEDAIK-YYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRP 174
           +G E F    + +A+K Y     +  +D   YSN +A  A L+ + + I+    A+   P
Sbjct: 407 QGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDP 466

Query: 175 TFSKVLMRRALAYEAMGNFGDAMFDISAC-----SLNGDMNDASIEPILERILNKQAEFV 229
            F +  +R+A A  A+  F  A+  + A       LN   N   I+ +   I   Q  F 
Sbjct: 467 NFIRAYIRKATAQIAVREFASAIETLDAARAKDTELNNGANVREIDQLY--IKASQQRFQ 524

Query: 230 LKEKISANKEQNLPSSTPLASFFRVFK-PETS 260
            ++          P+ TP  ++ R  K PE +
Sbjct: 525 PQD----------PNETPEQAYARALKDPEVA 546

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 64/126 (50%), Gaps = 6/126 (4%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKDD-PIYYSNISACYASLLQYEKVIEYATK 168
           A+  K++GN+  KT  +  AI+ Y  A+KL D   IY+SN +  +  +  ++  I    K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERILNKQAEF 228
           AL++ P   K   RR ++Y  +  F +A  D+    L    NDA+     +R L+   +F
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV-LASKPNDATA----KRGLDVCEKF 126

Query: 229 VLKEKI 234
           + +E+ 
Sbjct: 127 IREERF 132

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 62/147 (42%), Gaps = 33/147 (22%)

Query: 309 QNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYI----YQSLIG 364
           +N+ N+AIK +     +Y G +  +  E +K  D++  +I    R   ++    +QS I 
Sbjct: 16  KNRGNDAIKTQ-----DYPGAIE-LYTEAIKLDDTV--SIYFSNRAMGHLKMDNFQSGI- 66

Query: 365 SDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFA 424
                      + DKALE++P N   Y+ RG SY    +++ A KD   V     N+   
Sbjct: 67  ----------NDCDKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPND--- 113

Query: 425 YIQLACLAYRESKFDDCETLFSEARRK 451
                  A  +   D CE    E R K
Sbjct: 114 -------ATAKRGLDVCEKFIREERFK 133

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 50/90 (55%), Gaps = 2/90 (2%)

Query: 103 EETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEK 161
           EETK + A  LK +GN+      F+ AI  Y  A+ +  ++ IYY+N +A Y+SL  +EK
Sbjct: 93  EETKVK-AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEK 151

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMG 191
             E A  A+++ P +SK   R   A  A+ 
Sbjct: 152 ATEDAESAIRVDPNYSKGYSRLGFAKYALN 181

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%)

Query: 377 FDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAY 433
           + +A+ + PNN   Y +R  +Y   + +EKA +D +    +D N    Y +L    Y
Sbjct: 122 YSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKY 178

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F    F+ A++ +  A++  ++P  + YSN S  YASL ++++ +  AT+ +K
Sbjct: 8   KKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVK 67

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDA 196
           ++  +SK   R   A+  +GN  +A
Sbjct: 68  IKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 4/100 (4%)

Query: 117 GNELFKTSKFEDAIK-YYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G E F    +  A+K Y    ++   D   YSN +A  + L+ +   I+   KA+++ P+
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 176 FSKVLMRRALAYEAMGNFGDAM--FDISACSLNGDMNDAS 213
           F +  +R+A A  A+  +  A+   D+ A + + ++N+ S
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETLDV-ARTKDAEVNNGS 497

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 5/48 (10%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEK 161
           K +GN+L+K  KF++AI  Y  A  L+ D  Y +N +A      +YEK
Sbjct: 262 KAEGNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNRAAA-----EYEK 304

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 55/125 (44%), Gaps = 18/125 (14%)

Query: 379 KALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKF 438
           K+LE++PN+   +YH G+ + I   Y  A   F +    D  N   +  +  L Y+ S++
Sbjct: 297 KSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 356

Query: 439 DDCETLFSEARRKFPTAPEVPNFFAEVLADRG--------ESEKAMKEFDKAIELEAKTP 490
            D    ++ A R  P       + +EV  D G        +   A+  + +A  L+   P
Sbjct: 357 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLNDALDAYKQAARLD---P 406

Query: 491 EEIHV 495
           E +H+
Sbjct: 407 ENVHI 411

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN-FGDAM 197
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N   DA+
Sbjct: 339 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDAL 395

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKALK 171
           K +GN  F    +E A + +  A+ + + P  + YSN SACY SL ++ + ++ A + +K
Sbjct: 8   KQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVK 67

Query: 172 LRPTFSKVLMRRALAYEAMGNFGDA 196
           + P +SK   R   A   + N  DA
Sbjct: 68  INPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 61/128 (47%), Gaps = 13/128 (10%)

Query: 73  PQEDTPTTKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKY 132
           P++    T++P+     N EP   ++D   E+     A   K +GN+ +K  KF++AI++
Sbjct: 217 PKQAEAKTEEPL---KENNEPEPMEVD---EKGPQVAAEEEKAEGNKFYKARKFDEAIEH 270

Query: 133 YHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKAL----KLRPTF---SKVLMRRAL 185
           Y+ A +L  D  Y +N +A       YE  I   T A+    ++R  +   +K   R   
Sbjct: 271 YNKAWELHKDITYLNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKVIAKSFARIGN 330

Query: 186 AYEAMGNF 193
           AY  +G+ 
Sbjct: 331 AYHKLGDL 338

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 117 GNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G E F  + + +A+K Y   +K    D   YSN +A  A L+ + + I    +A++  P 
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 176 FSKVLMRRALAYEAMGNFGDAM 197
           F +  +R+A A  A+  F  A+
Sbjct: 449 FIRAYIRKASAQIAVKEFAAAV 470

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALK 171
           LK +GN+      +E AI  Y  A+K L  + IYY+N +A ++SL  Y++ +E A  A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164

Query: 172 LRPTFSKVLMRRALAYEAMG 191
           + PT+ +   R   A  A G
Sbjct: 165 IDPTYFRGYSRLGFAKYAQG 184

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 74/317 (23%), Positives = 144/317 (45%), Gaps = 37/317 (11%)

Query: 229 VLKEKISANKEQNLPSSTPLAS--FFRVFKPETSFANYEESNEADRELMNGLTNLYKNSE 286
           +L E++ ++  QN+P    L S   F +   + S + +   N+  R     L ++   S 
Sbjct: 356 LLNEQLPSHILQNMPWCLALLSRLHFEIQNHDMSLSYF---NKLRRLQPTRLKDMDVYST 412

Query: 287 EGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKS 346
             + + DK  ++ A+L  + ++Q+       +K  I     G L+ +  +  +A  ++K 
Sbjct: 413 LLWHLHDK--IRLADLCHELMAQD-------DKNCITWCCLGNLFSLNRDHDEAIKALKK 463

Query: 347 AIELHPRVNSYIYQSLIGSDSTTTSEY---LQNFDKALELEPNNPAIYYHRGQSYFIAQQ 403
           A  L+P+  +Y Y +L G + +    +      + KAL + PN+   +Y  G S     Q
Sbjct: 464 ATSLNPQF-AYAY-TLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQ 521

Query: 404 YEKAGKDFDKVKELDENNIF----AYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVP 459
           Y++A   F+K + ++  N+       + L  L  RE   D     +  A    P +    
Sbjct: 522 YDEALLHFEKARSINPVNVILNCCCGVALERLGRREKALD----FYQLACELQPNSSLAL 577

Query: 460 NFFAEVLADRGESEKAMKEFDKAIELEAKTPEE--IHVGIAPL---IGKATLLISKPTVE 514
              +++L + G+   A++ F+K   LE  TP E  +H  +  L   +G+    I++ T+ 
Sbjct: 578 FKKSQLLFNLGQYSNALQNFEK---LEQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIA 634

Query: 515 NFVE--GIQLLQEACDK 529
             ++  GIQL++EA +K
Sbjct: 635 MNLDPNGIQLVKEALEK 651

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 95/211 (45%), Gaps = 19/211 (9%)

Query: 358 IYQSLIGS--DSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVK 415
           I+ +L+    DST  S +L N  + +E  PN P  +   G  Y + + +E A K F+K  
Sbjct: 453 IFSTLLWHLHDSTRLS-HLSN--ELVETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKAT 509

Query: 416 ELDENNIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKA 475
           ++D N  +AY       +  S  D  +T  +  RR     P+  N +  +    G     
Sbjct: 510 KIDYNFAYAY---TLQGHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGL----GMCYMK 562

Query: 476 MKEFDKAIEL--EAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRS 533
           + ++DKA+    +A+    ++V +    G A   + K + +   + +Q  ++AC+  P S
Sbjct: 563 LGQYDKALLFFEKARNINPVNVILICCCGVA---LEKLSYQE--KALQYYEQACELQPSS 617

Query: 534 EQARLGLAQLKLQQEDIDEAIQLFEEAAELA 564
             A+   A L         A++ FEE A+LA
Sbjct: 618 SLAKFKKAHLLYSMARYSAALENFEELAKLA 648

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKL-KDDPIYYSNISACYASLLQYEKVIEYATK 168
           A ALK +GN+      +  A++ Y+ A+KL     +YY+N +A Y+S  +Y++ I+ A  
Sbjct: 103 AEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAES 162

Query: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAM 197
           A+K+ P +SK   R   A  A G   +A+
Sbjct: 163 AIKVEPNWSKGYSRLGFAKFAQGKSQEAL 191

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 118/255 (46%), Gaps = 32/255 (12%)

Query: 289 FQIADKSFLKAAELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAI 348
           + + DK  ++ A+L  + + Q+       +K+AI     G L+ +  +  +A  ++K A 
Sbjct: 434 WHLHDK--IRLADLCHELMEQD-------DKSAITWCCLGNLFSLNRDHDEAIKALKKAT 484

Query: 349 ELHPRVNSYIYQSLIGSDSTTTSEY---LQNFDKALELEPNNPAIYYHRGQSYFIAQQYE 405
            L PR  +Y Y +L G + +    +      + KAL + PN+   +Y  G S     QY+
Sbjct: 485 NLDPRF-AYAY-TLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYD 542

Query: 406 KAGKDFDKVKELDENNIF----AYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNF 461
           +A   F+K + ++  N+       + L  L  RE   D     +  A    P +      
Sbjct: 543 EALLHFEKARSINPVNVILNCCCGVALERLGRREKALD----FYQLACELQPNSSLALFK 598

Query: 462 FAEVLADRGESEKAMKEFDKAIELEAKTPEE--IHVGIAPL---IGKATLLISKPTVENF 516
            +++L + G+   A++ F+K   LE  TP E  IH  +  L   +G+    I++ T+   
Sbjct: 599 KSQLLFNLGQYSNALQNFEK---LEQLTPNEAPIHFLLGQLYQIVGRKKDAITQFTIAMN 655

Query: 517 VE--GIQLLQEACDK 529
           ++  GIQL++EA +K
Sbjct: 656 LDPKGIQLVKEALEK 670

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 104 ETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL-KDDPIYYSNISACYASLLQYEKV 162
           E+ NE A  LK KGN  FK   +E AI YY  A  L   +PIY+SN++     L ++++ 
Sbjct: 35  ESMNETAEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEA 94

Query: 163 IEYATKAL 170
           +    K L
Sbjct: 95  VNACDKGL 102

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 66/132 (50%), Gaps = 5/132 (3%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYY--HYALKLKDDPI---YYSNISACYASLLQYEK 161
           +E A   K +GNEL+K  +F+DA + Y    A++ +D  I    ++N +AC   L  Y +
Sbjct: 80  HEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRR 139

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERI 221
            IE  +KAL + P   K   R + A+ ++    +A       + + +  + SI  +L  I
Sbjct: 140 CIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEAKSAAIFANQSIEPENKSILNMLSVI 199

Query: 222 LNKQAEFVLKEK 233
             K+ E  +KE+
Sbjct: 200 ERKEQELKIKEQ 211

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATK 168
           A + K +GN+      +  AI+ Y  A+K L  + IYY+N +A Y+S+ +Y+  I+ A K
Sbjct: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158

Query: 169 ALKLRPTFSKVLMRRALAYEAM 190
           A+++ P +SK   R A A  A+
Sbjct: 159 AIEIDPAYSKGYSRLAFAKYAL 180

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 64/146 (43%), Gaps = 5/146 (3%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASLLQYEKVIEYATK 168
           A+  K+KGNE  K S ++ AI++Y  A+ L     IY+SN +  +     +   +     
Sbjct: 12  ALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDN 71

Query: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERILNKQAEF 228
           ALKL P   K   RR L+Y  +  F  A  D++   L    ND +    L+   N   E 
Sbjct: 72  ALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV-LKAKPNDITASNALKVCENFIREE 130

Query: 229 VLKEKISA---NKEQNLPSSTPLASF 251
             K  I     N + N+  +  L SF
Sbjct: 131 RFKNAIGGSGDNAKSNICQTLNLESF 156

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 10/74 (13%)

Query: 378 DKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESK 437
           D AL+L+P N   Y+ RG SY    ++ KA  D + V +   N+I A   L         
Sbjct: 70  DNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDITASNALKV------- 122

Query: 438 FDDCETLFSEARRK 451
              CE    E R K
Sbjct: 123 ---CENFIREERFK 133

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 53/101 (52%), Gaps = 2/101 (1%)

Query: 101 LTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASLLQY 159
           +T+E   + A+  K++GN   K  K+++A++YY  A++L D   IY+SN +     L  +
Sbjct: 2   VTQEAAQQ-ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNF 60

Query: 160 EKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDI 200
               E   KA+ L P   K + RR L+Y  +  F  A  D+
Sbjct: 61  LTAQEDCDKAIALDPKNIKAIHRRGLSYVGLLEFFKARKDL 101

