Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F017406.27ON31331315740.0
NCAS0H015106.27ON31331311251e-155
KNAG0M012406.27ON31430911221e-154
CAGL0E02519g6.27ON31530810591e-145
KAFR0G026506.27ON32131210151e-138
TDEL0G044206.27ON32231710081e-137
SAKL0E01474g6.27ON31131210041e-137
Kpol_1032.96.27ON3182939991e-136
Kwal_56.224546.27ON3153009661e-131
TBLA0E030606.27ON3193159591e-130
ZYRO0C07612g6.27ON3192939541e-129
KLTH0C11044g6.27ON3152899471e-128
TPHA0M002906.27ON3273199441e-127
YOL002C (IZH2)6.27ON3173109341e-126
Suva_15.1736.27ON3273109291e-125
Ecym_30316.27ON3282899281e-125
ACL002C6.27ON3292759271e-125
Skud_15.1606.27ON3273109261e-124
Smik_15.1686.27ON3273109241e-124
KLLA0D01331g6.27ON3083039121e-123
Kwal_56.227043.90ON3202967122e-92
CAGL0G04631g3.90ON3163116862e-88
KLTH0C09504g3.90ON3192736852e-88
YDR492W (IZH1)3.90ON3163196819e-88
SAKL0C09218g3.90ON3143026782e-87
Smik_4.7693.90ON3163176792e-87
Suva_2.6683.90ON3153176759e-87
Skud_4.7663.90ON3163196732e-86
NCAS0I025703.90ON3143126634e-85
TPHA0A006403.90ON3273116644e-85
ZYRO0B06556g3.90ON3183056611e-84
TDEL0D053403.90ON3163056566e-84
AFR337W3.90ON3173056566e-84
Kpol_1053.263.90ON3242766445e-82
NDAI0A071603.90ON3303106439e-82
Ecym_35883.90ON3052756373e-81
KLLA0C12441g3.90ON3153036288e-80
KAFR0A081303.90ON3193136105e-77
KNAG0K021603.90ON3233276045e-76
TBLA0B022903.90ON3262955951e-74
TBLA0B082553.90ON2962903893e-44
NCAS0C049203.90ON3262773661e-40
NDAI0G043003.90ON3182993268e-35
CAGL0I07491g3.90ON3012972287e-21
KAFR0J006705.197ON5092301983e-16
Suva_15.643.90ON3123181855e-15
Smik_15.563.90ON3123181723e-13
Skud_15.533.90ON3123171652e-12
YOL101C (IZH4)3.90ON3123141635e-12
NDAI0I023305.197ON5782361558e-11
KLLA0F15510g5.197ON6223011452e-09
NCAS0D026005.197ON5432361442e-09
KNAG0B051005.197ON5382661442e-09
TPHA0E031205.197ON5692371442e-09
TBLA0C060505.197ON4372401407e-09
YLR023C (IZH3)5.197ON5432701371e-08
Kpol_2002.945.197ON5772361353e-08
Smik_12.865.197ON5422721344e-08
Skud_12.915.197ON5422361282e-07
CAGL0D03322g5.197ON5452361282e-07
TDEL0E043205.197ON4502381202e-06
Suva_10.1045.197ON5412361193e-06
ZYRO0B10538g5.197ON5312391184e-06
Ecym_71095.197ON5682351184e-06
AAL153C5.197ON4192491158e-06
KLTH0B03498g5.197ON5462421132e-05
SAKL0G12980g5.197ON5632421113e-05
Kwal_33.151225.197ON5662421015e-04
KNAG0I004201.459ON108586850.050
KNAG0K006703.90ON32186800.13
TPHA0M018506.342ON39773760.48
TDEL0A075706.342ON36273740.93
KNAG0L021405.702ON160848731.5
NDAI0K022206.342ON36660712.0
TBLA0I024106.342ON36873712.0
NCAS0A053806.342ON36073712.1
KAFR0C046006.342ON37873702.7
ZYRO0D08162g6.342ON36373702.9
ZYRO0C05016g6.106ON48382702.9
KNAG0D003806.342ON38973693.1
YNR032W (PPG1)6.342ON36873693.5
Suva_14.3866.342ON36873693.9
Skud_14.3636.342ON36873683.9
CAGL0M10890g6.342ON36475684.1
Smik_14.3616.342ON36873684.5
TBLA0C06220singletonON49483667.5
TPHA0D018405.310ON58283677.5
Kpol_265.24.385ON54989669.0
SAKL0A01232g6.342ON37360659.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F01740
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      610   0.0  
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   437   e-155
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   436   e-154
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   412   e-145
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   395   e-138
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   392   e-137
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   391   e-137
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   389   e-136
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   376   e-131
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   374   e-130
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   372   e-129
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   369   e-128
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   368   e-127
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   364   e-126
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   362   e-125
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   362   e-125
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   361   e-125
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   361   e-124
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   360   e-124
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   355   e-123
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   278   2e-92
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   268   2e-88
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   268   2e-88
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   266   9e-88
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   265   2e-87