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 66/140 (47%), Gaps = 15/140 (10%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI-----YYSNISACYASLLQYEK 161
           +E A   K++GN+L+K  +F+DA + Y+  +++K D        Y+N +AC   +  Y +
Sbjct: 75  HEIAGNFKNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRR 134

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERI 221
            +     AL+  P   K   R   A+ A+    +A   +    L  D ++  ++ +L+ +
Sbjct: 135 CLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVEF-GLQVDSSNKPLQSLLDIV 193

Query: 222 LNKQAEFVLKEKISANKEQN 241
           L KQ          A KEQN
Sbjct: 194 LKKQ---------EAKKEQN 204

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 53/112 (47%), Gaps = 9/112 (8%)

Query: 92  EPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKD------DPIY 145
           EP LS+ +    E  NE A+ LK +GN+  +   ++DAI  Y  A+ L        D  Y
Sbjct: 69  EPKLSEKE---RELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGY 125

Query: 146 YSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197
            SN S       +YE+  + A   +K+ PTFSK   R A A      + DAM
Sbjct: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 61/126 (48%), Gaps = 6/126 (4%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYALKL--KDDPI---YYSNISACYASLLQYEK 161
           +E A   K++ N+L+K  +F DA + Y   +K+  +D  I    ++N +AC   L  Y  
Sbjct: 82  HEIAENFKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRS 141

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERI 221
            +    KA+++ P   K   R   A+ A+G F +A  D  +  L  D  +  ++ +L  I
Sbjct: 142 CVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEA-HDAVSFGLKIDEENVPLKNLLAVI 200

Query: 222 LNKQAE 227
             ++ E
Sbjct: 201 AKRETE 206

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (52%), Gaps = 7/89 (7%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKLKDDP--IYYSNISACYASLLQYEKVIEYATKAL 170
            K +GN  F    +  AI  +  A+++ + P  + YSN SACYAS  ++E+ ++ A + +
Sbjct: 6   FKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECV 65

Query: 171 KLRPTFSKVLMRRALAYEAMGNFGDAMFD 199
           K+ P++SK   R   A      FG +  D
Sbjct: 66  KISPSWSKGYNRVGAA-----QFGLSQLD 89

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 116 KGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRP 174
           +G E F    + +A+K Y   +K    D   +SN +A  A L+ + + IE   KA+ + P
Sbjct: 386 QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDP 445

Query: 175 TFSKVLMRRALAYEAMGNFGDAM 197
            F +  +R+A A  A+  F  A+
Sbjct: 446 NFVRAYIRKATAQIAVKEFAAAI 468

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 92  EPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISA 151
           EP   ++D   E      A A K +GN+L+K  +FE+AI++Y+ A +L  D  Y +N SA
Sbjct: 230 EPEAMEVDE--EPNSRVAAEAEKAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNRSA 287

Query: 152 C 152
            
Sbjct: 288 A 288

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 5/103 (4%)

Query: 90  NGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSN 148
           N E N+ + D+ T+    E    LK +GN+     ++E AIK Y  A+  L  + IYY+N
Sbjct: 86  NVEVNIPEEDAETKAKAEE----LKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYAN 141

Query: 149 ISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMG 191
            +A ++SL +Y++ I+ A  A+ + P++ +   R   A  A G
Sbjct: 142 RAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAKYAQG 184

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALK 171
           LK +GN+      +E AI  Y  A+K L  + IYY+N +A ++SL +Y++ ++ A  A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164

Query: 172 LRPTFSKVLMRRALAYEAMG 191
           + P++ +   R   A  A G
Sbjct: 165 IDPSYFRGYSRLGFAKYAQG 184

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATK 168
           A ALK +GN+   +  ++ A++ Y  A+K L  + +Y++N +A Y +   Y++ ++ A +
Sbjct: 101 AEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEE 160

Query: 169 ALKLRPTFSKVLMRRALAYEAMGNF 193
           A+KL P +SK   R A A     NF
Sbjct: 161 AIKLDPAYSKGYSRLAYAKYVQENF 185

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 82/173 (47%), Gaps = 17/173 (9%)

Query: 362 LIGSDSTTTSEY---LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELD 418
           L G+ +  + +Y   ++ + +A+++ P N   + +R  +Y  +Q Y++A KD ++  +LD
Sbjct: 106 LEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLD 165

Query: 419 ENNIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKE 478
                 Y +LA   Y +  F+  E+L  EA +K     E+    A  +  RG  E A K 
Sbjct: 166 PAYSKGYSRLAYAKYVQENFE--ESL--EAYKKV---LEIEGDSATEVTKRG-YETAKKR 217

Query: 479 FDKAIELEAKTPEEIHVG-IAPLIGKA----TLLISKPTVENFVEGIQLLQEA 526
            ++++ LE   P E   G   P  G      + L+S   +E  +   Q++Q A
Sbjct: 218 VEESLNLEKSVPTESAGGQTNPAAGGGFPDFSSLMSG-GLEGLMNNPQMMQAA 269

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI-----YYSNISACYASLLQYEK 161
           +E A   K++GN+L+K  +F DA + Y   +++K D        Y+N +AC   L  +  
Sbjct: 75  HEIAENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRS 134

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERI 221
            I     AL   P   K   R   A+ A+  F  A   I       D ++ S E +L  I
Sbjct: 135 CISDCKTALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQ-KIDNDNKSFENLLNII 193

Query: 222 LNKQAEF 228
            NK+ E 
Sbjct: 194 KNKEEEI 200

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 64/127 (50%), Gaps = 6/127 (4%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK--DDPI---YYSNISACYASLLQYEK 161
           +E A   K++GN+L++  +++DA + Y+  +++   DD I    + N +AC   L  + +
Sbjct: 77  HEIAENFKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRR 136

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILERI 221
            I    +AL+  P   K   R   A+ ++    +A   I    L  D N+A++  +L++I
Sbjct: 137 CINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIE-FGLRFDSNNAALGALLDKI 195

Query: 222 LNKQAEF 228
           + K  E 
Sbjct: 196 VKKDEEI 202

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 74/152 (48%), Gaps = 11/152 (7%)

Query: 86  LVDSNGEPNLSD-IDSLT----EETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK 140
           L +++GE  ++D +++L     E   +E A   K++GNE +K  ++ DA + Y   + +K
Sbjct: 45  LDETDGEGGVNDNLEALKALAYEGEPHEIAGNFKNRGNEFYKLKQYRDAREVYTKGIDVK 104

Query: 141 --DDPI---YYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGD 195
             DD I    Y+N +AC   L  + K IE   KAL       K   R   A+ ++  F +
Sbjct: 105 CDDDKINESLYANRAACELELKNFRKCIEDCKKALSFNVKNIKCYYRMGKAFLSVDRFDE 164

Query: 196 AMFDISACSLNGDMNDASIEPILERILNKQAE 227
           +   I    L  D  + S++ +L+ I  +Q E
Sbjct: 165 SKESIEF-GLKIDSENKSLKNLLQAIEKRQLE 195

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 56/122 (45%), Gaps = 12/122 (9%)

Query: 379 KALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKF 438
           K+LE++P++ A +YH G+ + I   Y  A   F +    D  N   +  +  L Y+ S++
Sbjct: 296 KSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 355

Query: 439 DDCETLFSEARRKFPTAPEVPNFFAEVLADRGE-SEKAMKEFDKAIELEAKT----PEEI 493
            D    ++ A R  P       + +EV  D G   E   K+ + A++   +     P+ +
Sbjct: 356 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNKQLNDALDAYKQAARLDPDNV 408

Query: 494 HV 495
           H+
Sbjct: 409 HI 410

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMG-NFGDAM 197
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE       DA+
Sbjct: 338 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNKQLNDAL 394

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 105 TKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASLLQYEKVI 163
           T  + A+  K++GN   K   +  AI+ Y  A++L D   +Y+SN + C+  L  ++   
Sbjct: 4   TDADKALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCAS 63

Query: 164 EYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISA 202
           +   KAL L P   K   RR LA   +  F  A  D++ 
Sbjct: 64  QDCDKALALDPKNVKAYHRRGLACVGLLEFKKARADLTV 102

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQ--LACL 431
           ++ +DKA+EL+      + +R   +     ++ A +D DK   LD  N+ AY +  LAC+
Sbjct: 29  IEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACV 88

Query: 432 AYRESK 437
              E K
Sbjct: 89  GLLEFK 94

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 45/92 (48%), Gaps = 1/92 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASLLQYEKVIEYATK 168
           A+ LK++GN   K   F  AI  Y  A+ L     IY+SN +  +  L  ++  +    +
Sbjct: 12  ALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDE 71

Query: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAMFDI 200
           ALKL P  +K   RR L+Y  +  F  A  D+
Sbjct: 72  ALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDL 103

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 321 AIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNF--- 377
           A+ L+  G ++  K +  KA D    AI L         QS+  S+       L NF   
Sbjct: 12  ALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDST------QSIYFSNRALAHLKLDNFQSS 65

Query: 378 ----DKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKV 414
               D+AL+L+P N   Y+ RG SY    +++KA  D   V
Sbjct: 66  LNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIV 106

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 63/138 (45%), Gaps = 7/138 (5%)

Query: 98  IDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASL 156
           + S ++E  N+ A+  K++GN   K   F  A + Y  A++L     IY+SN +  +  L
Sbjct: 1   MSSASDEDVNK-ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKL 59

Query: 157 LQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEP 216
             ++  +    KA++L P   K   RR L+Y  +  F  A  D+    L    N    EP
Sbjct: 60  DNFQTALNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV-LRAKPN----EP 114

Query: 217 ILERILNKQAEFVLKEKI 234
           +  R L+     + KEK 
Sbjct: 115 VATRALDVCERVIRKEKF 132

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%)

Query: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKV 414
           L + +KA+EL+P N   Y+ RG SY    ++ KA KD   V
Sbjct: 66  LNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV 106

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 55/113 (48%), Gaps = 2/113 (1%)

Query: 108 EWAMALKDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASLLQYEKVIEYA 166
           E A+  KD+GN   K+  ++ AI+ Y  A++L     I+YSN +  +  L  ++  +   
Sbjct: 10  EAALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDC 69

Query: 167 TKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASIEPILE 219
             A+KL     K   RR LAY  +  F  A  D++   L    NDA+ +  LE
Sbjct: 70  NDAIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL-LKYKPNDATAKRGLE 121

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 8/90 (8%)

Query: 112 ALKDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKAL 170
            +K++GN  F+ S F  A +YY   + L+ ++PI YSN +     L ++ + I+   + L
Sbjct: 6   TVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

Query: 171 -------KLRPTFSKVLMRRALAYEAMGNF 193
                  K  P   K+L R  LA E++  F
Sbjct: 66  GKLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 5/99 (5%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKD-----DPIYYSNISACYASLLQYEK 161
           +E A   K +GN+L+K  +F DA + Y   + +K      +   Y+N +AC   +  Y +
Sbjct: 78  HEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRR 137

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDI 200
            I    +AL+L P   K   R A A+ A+    +A+  I
Sbjct: 138 CINDCKQALQLNPKNIKCYYRIAKAFTALERLDEALESI 176

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKL-KDDPIYYSNISACYASLLQYEKVIEYATK 168
           A +LK +GN+      +E AIK Y  A+ +   + +YY+N +A ++SL  Y++ I+ A  
Sbjct: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152

Query: 169 ALKLRPTFSKVLMRRALAYEAMG 191
           A+K+  ++SK   R   A  A G
Sbjct: 153 AVKVDSSYSKGYSRLGYAKFAQG 175

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 69/149 (46%), Gaps = 11/149 (7%)

Query: 88  DSNGEPNLSDIDSLT----EETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL---- 139
           D NG  N++ +D+L     E   +E A   K +GNE +K  ++ +A   Y   +++    
Sbjct: 49  DGNGGSNVT-LDALKALAYEGEPHEIAENFKKQGNEAYKLKQYRNARVLYERGIEVNCNN 107

Query: 140 -KDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMF 198
            K + + + N +AC   +  Y   I    KAL   P   K   R A A+ A+  + ++  
Sbjct: 108 DKINELLFVNKAACELEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRE 167

Query: 199 DISACSLNGDMNDASIEPILERILNKQAE 227
            I    L  D  ++S+  +L+ I+ KQ E
Sbjct: 168 SIE-FGLKVDSRNSSLLNLLKTIIKKQEE 195

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASLLQYEKVIEYATK 168
           A+ LK++GN+  K  K+  A++YY  A++L     I++SN +     L  ++  ++    
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAMFDIS 201
           AL+L P   K   RR L+   + +F  A  D+S
Sbjct: 73  ALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLS 105

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%)

Query: 158 QYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISA 202
           +Y K +EY TKA++L  T S     RALA   + NF   + D ++
Sbjct: 28  KYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 42/101 (41%), Gaps = 13/101 (12%)

Query: 321 AIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNF--- 377
           AI L+  G  Y  + +  KA +    AIEL         QS+  S+       L NF   
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDST------QSIFFSNRALAQLKLDNFQSC 66

Query: 378 ----DKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKV 414
               + ALEL+P N   Y+ RG S      ++KA  D   V
Sbjct: 67  LDDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV 107

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALK 171
           LK +GN+      +E AI  Y  A++ L  + IYY+N +A ++SL +Y++ ++ A  ++ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164

Query: 172 LRPTFSKVLMRRALAYEAMG 191
           + P++ +   R   A  A G
Sbjct: 165 IDPSYFRGYSRLGFAKYAQG 184

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYYS-----NISACYASLLQYEK 161
           +E A   K++GN+L+K  +F DA   Y+  +++K D    S     N +AC   L  Y +
Sbjct: 74  HEVAENFKNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRR 133

Query: 162 VIEYATKALKLRPTFSKVLMRRALAY 187
            I    +ALKL P   K   R   A+
Sbjct: 134 CINDCREALKLNPKNPKAFFRIGKAF 159

>CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166c CDC23
          Length = 639

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 95/228 (41%), Gaps = 41/228 (17%)

Query: 331 YYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSD-STTTSEYLQNFDKALELEPNNPA 389
           ++M N   +  ++I S  +L   +   I+Q L+  +      EYL  F+  L L PN   
Sbjct: 284 HFMSNFQFENLENINSQSKLESNIPFKIFQLLLFKEFQGNVDEYLTTFEDLLTLFPNFTF 343

Query: 390 IYYHRGQSYFIAQQYEKAGKDFDKVKE-----LDENNIFAYI--------QLACLAYRES 436
           +   +  + +    Y  + + F+K+ E     LD+ + F+ I        +LA LA   S
Sbjct: 344 LQAQKALTSYQYMDYVNSEQIFEKIMEDDPYRLDDMDTFSNILYVMQKNAKLAYLAQFVS 403

Query: 437 KFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVG 496
           + D         R +  T   + N+++     R E EK++  F +A+ L+ KT       
Sbjct: 404 QID---------RFRPETCCVIANYYSA----RQEHEKSIMYFRRALTLDKKTT------ 444

Query: 497 IAPLIGKATLLISKPTVE--NFVEGIQLLQEACDKDPRSEQARLGLAQ 542
                  A  L+    VE  N    I+  + A D DPR  +A  GL Q
Sbjct: 445 ------SAWTLMGHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQ 486

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 4/91 (4%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKL 172
           K++GN LFK   + +A+  Y   +  +  +P+ YSN +     L +Y + I+   + L+ 
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRY 67

Query: 173 RPTFSKVLMRRALAYE---AMGNFGDAMFDI 200
             T   V +R  L Y    A G  G     +
Sbjct: 68  TSTAEHVAIRSKLQYRLELAQGAVGSVQIPV 98

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 49/95 (51%), Gaps = 5/95 (5%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK--DDPI---YYSNISACYASLLQYEK 161
           +E A   K++ N+L+K  +F++A + Y   +++K  DD +    ++N++AC   +  + +
Sbjct: 75  HEVAENFKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRR 134

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDA 196
            I    KAL+  P   K   R A A+  +    +A
Sbjct: 135 CINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEA 169

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 2/86 (2%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKL--KDDPIYYSNISACYASLLQYEKVIEYATKAL 170
           LK+ GN+ +K   +E A+ Y+  AL     +  I YSN +A +  L  Y + +E     +
Sbjct: 11  LKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCV 70

Query: 171 KLRPTFSKVLMRRALAYEAMGNFGDA 196
           +L P + K   R  +AY  +    +A
Sbjct: 71  ELAPNWDKGYSRVGVAYLGLQKLDEA 96

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%)

Query: 371 SEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLAC 430
           +E L++    +EL PN    Y   G +Y   Q+ ++A ++F K  +L+E N+ A  +LA 
Sbjct: 60  AEALEDGKNCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQNVHAKKELAY 119

Query: 431 LAY 433
           + Y
Sbjct: 120 VKY 122

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 117 GNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175
           G + F   ++  A+K Y   +K     P+ + N +A +  LL   +VI+   KA+ + P+
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 176 FSKVLMRRALA 186
           + K  +R+  A
Sbjct: 496 YIKAYVRKGFA 506

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYY--HYALKLKDDPI---YYSNISACYASLLQYEK 161
           +E A   K +GNEL+K  +F+DA + Y    A++ +D  I    ++N +AC   L  Y K
Sbjct: 80  HEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRK 139

Query: 162 VIEYATKALKLRPTFSKVLMR 182
            +E   KAL + P   K   R
Sbjct: 140 CVEDCGKALTINPKNIKCYYR 160

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 9/89 (10%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYA-LKLKDDPIYYSNISACYASLLQYEKVIEYATKALK 171
           L+ KGN+L+   ++E A+ YY  A L    +P++ +N+S     L ++E  +    +AL+
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALE 70

Query: 172 LR--------PTFSKVLMRRALAYEAMGN 192
           +             KV  R+ LA+E +  
Sbjct: 71  IMKKGPVTDDKILQKVQWRKKLAHEHLAG 99

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 10/121 (8%)

Query: 86  LVDSNGEPN----LSDIDSLTEETK-NEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK 140
           L +SNGE      L  + +L  E + +E A   K++GN+LF   +F +A   Y+  +++K
Sbjct: 51  LDESNGEGGDNLELEALKALAYEGEPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIK 110

Query: 141 --DDPI---YYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGD 195
             +D I    ++N +AC   L  Y   I     AL L P   K   R   A+  + N  +
Sbjct: 111 CENDKINEALFANRAACQLELKNYRSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEE 170

Query: 196 A 196
           A
Sbjct: 171 A 171

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 87  VDSNGEPNLSDIDSLTEETK-NEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK--DDP 143
           V++ G   L  + +L  E + +E A   K++GN+L+K  +++DA   Y   +++K  DD 
Sbjct: 55  VENGGNVELEALKALAYEGEPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDS 114

Query: 144 I---YYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAY 187
           I    Y N +AC   L  +   I    KAL       K   R   AY
Sbjct: 115 INGSLYLNRAACELELRNFRSCINDCKKALNFNAKCVKAFYRMGQAY 161

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASLLQYEKVIEYATK 168
           A+  KD+GN+   +  +  AI+ Y  A++L     I++SN +     L +++  +E ++K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAMFDI 200
           A++L  +  K   RR +AY  + +F  A  D+
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDL 100

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 9/90 (10%)

Query: 112 ALKDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKAL 170
            LK KGN  FK   +E A+ YY  A+     +PI YSN +     L ++ + ++   K L
Sbjct: 6   TLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGL 65

Query: 171 KL--------RPTFSKVLMRRALAYEAMGN 192
           K+             K+  R+ +A + +GN
Sbjct: 66  KMICPENDKDGKIVQKLEWRKEIALKNIGN 95

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYALKL---KDDPI---YYSNISACYASLLQYE 160
           +E A   K++GN+L+K  +F+DA   Y   +++   KD  I    ++N +AC   L  + 
Sbjct: 73  HEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFR 132

Query: 161 KVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDA 196
           + I     AL+L P   K   R   A+ A+    +A
Sbjct: 133 RCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%)

Query: 371 SEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFA 424
           S+ ++ F  AL +EPNN   +   GQSY    + E + + F+K  ELD ++++A
Sbjct: 685 SDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLYA 738

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 7/89 (7%)

Query: 382 ELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDC 441
           E++P++ A +YH G+ + I   Y  A   F +    D  N   +  +  L Y+ S++ D 
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 442 ETLFSEARRKFPTAPEVPNFFAEVLADRG 470
              ++ A R  P       + +EV  D G
Sbjct: 367 LDAYTRAIRLNP-------YISEVWYDLG 388

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN-FGDAM 197
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N   DA+
Sbjct: 346 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDAL 402

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 49/114 (42%), Gaps = 34/114 (29%)

Query: 113 LKDKGNELFKTSKFEDAIKYYH---------YALKLKDDPIYYSNISACYASLLQYEKVI 163
            KD+  ELFKT  +  A++ Y          + L++    I YSN+ A      QY++ +
Sbjct: 348 FKDRAGELFKTGDYVAALQEYEKSANTLPHGHPLRI----ISYSNLMASQLKTGQYKESL 403

Query: 164 EYATKALKLRP---------------------TFSKVLMRRALAYEAMGNFGDA 196
             A+ ALKL P                      + K++ RRA A+E   NF +A
Sbjct: 404 HVASMALKLFPEDTTQWTQLIQNSEPSKTYRDMWPKIVQRRAEAFEHSENFQEA 457

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 5/97 (5%)

Query: 108 EWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDP---IYYSNISACYASLLQYEKVIE 164
           E A + KD+GN+  K   F+ A + Y  A++   DP   I+YSN +     L  +   + 
Sbjct: 7   ELATSYKDEGNKFLKQQDFQRANELYTKAIET--DPTQSIFYSNRALANLKLDNFMNALN 64

Query: 165 YATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDIS 201
             T A++L  +  K   RR LA   + NF  A  D +
Sbjct: 65  DCTNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFN 101

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 50/120 (41%), Gaps = 23/120 (19%)

Query: 339 KAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKAL-------ELEPNNPAIY 391
           +A++    AIE  P       QS+  S+    +  L NF  AL       EL  +N   Y
Sbjct: 27  RANELYTKAIETDPT------QSIFYSNRALANLKLDNFMNALNDCTNAIELNSSNLKAY 80

Query: 392 YHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETLFSEARRK 451
           + RG +      ++ A  DF+ V +   N+I A          ++ FD CE +  E R K
Sbjct: 81  HRRGLANIGLLNFKSARNDFNIVLKYKPNDIIA----------KNGFDTCEKVIREERFK 130

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 76/187 (40%), Gaps = 16/187 (8%)

Query: 381 LELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDD 440
           ++  PN P  +   G    + + ++ A K F+K  +LD N  +AY       +  S  D 
Sbjct: 538 MDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAY---TLQGHEHSSNDS 594

Query: 441 CETLFSEARRKFPTAPEVPNFFAEVLADR---GESEKAMKEFDKAIELEAKTPEEIHVGI 497
            ++  +  R+     P+  N +  +       G+ E+A+  F+KA    +  P  + V I
Sbjct: 595 SDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKA---RSINPVNV-VLI 650

Query: 498 APLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLF 557
               G    L  K  V      +Q  + AC   P S  ++  + QL       + A+Q F
Sbjct: 651 CCCGGSLEKLGYKEKV------LQYYELACQLQPTSSLSKYKMGQLLYSMTRYNVALQTF 704

Query: 558 EEAAELA 564
           EE  +L 
Sbjct: 705 EELVKLV 711

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 55/159 (34%), Gaps = 39/159 (24%)

Query: 364 GSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENN-- 421
            SDS  T      + KAL  +P +   YY  G S     QYE+A   F+K + ++  N  
Sbjct: 594 SSDSAKTC-----YRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 648

Query: 422 -----------------IFAYIQLAC---------------LAYRESKFDDCETLFSEAR 449
                            +  Y +LAC               L Y  ++++     F E  
Sbjct: 649 LICCCGGSLEKLGYKEKVLQYYELACQLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELV 708

Query: 450 RKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAK 488
           +  P          +     G  + A+KE   A+ L+ K
Sbjct: 709 KLVPDDATAHYLLGQTYRIVGRKKDAVKELTVAMNLDPK 747

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 50/116 (43%), Gaps = 5/116 (4%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDIS 201
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N      D  
Sbjct: 331 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 390

Query: 202 ACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKP 257
             +   D+N+  I   LE  L KQ    L+   + NK    P++   A    + +P
Sbjct: 391 KQAARLDVNNVHIRERLE-ALTKQ----LENPGNMNKSNGAPTNASPAPPPVILQP 441

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASLLQYEKVIEYATK 168
           A+  K++GN   K   F  AI+ Y  A+ L     IY+SN +  +  +  ++  +    +
Sbjct: 12  ALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISA 202
           ALKL P   K   RRAL+  A+  F  A  D++ 
Sbjct: 72  ALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTV 105

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 50/116 (43%), Gaps = 5/116 (4%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDIS 201
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N      D  
Sbjct: 329 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 388

Query: 202 ACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKP 257
             +   D+N+  I   LE  L KQ    L+   + NK    P++   A    + +P
Sbjct: 389 KQAARLDVNNVHIRERLE-ALTKQ----LENPGNINKSNGAPTNASPAPPPVILQP 439

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 13/97 (13%)

Query: 328 GILYYMKNETLKAHDSIKSAIELHPRVNSYIYQ--SLIGSDSTTTSEYLQNFDKALELEP 385
           G+LYY   +   A D+   AI L+P ++   Y   +L  + +   ++ L ++++AL L+P
Sbjct: 455 GVLYYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDALDSYERALSLDP 514

Query: 386 NNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNI 422
            NP I           Q    A K  DK  E D NN+
Sbjct: 515 ENPVI-----------QGRLNALKIQDKKSEYDPNNV 540

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/120 (19%), Positives = 51/120 (42%), Gaps = 15/120 (12%)

Query: 379 KALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKF 438
           K+LEL+P +   +Y+ G+ +   + +  A +   +    D  N   +  +  L Y+  + 
Sbjct: 405 KSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQN 464

Query: 439 DDCETLFSEARRKFPTAPEVPNFFAEVLADRG--------ESEKAMKEFDKAIELEAKTP 490
            D    ++ A R  P       + +EV  + G        +   A+  +++A+ L+ + P
Sbjct: 465 HDALDAYTRAIRLNP-------YISEVWYNLGTLYETCNDQITDALDSYERALSLDPENP 517

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 24/48 (50%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEA 189
           +PI++ +I   Y  + Q    ++  T+A++L P  S+V       YE 
Sbjct: 447 NPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYET 494

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 1/86 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDIS 201
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N      D  
Sbjct: 323 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 382

Query: 202 ACSLNGDMNDASIEPILERILNKQAE 227
             +   D+N+  I   LE  L KQ E
Sbjct: 383 KQAARLDVNNVHIRERLE-ALTKQLE 407

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 51/115 (44%)

Query: 372 EYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACL 431
           E ++ FDKA +L+PN    Y  +G  Y     Y+ A   + K    D ++  AY  +   
Sbjct: 608 EAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMC 667

Query: 432 AYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELE 486
           + +  +++     F +AR   P+   +       +   G  EKA+  ++ A +++
Sbjct: 668 SMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQ 722