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   266   2e-87
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   264   9e-87
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   263   2e-86
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   259   4e-85
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   260   4e-85
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   259   1e-84
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   257   6e-84
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   257   6e-84
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   252   5e-82
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   252   9e-82
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   249   3e-81
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   246   8e-80
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   239   5e-77
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   237   5e-76
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   233   1e-74
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             154   3e-44
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   145   1e-40
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    130   8e-35
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    92   7e-21
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    81   3e-16
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    76   5e-15
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    71   3e-13
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    68   2e-12
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    67   5e-12
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     64   8e-11
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    60   2e-09
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    60   2e-09
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    60   2e-09
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    60   2e-09
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    59   7e-09
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    57   1e-08
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    57   3e-08
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    56   4e-08
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    54   2e-07
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    54   2e-07
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    51   2e-06
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    50   3e-06
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    50   4e-06
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    50   4e-06
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    49   8e-06
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    48   2e-05
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    47   3e-05
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    44   5e-04
KNAG0I00420 Chr9 complement(62534..65791) [3258 bp, 1085 aa] {ON...    37   0.050
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    35   0.13 
TPHA0M01850 Chr13 (386485..387678) [1194 bp, 397 aa] {ON} Anc_6....    34   0.48 
TDEL0A07570 Chr1 (1321568..1322656) [1089 bp, 362 aa] {ON} Anc_6...    33   0.93 
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...    33   1.5  
NDAI0K02220 Chr11 (503034..504134) [1101 bp, 366 aa] {ON} Anc_6....    32   2.0  
TBLA0I02410 Chr9 (554763..555869) [1107 bp, 368 aa] {ON} Anc_6.3...    32   2.0  
NCAS0A05380 Chr1 (1066582..1067664) [1083 bp, 360 aa] {ON} Anc_8...    32   2.1  
KAFR0C04600 Chr3 (922688..923824) [1137 bp, 378 aa] {ON} Anc_6.3...    32   2.7  
ZYRO0D08162g Chr4 complement(705432..706523) [1092 bp, 363 aa] {...    32   2.9  
ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} simila...    32   2.9  
KNAG0D00380 Chr4 complement(52001..53170) [1170 bp, 389 aa] {ON}...    31   3.1  
YNR032W Chr14 (686010..687116) [1107 bp, 368 aa] {ON}  PPG1Putat...    31   3.5  
Suva_14.386 Chr14 (667275..668381) [1107 bp, 368 aa] {ON} YNR032...    31   3.9  
Skud_14.363 Chr14 (654109..655215) [1107 bp, 368 aa] {ON} YNR032...    31   3.9  
CAGL0M10890g Chr13 (1082128..1083222) [1095 bp, 364 aa] {ON} hig...    31   4.1  
Smik_14.361 Chr14 (643981..645087) [1107 bp, 368 aa] {ON} YNR032...    31   4.5  
TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON}             30   7.5  
TPHA0D01840 Chr4 complement(383875..385623) [1749 bp, 582 aa] {O...    30   7.5  
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    30   9.0  
SAKL0A01232g Chr1 complement(118646..119767) [1122 bp, 373 aa] {...    30   9.7  