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 69/177 (38%), Gaps = 10/177 (5%)

Query: 388 PAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETLFSE 447
           P  +   G  + + + +++A + FDK  +LD N ++AY            +D  +T + +
Sbjct: 590 PETWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRK 649

Query: 448 ARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKATLL 507
           A                     GE E+A+  F+KA          I+   A LI    + 
Sbjct: 650 AISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKA--------RSINPSNAILICCCGVT 701

Query: 508 ISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAELA 564
           + K  + N  + +   + AC   P S  A+   A L        +A+  FEE  ++A
Sbjct: 702 MEK--LGNQEKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIA 756

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 36.2 bits (82), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 6/88 (6%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKL 172
           K++GN  FK   ++ A + Y   + ++ ++PI YSN +     L +Y +V+E   K L  
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 173 RP-----TFSKVLMRRALAYEAMGNFGD 195
            P      + K+  R  +A + M +  D
Sbjct: 67  TPNTTDTVYKKLNYRLEMALKNMKHVND 94

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 52/119 (43%), Gaps = 36/119 (30%)

Query: 111 MALKDKGNELFKTSKFEDAIKYY---------HYALKLKDDPIYYSNISACYASLLQYEK 161
           +  K +G+ELFK   +  A++ Y         ++ L++    I YSNI A    + +Y K
Sbjct: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRI----ISYSNIIATQLKIGEYSK 470

Query: 162 VIEYATKALKLRP-----------------------TFSKVLMRRALAYEAMGNFGDAM 197
            IE    AL L P                        +SK++MR+A +YE + N+  A+
Sbjct: 471 SIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 5/95 (5%)

Query: 107 NEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDD-----PIYYSNISACYASLLQYEK 161
           +E A   K++GN+L++  +++DA + Y+  + +K D        +SN +AC   L  Y +
Sbjct: 75  HEVAENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRR 134

Query: 162 VIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDA 196
            +    +AL+      K   R A A+  +    DA
Sbjct: 135 CVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 79/187 (42%), Gaps = 16/187 (8%)

Query: 381 LELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDD 440
           ++  PN P  +   G    + + ++ A K F+K  +LD N  +AY       +  S  D 
Sbjct: 533 MDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAY---TLQGHEHSSNDS 589

Query: 441 CETLFSEARRKFPTAPEVPNFFAEVLADR---GESEKAMKEFDKAIELEAKTPEEIHVGI 497
            ++  +  R+     P+  N +  +       G+ E+A+  F+K     A++   ++V +
Sbjct: 590 SDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEK-----ARSINPVNVVL 644

Query: 498 APLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLF 557
               G +   + K   +   + +Q  + AC   P S  ++  + QL       + A+Q F
Sbjct: 645 ICCCGGS---LEKLGYKE--KALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTF 699

Query: 558 EEAAELA 564
           EE  +L 
Sbjct: 700 EELVKLV 706

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 48/113 (42%)

Query: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAY 433
           ++ F+KA +L+PN    Y  +G  +      + A   + K    D  +  AY  L   A 
Sbjct: 560 IKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAM 619

Query: 434 RESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELE 486
           +  ++++    F +AR   P    +       L   G  EKA++ ++ A  L+
Sbjct: 620 KLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQ 672

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 57/164 (34%), Gaps = 39/164 (23%)

Query: 364 GSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNI- 422
            SDS  T      + KAL  +P +   YY  G S     QYE+A   F+K + ++  N+ 
Sbjct: 589 SSDSAKTC-----YRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVV 643

Query: 423 ------------------FAYIQLAC---------------LAYRESKFDDCETLFSEAR 449
                               Y +LAC               L Y  ++++     F E  
Sbjct: 644 LICCCGGSLEKLGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELV 703

Query: 450 RKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEI 493
           +  P          +     G  + A+KE   A+ L+ K  + I
Sbjct: 704 KLVPDDATAHYLLGQTYRIVGRKKDAIKELTVAMNLDPKGNQVI 747

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 1/90 (1%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASLLQYEKVIEYATKALKL 172
           K++GN L K   F  AI+ Y  A+ L     IY+SN +  +  +  ++  +    +A+KL
Sbjct: 16  KNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKL 75

Query: 173 RPTFSKVLMRRALAYEAMGNFGDAMFDISA 202
            P   K   RRAL+  A+  F  A  D++ 
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKAKRDLNV 105

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQ--LACL 431
           ++ + +A++L+      + +R  S+F    ++ A  D D+  +LD  NI AY +  L+C+
Sbjct: 32  IEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCM 91

Query: 432 AYRESK 437
           A  E K
Sbjct: 92  ALLEFK 97

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 8/106 (7%)

Query: 101 LTEETKN---EWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDP---IYYSNISACYA 154
           +TEE K    E A+ LK++GN+  K   +  A +YY  A++   DP   I YSN +    
Sbjct: 1   MTEEVKACNPEKALELKNEGNKFVKEKLYAKAAEYYTKAIE--HDPENTILYSNRAFTNL 58

Query: 155 SLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDI 200
            L  ++  ++ A +A++L     K   RRA++Y  +  F  A  D+
Sbjct: 59  KLDNFQSSLDDAKRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDL 104

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 75/183 (40%), Gaps = 16/183 (8%)

Query: 385 PNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETL 444
           PN P  +   G    + + +E A K F+K  ++D N  +AY       +  S  D  +T 
Sbjct: 532 PNAPQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAY---TLQGHEHSSNDSFDTA 588

Query: 445 FSEARRKFPTAPEVPNFFAEV---LADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLI 501
            +  R+     P+  N +  +       G+ ++A+  F+K     A++   I+V +    
Sbjct: 589 KNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEK-----ARSINPINVILICCC 643

Query: 502 GKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAA 561
           G     ++   ++   + +   + AC+  P S  A    A L         A+Q FEE  
Sbjct: 644 G-----VALEKLQYQEKALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELT 698

Query: 562 ELA 564
           +LA
Sbjct: 699 KLA 701

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 51/122 (41%)

Query: 372 EYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACL 431
           E L +F+KA  + P N  +    G +    Q  EKA   ++   EL  ++  A  + A L
Sbjct: 621 EALLHFEKARSINPINVILICCCGVALEKLQYQEKALSYYELACELQPSSSLANFKRAHL 680

Query: 432 AYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPE 491
            Y   ++      F E  +  P    V     ++    G  + A+KEF  A+ L+ K  +
Sbjct: 681 LYSMGRYSVALQYFEELTKLAPDEATVHFLLGQLYQILGRKKDAVKEFTIAMNLDPKGNQ 740

Query: 492 EI 493
            I
Sbjct: 741 LI 742

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 117 GNELFKTSKFEDAIKYYHYALKLKDDPIYYSNISACYASL--LQY-EKVIEYATKALKLR 173
           G    K  ++++A+ ++  A  +  +PI    I  C  +L  LQY EK + Y   A +L+
Sbjct: 610 GMSCMKLGQYDEALLHFEKARSI--NPINVILICCCGVALEKLQYQEKALSYYELACELQ 667

Query: 174 PTFSKVLMRRALAYEAMGNFGDAM 197
           P+ S    +RA    +MG +  A+
Sbjct: 668 PSSSLANFKRAHLLYSMGRYSVAL 691

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 65/150 (43%), Gaps = 26/150 (17%)

Query: 97  DIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI------------ 144
           D +S +E  K   A  +K+ G +LFK   F+DA   Y  AL+  ++ I            
Sbjct: 268 DPESFSESYKA--ANKIKESGTQLFKKKDFQDAFFKYRKALRYVNEYIPDMDVDEELSVK 325

Query: 145 -------YYSNISACYASLLQYEKVIEYATKALKLR--PTF--SKVLMRRALAYEAMGNF 193
                   Y NIS    +L +Y+  I +AT  L++   PT   +K   RR   Y A    
Sbjct: 326 FAELKMKLYLNISLVLFNLKKYDSAITHATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRL 385

Query: 194 GDAMFDISACSLNGDMNDASIEPILERILN 223
            +A+ D   C  N + +D  I+  +E + N
Sbjct: 386 EEALKDYKNCKEN-NPDDKVIDQKIESVEN 414

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 48/89 (53%), Gaps = 2/89 (2%)

Query: 120 LFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSK 178
            +    ++  +  +  AL +K DD + ++ + A  A+  + E+ I+   KAL+L+PTF +
Sbjct: 429 FYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 488

Query: 179 VLMRRALAYEAMGNFGDAM-FDISACSLN 206
                A++   MG F +A  + ++A S++
Sbjct: 489 ARCNLAVSCMNMGCFKEAAEYLLTALSMH 517

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 37.7 bits (86), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 75/187 (40%), Gaps = 16/187 (8%)

Query: 381 LELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDD 440
           ++  PN P  +   G    + + ++ A K F+K  +LD N  +AY       +  S  D 
Sbjct: 526 MDTMPNKPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAY---TLQGHEHSSNDS 582

Query: 441 CETLFSEARRKFPTAPEVPNFFAEVLADR---GESEKAMKEFDKAIELEAKTPEEIHVGI 497
            ++  +  R+     P+  N +  +       G+ E+A+  F+KA    +  P  + V I
Sbjct: 583 SDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKA---RSINPVNV-VLI 638

Query: 498 APLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLF 557
               G    L  K       + +Q  + AC   P S  ++  + QL         A+Q F
Sbjct: 639 CCCGGSLEKLGYKE------KALQYYELACHLQPTSSLSKYKMGQLLYSMTRYSVALQTF 692

Query: 558 EEAAELA 564
           EE  +L 
Sbjct: 693 EELVKLV 699

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 48/113 (42%)

Query: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAY 433
           ++ F+KA +L+PN    Y  +G  +      + A   + K    D  +  AY  L   + 
Sbjct: 553 IKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSM 612

Query: 434 RESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELE 486
           +  ++++    F +AR   P    +       L   G  EKA++ ++ A  L+
Sbjct: 613 KLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQ 665

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 43/101 (42%), Gaps = 13/101 (12%)

Query: 321 AIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNF--- 377
           A+A +  G  Y  +   +KA +    AIEL P       QS+  S+       L NF   
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIELDPT------QSIFFSNRALAQLKLDNFQSC 65

Query: 378 ----DKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKV 414
               D AL L+P N   Y+ RG S+    Q +KA  D   V
Sbjct: 66  MNDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 33/78 (42%), Gaps = 10/78 (12%)

Query: 123 TSKFEDAIKYYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMR 182
           TS F DA          K+  + + N    Y     Y K IE  ++A++L PT S     
Sbjct: 2   TSAFADA----------KEQAVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSN 51

Query: 183 RALAYEAMGNFGDAMFDI 200
           RALA   + NF   M D 
Sbjct: 52  RALAQLKLDNFQSCMNDC 69

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 1/86 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDIS 201
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N      D  
Sbjct: 333 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 392

Query: 202 ACSLNGDMNDASIEPILERILNKQAE 227
             +   D+N+  I   LE  L KQ E
Sbjct: 393 KQAARLDVNNIHIRERLE-ALTKQLE 417

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 52/125 (41%), Gaps = 18/125 (14%)

Query: 379 KALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKF 438
           K+LE++  +   +YH G+ + +   Y  A   F +    D  N   +  +  L Y+ S++
Sbjct: 299 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQY 358

Query: 439 DDCETLFSEARRKFPTAPEVPNFFAEVLADRG--------ESEKAMKEFDKAIELEAKTP 490
            D    ++ A R  P       + +EV  D G        +   A+  + +A  L+   P
Sbjct: 359 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLD---P 408

Query: 491 EEIHV 495
             +H+
Sbjct: 409 NNVHI 413

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN-FGDAM 197
           +P ++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N   DA+
Sbjct: 341 NPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 397

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 45/81 (55%), Gaps = 4/81 (4%)

Query: 347 AIELHPRVNSYIYQSLIGS---DSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQ 403
           AI++  R  ++ Y+ +IG    +    SE ++ F  AL ++PN+   +   GQ+YF   +
Sbjct: 676 AIKMELRSTNWPYR-VIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGR 734

Query: 404 YEKAGKDFDKVKELDENNIFA 424
            E + K F+K  E+D  +++A
Sbjct: 735 VEASTKVFEKAIEIDPLHLYA 755

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI-YYSNISACYASLLQYEKVIEYATK 168
           A  LK+KGNE  K  ++  AI  Y  A+KL      YY+N +  Y     ++  I  A K
Sbjct: 134 AEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANK 193

Query: 169 AL----KLRPTFSKVLMRRALAYEAMGNF 193
           ++    K+ PT  K   R  LA   +G++
Sbjct: 194 SIEIDSKIHPTNFKAYYRLGLAKYEIGDY 222

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%)

Query: 158 QYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFD 199
           QY K I   + A+KL PT       RALAY    NF  A+ D
Sbjct: 149 QYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIID 190

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 55/128 (42%), Gaps = 34/128 (26%)

Query: 114 KDKGNELFKTSKFEDAIKYY---------HYALKLKDDPIYYSNISACYASLLQYEKVIE 164
           KD+G E FK   +  A + Y         ++AL++    + YSN++A    + +Y++ + 
Sbjct: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRI----VAYSNLTAALFKVGEYKRCLS 332

Query: 165 YATKALKLRP---------------------TFSKVLMRRALAYEAMGNFGDAMFDISAC 203
               AL++ P                      + K++ RRA A+E + N+  A+ D  + 
Sbjct: 333 DIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392

Query: 204 SLNGDMND 211
               + ND
Sbjct: 393 IEKNNFND 400

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 52/105 (49%), Gaps = 3/105 (2%)

Query: 101 LTEETKNEWAMAL--KDKGNELFKTSKFEDAIKYYHYALKL-KDDPIYYSNISACYASLL 157
           ++  T ++ A AL  K++GN   K   F  AI+ Y  A+ L     IY+SN +  +  + 
Sbjct: 1   MSTPTASDCAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVD 60

Query: 158 QYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISA 202
            ++  +    +A+KL P   K   RRAL+  A+  F  A  D++ 
Sbjct: 61  NFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNV 105

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 52/125 (41%), Gaps = 18/125 (14%)

Query: 379 KALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKF 438
           K+LE++  +   +YH G+ + I   Y  A   F +    D  N   +  +  L Y+ +++
Sbjct: 349 KSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQY 408

Query: 439 DDCETLFSEARRKFPTAPEVPNFFAEVLADRG--------ESEKAMKEFDKAIELEAKTP 490
            D    ++ A R  P       + +EV  D G        +   A+  + +A  L+   P
Sbjct: 409 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQVNDALDAYKQAARLD---P 458

Query: 491 EEIHV 495
             +H+
Sbjct: 459 NNVHI 463

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 32/73 (43%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDIS 201
           +P ++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N  +   D  
Sbjct: 391 NPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQVNDALDAY 450

Query: 202 ACSLNGDMNDASI 214
             +   D N+  I
Sbjct: 451 KQAARLDPNNVHI 463

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 26/104 (25%)

Query: 116 KGNELFKTSKFEDAIKYYHYALKL--KDDP---IYYSNISACYASLLQYEKVIEYATKAL 170
           +G+  FK   +  A++ Y  +L    +  P   I YSNI+A    + +Y  +++ A KAL
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 171 KLRP---------------------TFSKVLMRRALAYEAMGNF 193
           KL P                      +SK+++R+A A E + NF
Sbjct: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 1/92 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASLLQYEKVIEYATK 168
           A+  KD+GN+  K   F  A + Y  A++L D   I++SN +  +     ++  +    K
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAMFDI 200
           AL+L     K   RR L+Y  +  F  A  D+
Sbjct: 72  ALELDSKNIKAYHRRGLSYVGLLEFKKARTDL 103

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 7/100 (7%)

Query: 320 TAIALEY--SGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGS---DSTTTSEYL 374
           +A ALEY   G  +  K + +KA +    AIEL    + +     +     D+   S  L
Sbjct: 9   SAKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLS--L 66

Query: 375 QNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKV 414
            + DKALEL+  N   Y+ RG SY    +++KA  D   V
Sbjct: 67  NDCDKALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKD-DPIYYSNISACYASLLQYEKVIEYATK 168
           A+  K++GN   K   F  AI+ Y  A+ L     IY+SN +  +  +  ++  +    +
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 169 ALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISA 202
           A+KL P   K   RRAL+  A+  F  A  D++ 
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKARKDLNV 105

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 83/190 (43%), Gaps = 16/190 (8%)

Query: 378 DKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESK 437
           ++ LE +P+ P  +   G  Y + + +++A + F+K  E+D +  + Y       +  S 
Sbjct: 499 NELLETQPDKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGY---TLQGHEHSS 555

Query: 438 FDDCETLFSEARRKFPTAPEVPNFF---AEVLADRGESEKAMKEFDKAIELEAKTPEEIH 494
            D  +   +  R+   + P+  N +          G+ E+A+  F+K     A++   ++
Sbjct: 556 NDSIDMAKTCYRKAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEK-----ARSINPVN 610

Query: 495 VGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAI 554
           V +    G A   + K + +   + +Q  + A +  P S  A+   A L         A+
Sbjct: 611 VILICCCGVA---LEKMSYQE--KALQYYELASELQPSSSLAKFKKAHLLYVMARYSVAL 665

Query: 555 QLFEEAAELA 564
           + FEE AELA
Sbjct: 666 ENFEELAELA 675

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN-FGDAM 197
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N   DA+
Sbjct: 319 NPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 375

>CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa]
           {ON} similar to uniprot|P89105 Saccharomyces cerevisiae
           YOL145c CTR9 required for G1 cyclin expression
          Length = 1110

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 83/186 (44%), Gaps = 28/186 (15%)

Query: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAY 433
           +Q +++AL+L+PNN      +  S  +       GK  + + E + +  F     A LA 
Sbjct: 237 IQAWERALQLDPNN------KQASILVL-----LGKFHNSLTEAENDEDFKEKYAAALA- 284

Query: 434 RESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAI-ELEAKTPEE 492
                 D  T+++ ++     +P +          +G+ EK +   D+ I +L    PE 
Sbjct: 285 ------DLNTVYTNSKE----SPVLLVLLQTFFFFKGDYEKVITIHDQKISKLSFLAPES 334

Query: 493 IHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDE 552
           ++       G+A+  +      ++ +   + QE+  +D  +  ARLGL Q +++   ++E
Sbjct: 335 VYSESLFWCGRASYAMG-----DYRKAFTMFQESLKRDENNLLARLGLGQTQIKNSLVEE 389

Query: 553 AIQLFE 558
           +I  FE
Sbjct: 390 SILTFE 395

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 34.3 bits (77), Expect = 0.21,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKL 172
           K++GNEL+K   + DAI  Y   +  +  +P+ +SN +     L ++ + IE   + L+L
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 173 RPTFSKVLMRRALAY 187
             +     +R  L Y
Sbjct: 68  AASPQHAALRAKLLY 82

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN-FGDAM 197
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N   DA+
Sbjct: 331 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDAL 387

>ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} similar
           to uniprot|P19735 Saccharomyces cerevisiae YBR055C PRP6
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 867

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 52/253 (20%), Positives = 108/253 (42%), Gaps = 26/253 (10%)

Query: 356 SYIYQSLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVK 415
           S +Y   I  +     + L+  D+A  + PN+  ++  + +   +  Q E A K F    
Sbjct: 528 SLMYSKEIWKNGHDIPKSLEILDRAQNILPNSLEVWLAKLKFLCLTDQVELAQKSFAMAM 587

Query: 416 E-LDENNI-----FAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADR 469
           E L ++ +       Y  ++ L +R       + L      KFP  P+      ++  D 
Sbjct: 588 ERLRDSQVPHLEKLYYKYISFLRFRRQNTAAIKMLNETCIPKFPNCPKFYLQLGQIHYDL 647

Query: 470 GESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDK 529
           G++E++   F++  ++    P+ I + I+ L     + + +P     +  + LL     K
Sbjct: 648 GQTEESQMAFERGTKM---LPQGIPLWIS-LARIEEIDLKRPAKARSIFDLALL-----K 698

Query: 530 DPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRAD 589
           +P +E   L  AQ++ +  + D+A  + +++ +     +    AT +AE       IR  
Sbjct: 699 NPANETLSLARAQMEARLGNYDQARFIIQQSLQ-----KHSKSATLWAE------NIRIL 747

Query: 590 PAMDAKIRQTIEQ 602
           P   A +++T+ Q
Sbjct: 748 PLKRANVKKTVFQ 760

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN-FGDAM 197
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N   DA+
Sbjct: 344 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDAL 400

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
           antiviral protein
          Length = 1411

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 7/122 (5%)

Query: 371 SEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFA-YIQLA 429
           +E +Q F  AL ++P +   +   GQSY    + E + K F++  +LDE++ +A Y +  
Sbjct: 696 AESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDLDEHHSYALYYKAV 755

Query: 430 C---LAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEV---LADRGESEKAMKEFDKAI 483
           C   L   E        L  E  +  P         +E    L  +G   K++ E  KAI
Sbjct: 756 CHSQLGEYEESLKLMYNLVGENPKTIPFKVSCATLISEYSKDLYSQGYLLKSISESQKAI 815

Query: 484 EL 485
            L
Sbjct: 816 LL 817

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 120 LFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSK 178
            +    ++  +  +  AL ++ DD + ++ + A  A+  + E+ I+   KAL+L+PTF +
Sbjct: 436 FYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 495

Query: 179 VLMRRALAYEAMGNFGDA 196
                A++   MG + +A
Sbjct: 496 ARCNLAVSCMNMGCYKEA 513

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 6/105 (5%)

Query: 284 NSEEGFQIA-DKSFLKAAELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHD 342
           NS++G ++A D++  K  E+   Q   N  N+       + L   G+L+Y  NE  K  D
Sbjct: 395 NSDDGIEMAFDQNRYKLNEIVTKQF-LNIANKLPNADADVQLGL-GLLFYSNNEFDKTID 452

Query: 343 SIKSAIELHPRVNSYIYQSLIGS--DSTTTSEYLQNFDKALELEP 385
             K+A+ +HP  +  ++  L  S  +S+   E +Q + KAL+L+P
Sbjct: 453 CFKTALVIHPE-DELMWNRLGASLANSSRPEEAIQAYHKALQLKP 496

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 73/182 (40%), Gaps = 16/182 (8%)

Query: 386 NNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETLF 445
           N P  +   G  + + + +++A K F+KV +LD    + Y   A     +  FD  +  F
Sbjct: 563 NEPQTWCCLGNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNYF 622

Query: 446 SEARRKFPTAPEVPNFFAEV---LADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIG 502
              R+   T  +  N +  +       GE E A+  F+KA  +        +V +    G
Sbjct: 623 ---RKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPS-----NVILICCCG 674

Query: 503 KATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAE 562
            A   +S P      + +   + AC   P S  A+   A L     +   A++ FEE  +
Sbjct: 675 VAFEKLSYPE-----KALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTK 729

Query: 563 LA 564
           LA
Sbjct: 730 LA 731

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 4/106 (3%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDIS 201
           +P ++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N      D  
Sbjct: 345 NPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAY 404

Query: 202 ACSLNGDMNDASI----EPILERILNKQAEFVLKEKISANKEQNLP 243
             +   D N+  I    E + E++ N+    V+  +  A    N P
Sbjct: 405 KQAARLDTNNVHIRERLEALTEQLANQSNGNVMAHQPKAATASNPP 450

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 79/187 (42%), Gaps = 16/187 (8%)

Query: 381 LELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDD 440
           +++ PN P  +   G    + + ++ A K F+K  +LD N  +AY       +  S  D 
Sbjct: 544 MDIMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAY---TLQGHEHSSNDS 600

Query: 441 CETLFSEARRKFPTAPEVPNFFAEVLADR---GESEKAMKEFDKAIELEAKTPEEIHVGI 497
            ++  +  R+      +  N +  +       G+ E+A+  F+K     A++   ++V +
Sbjct: 601 SDSAKTCYRKALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEK-----ARSINPVNVVL 655

Query: 498 APLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLF 557
               G +   + K   +   + +Q  + AC   P S  ++  + QL       + A+Q F
Sbjct: 656 ICCCGGS---LEKLGYKE--KALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTF 710

Query: 558 EEAAELA 564
           EE  +L 
Sbjct: 711 EELVKLV 717

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 48/113 (42%)

Query: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAY 433
           ++ F+KA +L+PN    Y  +G  +      + A   + K    D  +  AY  L   + 
Sbjct: 571 IKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDSQHYNAYYGLGTSSM 630

Query: 434 RESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELE 486
           +  ++++    F +AR   P    +       L   G  EKA++ ++ A  L+
Sbjct: 631 KLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQ 683

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 82/199 (41%), Gaps = 44/199 (22%)

Query: 372 EYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACL 431
           E +  F KA++L+P     Y  +G  Y     ++ A   F K   +++ +  A   L   
Sbjct: 510 EAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKTHYNALYGLGMC 569

Query: 432 AYRESKFDDCETLFSEARRKFPT----------------APE-VPNFF------------ 462
             +  KF++    F +AR   P                  PE   NF+            
Sbjct: 570 CVKLGKFEEALLFFEKARALNPVNVILNCCCGVALERLQQPERALNFYELATELQPNSSL 629

Query: 463 -----AEVLADRGESEKAMKEFDKAIELEAKTPEEIHV-----GIAPLIGKATLLISKPT 512
                +++L + G+   A+  F++   LE+ TP+E HV      +  ++GK    +++ T
Sbjct: 630 ALFKKSQLLLNMGQYSSALHNFER---LESLTPDEAHVHFLLGNLYQIVGKKQDAMNQYT 686

Query: 513 VENFVE--GIQLLQEACDK 529
           +   ++  G QL++EA +K
Sbjct: 687 IAMNLDPKGSQLIKEAMEK 705

>KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
           dsRNA virus protection family member contains 8 copies
           of the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%)

Query: 371 SEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLAC 430
           +E ++ F  ++ +  ++   +   GQ+Y    + E + K F KV ELDEN+ FA+  LA 
Sbjct: 686 AESIEWFQSSIRVSSSDVESWVGLGQAYLNCGRVEASIKVFKKVLELDENHHFAWYFLAI 745

Query: 431 LAYRESKFD 439
                 +FD
Sbjct: 746 ALSALGEFD 754

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 49/121 (40%), Gaps = 18/121 (14%)

Query: 97  DIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALK----LKDDPIYYSNISAC 152
           D+ +L     +   M L  +   LF+   F  ++K +   L     LK DP     I AC
Sbjct: 184 DVTNLATTNASPNCMFLLLRAKLLFRKKNFMASLKLFQELLVNNPVLKPDP--RIGIGAC 241

Query: 153 YASLLQYEKVIEYATKALKLRPT------------FSKVLMRRALAYEAMGNFGDAMFDI 200
           +  L  Y+  I    ++L+L PT            F K L+      E   NF DAM D+
Sbjct: 242 FWQLKDYKMAINAWERSLELDPTNKNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDL 301

Query: 201 S 201
           S
Sbjct: 302 S 302

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 44/99 (44%)

Query: 371 SEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLAC 430
           SE ++ F  AL +EP +   +   GQ+Y+   + E + K F+K  E+   N +A+   A 
Sbjct: 698 SESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALEVSPGNAYAHYFKAL 757

Query: 431 LAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADR 469
              +   +D+   +F E   + P          EVL + 
Sbjct: 758 SLSKMGLYDESIEIFRELTAEHPDEESYQVSMVEVLVEH 796

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 73/188 (38%), Gaps = 36/188 (19%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKL--KDDP---IYYSNISACYASLLQYEKVIEYAT 167
            + KG ELFK   +  A+  Y  +L    +  P   I  SN+   Y  + +Y K ++ A 
Sbjct: 293 FRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLAP 352

Query: 168 KALKLRP---------------------TFSKVLMRRALAYEAMGNFGDAMFDISACSLN 206
            AL+L P                      +SK++MR A A E   N+  A  +      N
Sbjct: 353 LALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVAN 412

Query: 207 GDMNDASIEP--ILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPETSFANY 264
           G  N+  ++     +++LN  ++   K   +   +   P+ TP         P TS   Y
Sbjct: 413 GITNEKVMDGKRRCQKVLNPPSKVERKGTPTPTPQVVTPARTP--------DPATSKTVY 464

Query: 265 EESNEADR 272
           E +    R
Sbjct: 465 ENAERVKR 472

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN-FGDAM 197
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N   DA+
Sbjct: 337 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 393

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN-FGDAM 197
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N   DA+
Sbjct: 337 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 393

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 50/104 (48%), Gaps = 10/104 (9%)

Query: 120 LFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSK 178
            +  S+F+  I  +  AL +  +D + ++ + A  A+  + E+ I+   KAL+L+P+F +
Sbjct: 406 FYADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVR 465

Query: 179 VLMRRALAYEAMGNFGDA---------MFDISACSLNGDMNDAS 213
                A++   +G + +A         M ++   S NG  N  S
Sbjct: 466 ARYNLAVSSINIGCYKEAAEYLLSALKMHEVEGVSQNGTANPVS 509

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 51/111 (45%), Gaps = 26/111 (23%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKLK--DDP---IYYSNISACYASLLQYEKVIEYAT 167
            K KG  LFK   + ++++ Y  +L     + P   I  SNI A    + +Y K IE ++
Sbjct: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436

Query: 168 KALKLRPT---------------------FSKVLMRRALAYEAMGNFGDAM 197
            AL+L P+                     + K+++RRA ++E + +F  A+
Sbjct: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN-FGDAM 197
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N   DA+
Sbjct: 309 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 365

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALK 171
           LK KGN  FK   + +AI +Y+  + +   +PI YSN +       ++++ I    K L+
Sbjct: 6   LKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQ 65

Query: 172 L 172
           L
Sbjct: 66  L 66

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 30/113 (26%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKLKDDPIYY-------SNISACYASLLQYEKVIEY 165
            K++G E FKT  +  A++ Y  +L     PI +       SNI A  +   +Y K IE 
Sbjct: 397 FKERGTENFKTGDYVTALEAYQKSLNTL--PIKHPLRIIASSNILASMSKTGEYRKSIEI 454

Query: 166 ATKALKLRP---------------------TFSKVLMRRALAYEAMGNFGDAM 197
           +T AL+  P                      + K++++RA A+E + ++ +A+
Sbjct: 455 STSALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENAL 507

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 26/111 (23%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKL--KDDP---IYYSNISACYASLLQYEKVIEYAT 167
            K KG+  FK   + ++++ Y  +L     + P   I  SNI A    + +Y K IE ++
Sbjct: 377 FKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENSS 436

Query: 168 KALKLRP---------------------TFSKVLMRRALAYEAMGNFGDAM 197
            AL L P                      + K+++RRA ++E + +F +A+
Sbjct: 437 MALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNAL 487

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN-FGDAM 197
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N   DA+
Sbjct: 348 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 404

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN-FGDAM 197
           +PI++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N   DA+
Sbjct: 318 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 374

>SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} similar
           to uniprot|P09798 Saccharomyces cerevisiae YKL022C CDC16
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
           required for sporulation
          Length = 721

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 1/78 (1%)

Query: 385 PNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETL 444
           P +P  +   G  Y    +  +A K F K   LD N   A+I  A     E + +   + 
Sbjct: 430 PKSPVTWLGVGTYYLSINKVAEARKYFSKASILDPNFGQAWIGFAHTYAAEGEHEQAVSA 489

Query: 445 FSEARRKFPTAPEVPNFF 462
           +S A R FP    +PN F
Sbjct: 490 YSTASRFFP-GTHLPNLF 506

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 57/129 (44%), Gaps = 31/129 (24%)

Query: 93  PNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLK--DDP---IYYS 147
           PNL++++  + E         K+KG   F+T  +  A + Y  +L       P   + +S
Sbjct: 315 PNLTELERHSFEE-------FKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFS 367

Query: 148 NISACYASLLQYEKVIEYATKALKLRPT-------------------FSKVLMRRALAYE 188
           NI  C   + +Y + +  A+ ALKL P                    +SK++  +A+A+E
Sbjct: 368 NIIICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFE 427

Query: 189 AMGNFGDAM 197
            + N+  A+
Sbjct: 428 RVENYEKAL 436

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 67/151 (44%), Gaps = 19/151 (12%)

Query: 371 SEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFA-YIQLA 429
           ++ ++ F  AL ++PN+   +   GQ+YF   + E + K F+K  EL  ++ +A Y    
Sbjct: 701 TDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPDHNYAKYFNSV 760

Query: 430 CLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEV----------LADRGESEKAMKEF 479
            LA    + D+ E      R      PE   F  E+          L ++G   KA+   
Sbjct: 761 ALA----QMDEFERAIDILRHVLKDEPEKEVFKMELATQIVDYSFDLYNQGYLMKAIAII 816

Query: 480 DKAIELEAKTPEEIHVGIAPLIGKATLLISK 510
            +AI+L     +E+ + +  +I    + +SK
Sbjct: 817 SEAIDL----IKELVIDLDCVIQNVWITLSK 843

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 514 ENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAELA--KSYEEKL 571
           +N  + I+  Q A   DP   ++ +GL Q       ++ +I++FE+A EL+   +Y +  
Sbjct: 698 QNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPDHNYAKYF 757

Query: 572 QATTFAEAAKIQKRI 586
            +   A+  + ++ I
Sbjct: 758 NSVALAQMDEFERAI 772

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 35/80 (43%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDIS 201
           +P ++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N      D  
Sbjct: 345 NPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAY 404

Query: 202 ACSLNGDMNDASIEPILERI 221
             ++  D N+  I   LE +
Sbjct: 405 KQAVRLDPNNVHIRERLEAL 424

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 328 GILYYMKNETLKAHDSIKSAIELHPRVNSYIYQ--SLIGSDSTTTSEYLQNFDKALELEP 385
           G+LYY  ++   A D+   AI L+P ++   Y   +L  + +   S+ L  + +A+ L+P
Sbjct: 353 GVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAVRLDP 412

Query: 386 NN 387
           NN
Sbjct: 413 NN 414

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 28/112 (25%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALK---LKDDP---IYYSNISACYASLLQYEKVIEYA 166
            K KG  LFK   + ++++ Y  +L    LK  P   I  SNI A    + +Y K IE +
Sbjct: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKH-PLRIIALSNIIASQLKIGEYSKSIENS 431

Query: 167 TKALKLRPT---------------------FSKVLMRRALAYEAMGNFGDAM 197
             AL L P                      + K+++RRA ++E + +F +A+
Sbjct: 432 DTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 97/244 (39%), Gaps = 49/244 (20%)

Query: 297 LKAAELFKDQLSQNKDNEAIKE----------KTAIALEYSGILYYMKNETLKAHDSIKS 346
           LK  E+F   L   KD   + +            +I+  + G  + + N+  KA   +K 
Sbjct: 584 LKDFEIFSTVLWHLKDKINLSQISKTLIDNYPNNSISWCFIGNYFSLINDHDKAIKYLKK 643

Query: 347 AIELHPRVNSYIYQSLIGSDSTTTSEY---LQNFDKALELEPNNPAIYYHRGQSYFIAQQ 403
           A  ++PR  +Y Y +L G +  +   +      + KA+  +PN+   YY  G       Q
Sbjct: 644 ATTINPRF-TYAY-TLEGHEQASIDAFDTAKNCYRKAIACDPNHYNAYYGLGTCCMRLGQ 701

Query: 404 YEKAGKDFDKVKELDENN-------------------IFAYIQLACLAYRES---KFDDC 441
           Y++A   F+K K ++ +N                      Y +LAC     S   KF   
Sbjct: 702 YDQALLYFEKAKMINPSNAILLCCCGSALEKLNFNEKALNYYELACNLQPNSSFAKFKLA 761

Query: 442 ETLFSEARRKFP---------TAPE--VPNF-FAEVLADRGESEKAMKEFDKAIELEAKT 489
           + L+S +R              APE   P+F   ++    G  + ++KE+  A+ L+ K 
Sbjct: 762 KLLYSMSRYNLALEILEQVIEMAPEEVTPHFLLGQLYQMMGRKKDSVKEYTIAMNLDPKG 821

Query: 490 PEEI 493
            + I
Sbjct: 822 SQVI 825

>TBLA0C01590 Chr3 complement(370571..371797) [1227 bp, 408 aa] {ON}
           Anc_1.456 YJR032W
          Length = 408

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 71/161 (44%), Gaps = 26/161 (16%)

Query: 108 EWAMALKDKGNELFKTSKFEDAIKYYHYALKL-----------KDDPIYYSNI------S 150
           E A  +K+ G  LFK   F++A   Y  +L+            K++ I Y+N+      +
Sbjct: 238 EAANTIKESGTLLFKKKDFQNAFFKYKKSLRYITEYIPDMEMDKENNIKYTNLKIKLYLN 297

Query: 151 ACYA--SLLQYEKVIEYATKALKL----RPTFSKVLMRRALAYEAMGNFGDAMFDISACS 204
            C     + +YE+ I+YAT  +++    +   +K   R    Y A     DA+ D + C 
Sbjct: 298 MCLMMFDMQKYEEAIQYATYIIEMENVPKLDVAKAYYRSGNCYLAKKRLEDALKDYNLCK 357

Query: 205 LNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSS 245
            N + ND  ++  +E + N   +   KEK   N  +  PS+
Sbjct: 358 EN-NPNDKVVDQKIEHVENLIQQ--KKEKTRKNISKFFPSN 395

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 61/150 (40%), Gaps = 1/150 (0%)

Query: 340 AHDSIKSAIELHPR-VNSYIYQSLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSY 398
           A    + AI   PR  N+Y    +         E L  F+KA ++ P N  +    G + 
Sbjct: 604 AKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCGVAL 663

Query: 399 FIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEV 458
              +  +KA + ++    L  N+  A  + A L Y   +++     F E  +  P  P V
Sbjct: 664 EKLEYQDKALEYYELACTLQPNSNLARFKRANLLYAMGRYNLALQSFEELSKLTPEEPTV 723

Query: 459 PNFFAEVLADRGESEKAMKEFDKAIELEAK 488
                ++    G   +A++EF  A+ L+ K
Sbjct: 724 HFVLGQLYQIMGRKNEAIREFTVAMNLDPK 753

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 74/187 (39%), Gaps = 10/187 (5%)

Query: 378 DKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESK 437
           D  L   PN P  +   G    + + +E A + F+K  ++D    +AY            
Sbjct: 541 DYLLTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDS 600

Query: 438 FDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGI 497
           FD  +  F   R+     P   N +  +    G     +  +D+A+ L  +   +I+   
Sbjct: 601 FDAAKKCF---RKAIACDPRHYNAYYGM----GIYSMKLGHYDEAL-LYFEKARQIYPIN 652

Query: 498 APLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLF 557
           A LI    + + K   ++  + ++  + AC   P S  AR   A L       + A+Q F
Sbjct: 653 AVLICCCGVALEKLEYQD--KALEYYELACTLQPNSNLARFKRANLLYAMGRYNLALQSF 710

Query: 558 EEAAELA 564
           EE ++L 
Sbjct: 711 EELSKLT 717

>KNAG0A04560 Chr1 complement(645401..647935) [2535 bp, 844 aa] {ON}
           Anc_8.415 YDR206W
          Length = 844

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 159 YEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFD-ISAC 203
           + K +E    +L L P+FS+V  +R L Y    NFG A ++ +  C
Sbjct: 212 FAKAMELLHISLNLSPSFSEVFFQRGLIYIQCNNFGLATYEFLRGC 257

>NCAS0A08420 Chr1 complement(1667102..1668286) [1185 bp, 394 aa]
           {ON} Anc_1.456
          Length = 394

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 14/98 (14%)

Query: 366 DSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAY 425
           DS   + YL + D    L+      YY RG SY++ +  E A KD+ K KE + ++    
Sbjct: 311 DSILYATYLLDMDNVPNLDK--AKAYYRRGNSYYMKKLLEDAKKDYKKCKENNPDDKVV- 367

Query: 426 IQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFA 463
                    + K D+ + L  E + K  T   +  FF+
Sbjct: 368 ---------DQKIDEVQKLLDEKKAK--TRKNIAKFFS 394

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 2/98 (2%)

Query: 372 EYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFA-YIQLAC 430
           E ++ F  AL ++ N+   +   GQ+Y+   + E + K F+K  EL  +++FA Y +   
Sbjct: 696 ESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATELAPDHLFAGYFKAIS 755

Query: 431 LAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLAD 468
           LA    +++ C  + +    K P           +L D
Sbjct: 756 LA-GIGEYEQCIEIIAALLEKLPNEESFQVSMVNILID 792

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 46/110 (41%), Gaps = 26/110 (23%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKL--KDDPIYYSNISACYASLLQ---YEKVIEYAT 167
            KD+G E FK   +  A + Y  +L    K  P+     S   ASLL+   Y  +I  +T
Sbjct: 400 FKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITIST 459

Query: 168 KALKLRP---------------------TFSKVLMRRALAYEAMGNFGDA 196
            AL L P                      +SK++ RRA A+E + N+  A
Sbjct: 460 SALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQA 509

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%)

Query: 371 SEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFA 424
           S+ ++ F  A+ ++PN+   +   GQ+Y    + E + K F+K  ELD ++ +A
Sbjct: 682 SDSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYA 735

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 2/71 (2%)

Query: 518 EGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAEL--AKSYEEKLQATT 575
           + I+  Q A   DP   ++ +GL Q  L    I+ +I++FE+A EL  + +Y +  ++  
Sbjct: 683 DSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAKYFKSIA 742

Query: 576 FAEAAKIQKRI 586
            +E  +  + I
Sbjct: 743 LSEMGEFTESI 753

>Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON}
           (25908..28082) [2175 nt, 725 aa]
          Length = 724

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 1/78 (1%)

Query: 385 PNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETL 444
           P N   ++     Y   Q+  +A K F K   LD N   ++I  +     E + D   + 
Sbjct: 431 PKNAITWFGVATYYMTVQKISEARKYFSKSSILDPNFAPSWIGFSHTFALEGEHDQAISA 490

Query: 445 FSEARRKFPTAPEVPNFF 462
           +S A R FP    +PN F
Sbjct: 491 YSTASRFFP-GMHLPNLF 507

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%)

Query: 371 SEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFA 424
           S+ ++ F  AL ++PN+   +   GQ+Y    + E + K FDK  EL  ++ +A
Sbjct: 712 SDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIELQPSHTYA 765

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/116 (20%), Positives = 46/116 (39%), Gaps = 4/116 (3%)

Query: 132 YYHYALKLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMG 191
           + H   +   +P ++ +I   Y  + QY   ++  T+A++L P  S+V       YE   
Sbjct: 339 FQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCN 398

Query: 192 NFGDAMFDISACSLNGDMNDASI----EPILERILNKQAEFVLKEKISANKEQNLP 243
           N      D    +   D N+  I    E + E++ N+     +  ++      N P
Sbjct: 399 NQLTDALDAYKQAARLDTNNVHIRERLEALTEQLANQSNGNTMPPQLKTPAATNPP 454

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query: 373 YLQN---------FDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIF 423
           YLQN         F  A+ ++PN+   +   GQ+Y    + E + K F+K  ELD +++ 
Sbjct: 679 YLQNQQESSSIEWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDGSHLH 738

Query: 424 A-YIQLACLA 432
           A Y +   LA
Sbjct: 739 AQYFKALALA 748

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 142 DPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN-FGDAM 197
           +P ++ +I   Y  + QY   ++  T+A++L P  S+V       YE   N   DA+
Sbjct: 411 NPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDAL 467

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 120 LFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSK 178
            +  ++F+  I  +  ALK+  +D + ++ + A  A+  + E+ I+   KAL L+P+F +
Sbjct: 460 FYSNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVR 519

Query: 179 VLMRRALAYEAMGNFGDA 196
                A++   +G + +A
Sbjct: 520 ARYNLAVSSINIGCYKEA 537

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 328 GILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIG---SDSTTTSEYLQNFDKALELE 384
           G+L+Y  NE  K  D  K+A+++ P  N  +  + +G   ++S  + E +Q + KAL L+
Sbjct: 457 GLLFYSNNEFDKTIDCFKAALKVSP--NDELLWNRLGASLANSNRSEEAIQAYHKALNLK 514

Query: 385 P 385
           P
Sbjct: 515 P 515

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
           complex component and TPR protein, mediates 3'-5' RNA
           degradation by the cytoplasmic exosome; null mutants
           have superkiller phenotype of increased viral dsRNAs and
           are synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%)

Query: 371 SEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFA 424
           S+ ++ F  AL ++PN+   +   GQ+Y    + E + K FDK  +L  ++ FA
Sbjct: 719 SDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTFA 772

>ZYRO0E03300g Chr5 complement(259634..260827) [1194 bp, 397 aa] {ON}
           similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 397

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 55/131 (41%), Gaps = 23/131 (17%)

Query: 110 AMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI-------------------YYSNIS 150
           A  +K+ G  L+K   F++A   Y  +L+  ++ I                    Y N+S
Sbjct: 239 ANTIKESGTLLYKKKDFQNAYYKYIKSLRYVNEFIPEESVDKANRINFINLKSKLYLNLS 298

Query: 151 ACYASLLQYEKVIEYATKALKLR----PTFSKVLMRRALAYEAMGNFGDAMFDISACSLN 206
                L  Y++ I+YAT  L++        +K L RR  +Y A   + +A+ D  +C   
Sbjct: 299 LVLYYLQNYDESIKYATYLLEMENIPDADQAKALYRRGNSYSAKRKWEEALKDYKSCQEK 358

Query: 207 GDMNDASIEPI 217
            D +   +E I
Sbjct: 359 NDQDKVVVEKI 369

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 59/130 (45%), Gaps = 23/130 (17%)

Query: 310 NKDNEAIKEKTAIALEYSGILYYMKNETLKAH----DSIKSAIELHP--------RVNSY 357
           ++DN  +  K A  ++ SG L Y K +   A+     S++   E  P        R+N  
Sbjct: 228 DEDNFTLAFKVANTIKESGTLLYKKKDFQNAYYKYIKSLRYVNEFIPEESVDKANRINFI 287

Query: 358 IYQSLIGSDSTTTSEYLQNFDKA-------LELE----PNNPAIYYHRGQSYFIAQQYEK 406
             +S +  + +    YLQN+D++       LE+E     +     Y RG SY   +++E+
Sbjct: 288 NLKSKLYLNLSLVLYYLQNYDESIKYATYLLEMENIPDADQAKALYRRGNSYSAKRKWEE 347

Query: 407 AGKDFDKVKE 416
           A KD+   +E
Sbjct: 348 ALKDYKSCQE 357

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 60/150 (40%), Gaps = 1/150 (0%)

Query: 345 KSAIELHP-RVNSYIYQSLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQ 403
           + AI   P   N+Y    ++        E L  F+KA  + P N  +    G +      
Sbjct: 586 RKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLSY 645

Query: 404 YEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFA 463
            EKA + ++   EL  ++  A  + A L Y   ++      F E +   P    V     
Sbjct: 646 QEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVHFLLG 705

Query: 464 EVLADRGESEKAMKEFDKAIELEAKTPEEI 493
           ++ +  G  + A+KE+  A+ L+ K  + I
Sbjct: 706 QIYSILGRKKDAIKEYTIALNLDPKGRQLI 735

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 121 FKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKV 179
           +    F+  ++ +  ALK+  +D + ++ + A  A+  + E+ I+   KA+ L+P+F + 
Sbjct: 452 YSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRA 511

Query: 180 LMRRALAYEAMGNFGDA 196
               A+A   +G + +A
Sbjct: 512 RYNLAVASMNIGCYQEA 528

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALK 171
           K  GN  FK   +  A++YY   ++++ ++PI YSN +     L +Y + +E     LK
Sbjct: 7   KTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLK 65

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 41/95 (43%), Gaps = 1/95 (1%)

Query: 385 PNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETL 444
           P +   ++  G  YF      +A K F K   LD N  +A++  A     E + +   + 
Sbjct: 429 PKSSVTWFAVGTYYFSINNIPEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 488

Query: 445 FSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEF 479
           +S A R FP    +P+ +  +   R ++    +E+
Sbjct: 489 YSTAARFFP-GTHLPHLYLGMQYSRMDTLTLAEEY 522

>TPHA0G00240 Chr7 complement(37417..41709) [4293 bp, 1430 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1430

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%)

Query: 371 SEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLA 429
           +E ++ F  AL ++  +   +   GQ+Y    + E + K F+K  ELD N+++A + LA
Sbjct: 715 AESIEWFQSALRIDKEDIESWVGLGQAYVGCGRIEASIKVFEKAIELDSNHLYAKLFLA 773

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 41/95 (43%), Gaps = 1/95 (1%)

Query: 385 PNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETL 444
           P +   ++  G  YF      +A K F K   LD N  +A++  A     E + +   + 
Sbjct: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478

Query: 445 FSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEF 479
           +S A R FP    +P+ +  +   R ++    +E+
Sbjct: 479 YSTAARFFP-GTHLPHLYLGMQYSRMDTLTLAEEY 512

>ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp,
           785 aa] {ON} similar to uniprot|P09798 Saccharomyces
           cerevisiae YKL022C CDC16 Subunit of the
           anaphase-promoting complex/cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition required for sporulation
          Length = 785

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 1/76 (1%)

Query: 387 NPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCETLFS 446
           N   ++     Y + ++ E+A K F K   LD N   A++  A     E + D   + +S
Sbjct: 496 NSITWFSVATYYMVVEKIEEARKYFSKSSILDPNFAPAWLGFAHTYAIEGEQDQAISAYS 555

Query: 447 EARRKFPTAPEVPNFF 462
            A R FP    +PN F
Sbjct: 556 TAARFFP-GIHLPNLF 570

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 3/78 (3%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALK 171
           LK +GN  F+   +  A  YY   +KL+  +PI YSN +        +   +E   + LK
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 172 LRPTFSK--VLMRRALAY 187
              + +K    ++R L Y
Sbjct: 66  YTSSSTKEATTIKRKLEY 83

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 38/61 (62%), Gaps = 5/61 (8%)

Query: 328 GILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIG---SDSTTTSEYLQNFDKALELE 384
           G+L+Y K++  K  D  +SA++++P  N  +  + +G   ++S  + E +Q + +AL+L+
Sbjct: 465 GLLFYTKDDFDKTIDCFESALKVNP--NDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

Query: 385 P 385
           P
Sbjct: 523 P 523

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 37/61 (60%), Gaps = 5/61 (8%)

Query: 328 GILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIG---SDSTTTSEYLQNFDKALELE 384
           G+L+Y K++  K  D  +SA+ ++P  N  +  + +G   ++S  + E +Q + +AL+L+
Sbjct: 464 GLLFYTKDDFDKTIDCFESALRVNP--NDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

Query: 385 P 385
           P
Sbjct: 522 P 522

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 38/61 (62%), Gaps = 5/61 (8%)

Query: 328 GILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIG---SDSTTTSEYLQNFDKALELE 384
           G+L+Y K++  K  D  +SA++++P  N  +  + +G   ++S  + E +Q + +AL+L+
Sbjct: 464 GLLFYTKDDFDKTIDCFESALKVNP--NDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

Query: 385 P 385
           P
Sbjct: 522 P 522

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
           (REAL)
          Length = 1417

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 30/54 (55%)

Query: 371 SEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFA 424
           S+ ++ F  AL ++PN+   +   GQ+Y    + E + K FDK  +L  ++ +A
Sbjct: 704 SDSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTYA 757

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 38/61 (62%), Gaps = 5/61 (8%)

Query: 328 GILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIG---SDSTTTSEYLQNFDKALELE 384
           G+L+Y K++  K  D  +SA++++P  N  +  + +G   ++S  + E +Q + +AL+L+
Sbjct: 464 GLLFYTKDDFDKTIDCFESALKVNP--NDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

Query: 385 P 385
           P
Sbjct: 522 P 522

>YHR166C Chr8 complement(437170..439050) [1881 bp, 626 aa] {ON}
           CDC23Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 626

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 61/151 (40%), Gaps = 17/151 (11%)

Query: 456 PEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVE- 514
           PE     A   + R E EK++  F +A+ L+ KT              A  L+    VE 
Sbjct: 397 PETCCIIANYYSARQEHEKSIMYFRRALTLDKKTT------------NAWTLMGHEFVEL 444

Query: 515 -NFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQA 573
            N    I+  + A D  PR  +A  GL Q     +    ++  F++A  L K ++ ++  
Sbjct: 445 SNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQKACTL-KPWDRRIWQ 503

Query: 574 TTFAEAAKIQKRIRADPAMDAKIR--QTIEQ 602
                 +K   ++ A       I+  QT++Q
Sbjct: 504 VLGECYSKTGNKVEAIKCYKRSIKASQTVDQ 534

>CAGL0M05973g Chr13 (627289..628521) [1233 bp, 410 aa] {ON} highly
           similar to uniprot|P25293 Saccharomyces cerevisiae
           YKR048c NAP1 nucleosome assembly protein I
          Length = 410

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 63/137 (45%), Gaps = 22/137 (16%)

Query: 135 YALKLKDDPIYYSNISACYASLLQY--EKVIEYATKA-----LKLR-----PTFSKVLMR 182
           +   L++ PI    I+   A +L+Y  +  IEY T+      LK +     P F    + 
Sbjct: 186 WLTALENLPIVSDTITDRDAEVLEYLQDVSIEYLTEGKPGFLLKFKFSEENPYFKTPELT 245

Query: 183 RALAYEA-MGNFGDAMFDIS-ACSLNGDMNDASIEPILERILNKQAEFVLKEKISANKEQ 240
           +   Y++ +G  GD ++D +  CS++   ND+++   +E  + KQ     K+  +  K  
Sbjct: 246 KTYYYQSELGYSGDFIYDHADGCSIDWVDNDSNVTIAVE--MRKQRNKTTKQVRTIEK-- 301

Query: 241 NLPSSTPLASFFRVFKP 257
                TP+ SFF  F P
Sbjct: 302 ----ITPIESFFNFFDP 314

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 1/59 (1%)

Query: 113 LKDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKAL 170
            K KGN  +K + F DA+ +Y  A+     +P+ YSN +     L  Y    +   + L
Sbjct: 7   FKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADASQMCQRGL 65

>NCAS0A13640 Chr1 (2681868..2683133) [1266 bp, 421 aa] {ON}
           Anc_7.267 YIL071C
          Length = 421

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 15/86 (17%)

Query: 372 EYLQNFDKALELEPNNPAIYYHRGQSYFIAQ--QYEKAGKDFDKVKELDENNIFAY---- 425
           E+ QN +KA++L          R + Y  A+  +Y   G+  D  KEL E  + AY    
Sbjct: 103 EHYQNAEKAIQLLI--------RSKDYKNAEDLEYRIRGRHPDLHKELPEGELSAYRRIH 154

Query: 426 -IQLACLAYRESKFDDCETLFSEARR 450
            +  ACL   E  FD C T F+   R
Sbjct: 155 LLGCACLFIEEKYFDCCHTFFNYLNR 180

>TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa]
           {ON} Anc_5.72 YHR166C
          Length = 666

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 38/87 (43%), Gaps = 10/87 (11%)

Query: 456 PEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVEN 515
           PE     A   + R E EK++  F +AI L  K     ++    L+G   +      ++N
Sbjct: 437 PETCCIIANYYSARQEHEKSILYFRRAITLNKK-----NISAWTLMGHEFV-----ELKN 486

Query: 516 FVEGIQLLQEACDKDPRSEQARLGLAQ 542
               I+  + A D +PR  +A  GL Q
Sbjct: 487 SQAAIECYRHAVDINPRDFKAWYGLGQ 513

>TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1410

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 10/74 (13%)

Query: 470 GESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDK 529
           G  E ++K F+K +EL    P  ++     L            V  FVE I++L+   D 
Sbjct: 723 GRIEASIKVFEKPLELSPHHPHALYFKALGL----------SDVGQFVESIEILEYITDL 772

Query: 530 DPRSEQARLGLAQL 543
           +P +E  ++ LA++
Sbjct: 773 NPNNEAFKICLAKI 786

>Smik_8.250 Chr8 complement(414141..416021) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 36/89 (40%), Gaps = 14/89 (15%)

Query: 456 PEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVE- 514
           PE     A   + R E EK++  F +A+ L+ KT              A  L+    VE 
Sbjct: 397 PETCCIIANYYSARQEHEKSIMYFRRALTLDKKTT------------NAWTLMGHEFVEL 444

Query: 515 -NFVEGIQLLQEACDKDPRSEQARLGLAQ 542
            N    I+  + A D  PR  +A  GL Q
Sbjct: 445 SNSHAAIECYRRAVDICPRDFKAWFGLGQ 473

>TBLA0E04260 Chr5 (1083669..1087277) [3609 bp, 1202 aa] {ON}
           Anc_8.242 YER176W
          Length = 1202

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 44/89 (49%), Gaps = 8/89 (8%)

Query: 297 LKAAELFKDQLSQNKDNEAIKEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNS 356
           L +  + K   S  K+N++IKEK +I +E S +   +KNE +K     +  IE   RV S
Sbjct: 492 LSSLNISKPSNSDVKNNKSIKEKKSIVVENSKLKPIIKNEHIK-----RDVIEEGVRVAS 546

Query: 357 Y-IYQSLIGSDSTTTSEYLQNFDKALELE 384
           Y  Y   +  D  +T  Y   F  A+ LE
Sbjct: 547 YNKYTPTLNYDDLST--YFSEFSYAMFLE 573

>CAGL0M05489g Chr13 (585392..586672) [1281 bp, 426 aa] {ON} similar
           to uniprot|P38130 Saccharomyces cerevisiae YBR205w KTR3
          Length = 426

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 58/129 (44%), Gaps = 22/129 (17%)

Query: 248 LASFFRVFKPETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQL 307
           L   F + KP+        +  A ++ M G T++ KN + G+ I       A++L +D +
Sbjct: 34  LTVLFLMHKPDAG-----TTAMAPQQTMAGFTSVVKNGQPGYVIP------ASDLLQD-V 81

Query: 308 SQNKDNEAIKEKTA-IALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSD 366
            ++  ++ +KEK A I L  +G L+ + N      D +          + Y Y  +  +D
Sbjct: 82  KEHPLDDGVKEKAAFITLARNGDLWSLVNTIRHVEDRLN---------HRYHYDWVFLND 132

Query: 367 STTTSEYLQ 375
              T E+++
Sbjct: 133 KGFTDEFIR 141

>KAFR0E02240 Chr5 complement(451940..453811) [1872 bp, 623 aa] {ON}
           Anc_5.72 YHR166C
          Length = 623

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 80/198 (40%), Gaps = 40/198 (20%)

Query: 358 IYQSLIGSDSTTTSEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKV--- 414
           +YQ + G+      E+L N +  L + PN   +       Y+    Y  + K F+++   
Sbjct: 299 LYQEIGGN----IDEFLMNLEYLLSISPNFAYLKSQHALVYYNHMDYISSEKLFNQIIKS 354

Query: 415 -----KELD-ENNIFAYIQ----LACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAE 464
                ++LD  +NI   +Q    LA LA   S+ D           KF    E     A 
Sbjct: 355 DPYRLEDLDVYSNILYVMQKHSKLAYLAQFVSQID-----------KFR--AESCCIAAN 401

Query: 465 VLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQ 524
             + R E EK++  F +A+ L+ K+      G   L+G   +      ++N    I+  +
Sbjct: 402 YYSSRQEHEKSIMYFRRALTLDKKS-----TGAWTLMGHEFV-----ELKNSNAAIECYR 451

Query: 525 EACDKDPRSEQARLGLAQ 542
            A D D R  +A  GL Q
Sbjct: 452 RAIDIDERDFKAWYGLGQ 469

>KLTH0H14234g Chr8 (1236691..1237878) [1188 bp, 395 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 395

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 68/157 (43%), Gaps = 30/157 (19%)

Query: 97  DIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKD--------DPIYYSN 148
           + D  + E   E +  +KD G+ LFK+  +++A   Y  ALK  +        D ++Y  
Sbjct: 229 NFDKDSAEKAYEASCIIKDSGSLLFKSKDYQNAYFKYRKALKYVNEFIPDIDMDKVFYEK 288

Query: 149 ISACYASLL-----------QYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGN----- 192
            +   A L            +YE  I+Y+   L++ P  S   + RA AY   GN     
Sbjct: 289 FTELKAKLYLNLILVMFNQKKYEDAIKYSVYLLEI-PEASG--LDRAKAYYRSGNCHLMK 345

Query: 193 --FGDAMFDISACSLNGDMNDASIEPILERILNKQAE 227
             F  A+ D +AC  + + ND +++  +    NK  E
Sbjct: 346 KRFDKALADFNACKEH-NPNDEAVDKKIGEAQNKLEE 381

>Suva_15.366 Chr15 complement(643222..645102) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 69/176 (39%), Gaps = 20/176 (11%)

Query: 372 EYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDE---NNIFAYIQL 428
           +Y ++ +  L++ PN   +  +     +    Y  A   FD++ + D    N++  Y  +
Sbjct: 313 DYFEDLEFLLQVFPNFTFLKAYNATISYNNLDYVTAEGRFDEIVKQDPYRLNDLETYSNI 372

Query: 429 ACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAK 488
             +  + SK        S+  R     PE     A   + R E EK++  F +A+ L+ K
Sbjct: 373 LYVMQKNSKLAYLAQFVSQIDR---FRPETCCIIANYYSARQEHEKSIMYFRRALTLDKK 429

Query: 489 TPEEIHVGIAPLIGKATLLISKPTVE--NFVEGIQLLQEACDKDPRSEQARLGLAQ 542
           T              A  L+    VE  N    I+  + A D  PR  +A  GL Q
Sbjct: 430 TT------------NAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQ 473

>Skud_8.230 Chr8 complement(408573..410453) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 69/174 (39%), Gaps = 16/174 (9%)

Query: 372 EYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDE---NNIFAYIQL 428
           +Y ++ +  L++ PN   +  +     +    Y  A   FD + + D    N++  Y  +
Sbjct: 313 DYFEDLEFLLQIFPNFTFLKAYNATISYNNLDYVTAESRFDDIVKQDPYRVNDLETYSNI 372

Query: 429 ACLAYRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAK 488
             +  + SK        S+  R     PE     A   + R E EK++  F +A+ L+ K
Sbjct: 373 LYVMQKNSKLAYLAQFVSQIDR---FRPETCCIIANYYSARQEHEKSIMYFRRALTLDKK 429

Query: 489 TPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQ 542
           T          L+G   + +S     N    I+  + A D  PR  +A  GL Q
Sbjct: 430 T-----TNAWTLMGHEFVELS-----NSHAAIECYRRAVDICPRDFKAWFGLGQ 473

>NCAS0I01650 Chr9 complement(303652..305139) [1488 bp, 495 aa] {ON}
           Anc_3.266 YBR056W
          Length = 495

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 73  PQEDTPTTKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIK 131
           P  ++    KP+    SN   N  DI  L +  KN W    KDKG E F+  +FED ++
Sbjct: 386 PLTNSGCIPKPLKRNMSNITEN--DIQRLVQAHKNYW----KDKGGEKFEYWRFEDGVR 438

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 328 GILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIG---SDSTTTSEYLQNFDKALELE 384
           G L+Y   E  K  D  ++A+E++P  N  +  + +G   ++S  + E +Q + KAL L+
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNP--NDELMWNRLGASLANSNRSEEAIQAYHKALALK 480

Query: 385 P 385
           P
Sbjct: 481 P 481

>ZYRO0F06182g Chr6 complement(513327..514613) [1287 bp, 428 aa] {ON}
           highly similar to uniprot|P39683 Saccharomyces
           cerevisiae YOR209C NPT1 Nicotinate
           phosphoribosyltransferase
          Length = 428

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 12/94 (12%)

Query: 86  LVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPIY 145
           L D+ G  N   ++S      + +    +D G+ +    K     K+YH  LKL   P +
Sbjct: 267 LTDTFGSDNF--LESFKPPYSDHYVGVRQDSGDPIEYAEKIS---KHYHDKLKL---PKF 318

Query: 146 YSNISACYASLLQYEKVIEYATKALK--LRPTFS 177
             +I  C++  L  +KV+ Y+  +LK  L+PTF 
Sbjct: 319 SKSI--CFSDSLNVKKVLNYSDASLKMGLKPTFG 350

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%)

Query: 525 EACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAELAKSYEEKLQATT 575
           EAC  DP      + L+ +    +  D  I  F++ +EL K Y  +L A T
Sbjct: 6   EACFWDPNDNGVNILLSHVSQGIKSCDSMIHFFKQRSELEKDYARRLGAIT 56

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 32/55 (58%)

Query: 371 SEYLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAY 425
           SE ++ F  AL ++P++   +   GQ+Y+   + E + K F+K  E++  + +A+
Sbjct: 697 SESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALEVEPTSAYAH 751

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 1/75 (1%)

Query: 114 KDKGNELFKTSKFEDAIKYYHYALKLK-DDPIYYSNISACYASLLQYEKVIEYATKALKL 172
           K+ GN LFK   + +A+  Y   +  +  +P+ YSN +     L +Y   I+   + L+ 
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 173 RPTFSKVLMRRALAY 187
                   +R  L Y
Sbjct: 72  ALGPEHAAIRSKLQY 86

>ZYRO0G17358g Chr7 complement(1428038..1428904) [867 bp, 288 aa]
           {ON} similar to uniprot|P47133 Saccharomyces cerevisiae
           YJR088C Hypothetical ORF
          Length = 288

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 385 PNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLA-CLAYRESKFD 439
           P +P I++   Q+YF   Q+E+A    ++V +L   N  A  +LA  L Y+  + D
Sbjct: 156 PIDPEIWWFAAQNYFELGQFERAVYCLEEVIQLTPFNYVASARLAEVLYYKSMRVD 211

>TBLA0H03300 Chr8 (805828..809073) [3246 bp, 1081 aa] {ON} Anc_8.415
           YDR206W
          Length = 1081

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 155 SLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACSLNGDMNDASI 214
           S+  ++K   Y   A  L P+  +  ++++L Y    NFG A ++   CSL+   N + +
Sbjct: 244 SVQDFKKAFRYLDIASLLLPSVGEPHLQKSLIYLNTNNFGCATYEFIRCSLSRIPNQSGL 303

Query: 215 EPILERILNKQAEFVLKEK 233
                 + +K +  +++EK
Sbjct: 304 SMFKTMMFDKNS--IIREK 320

>KAFR0A00370 Chr1 (69584..70198) [615 bp, 204 aa] {ON} Anc_2.400
           YMR132C
          Length = 204

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 56/119 (47%), Gaps = 21/119 (17%)

Query: 210 NDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFF------RVFKP-ETSF- 261
           N+ S++ + + +LN   + V    I ANK   +   T + S +      R  KP E SF 
Sbjct: 60  NEKSLDDVPDDVLNDCLQMVKANSIQANK---MVQCTIIISPWTNLKKNRFMKPGEVSFK 116

Query: 262 ----ANYEESNEADRELMNGLTN----LYKNSEEGFQIADKSFLKAAELFKDQLSQNKD 312
                  +++ + D +++N LT     L+++ EE   +A KS  K  E F   L+ N+D
Sbjct: 117 SLKMCRRKQAFQRDNKILNRLTKTRVELFEDVEETLHLAKKS--KDGEFFSTLLANNRD 173

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,416,593
Number of extensions: 2697371
Number of successful extensions: 9960
Number of sequences better than 10.0: 342
Number of HSP's gapped: 10006
Number of HSP's successfully gapped: 493
Length of query: 609
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 494
Effective length of database: 40,294,809
Effective search space: 19905635646
Effective search space used: 19905635646
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)