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/313 (95%), Positives = 300/313 (95%)

Query: 1   MPKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISG 60
           MPKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISG
Sbjct: 1   MPKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISG 60

Query: 61  YVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMI 120
           YVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMI
Sbjct: 61  YVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMI 120

Query: 121 DLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPX 180
           DLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNP 
Sbjct: 121 DLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPL 180

Query: 181 XXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEE 240
                       GGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEE
Sbjct: 181 FFYFFSSLTFLFGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEE 240

Query: 241 TFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLR 300
           TFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLR
Sbjct: 241 TFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLR 300

Query: 301 GLLSSYEIVHSRL 313
           GLLSSYEIVHSRL
Sbjct: 301 GLLSSYEIVHSRL 313

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  437 bits (1125), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 210/313 (67%), Positives = 243/313 (77%)

Query: 1   MPKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISG 60
           M K +Q+R   ++T+       + DN       K   + KLY WDEIPEWQKDNEHII+G
Sbjct: 1   MTKNLQQRVALTSTSTSTKTTIDDDNVSIKHTKKTTTIRKLYTWDEIPEWQKDNEHIIAG 60

Query: 61  YVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMI 120
           YVRETNSF+ C  SLFY+HNE+GNVYSHL+PGV FF TM+ +KY I  + TT+  DYL+I
Sbjct: 61  YVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLII 120

Query: 121 DLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPX 180
           +LFF GAF CLILSS FHCFKSHSLK+AT GNKLDYLGIV+LIVTSMISI+++GF+DN  
Sbjct: 121 NLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGP 180

Query: 181 XXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEE 240
                       G ACA VSLKD FRSREWRPYRAGLFVAFGLSA+LPIL G  YYG  E
Sbjct: 181 FFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHE 240

Query: 241 TFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLR 300
           T+ RIQLKW++LEG FYIFGAFLYG+RFPEKYV G+FDIWGHSHQIFH+LVVVAAFCHL+
Sbjct: 241 TWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLK 300

Query: 301 GLLSSYEIVHSRL 313
            LL SYE+VH  L
Sbjct: 301 ALLGSYELVHMNL 313

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  436 bits (1122), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/309 (67%), Positives = 241/309 (77%), Gaps = 1/309 (0%)

Query: 5   IQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRE 64
           +  R    T T+ E ++   D G+ ++   +K+  ++Y W+EIPEWQKDNEHII GYVRE
Sbjct: 1   MSSRVQRQTVTITEPVVYEDDGGE-MKTATKKITKRIYTWNEIPEWQKDNEHIIDGYVRE 59

Query: 65  TNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFF 124
           TNSF  C+HSLFY+HNES NVYSHL+P + FF  + LNKY +  + TTS+VDYL IDLFF
Sbjct: 60  TNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFF 119

Query: 125 FGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXX 184
            GAF CLILSS FHCFKSHSLKVAT GNKLDYLGIV+LIVTSMISI+Y+GF+D+      
Sbjct: 120 LGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYF 179

Query: 185 XXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIR 244
                   G AC  VSLKDHFRSREWRPYRAGLFVAFGLSAILPIL+G F YGIEE F R
Sbjct: 180 FSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHR 239

Query: 245 IQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLS 304
           IQ+KWIILEG FYI GAFLYG+RFPEK  PG +DIWGHSHQ+FHILVVVAA CHL+GL+ 
Sbjct: 240 IQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMV 299

Query: 305 SYEIVHSRL 313
           SYE+VH  L
Sbjct: 300 SYELVHKGL 308

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  412 bits (1059), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/308 (64%), Positives = 232/308 (75%), Gaps = 2/308 (0%)

Query: 5   IQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRE 64
           + +R   +  T  E  +  TD    I+  K+ VV KLY W+EIPEWQKDNEHI +GYVRE
Sbjct: 4   VHQRKVATMVTTEEQPLIGTDG--QIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRE 61

Query: 65  TNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFF 124
           T+S   C+ SLFY+HNE+ N+YSHL+P + FF T+  NKY +  YSTT+++DYL+ID+FF
Sbjct: 62  TSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFF 121

Query: 125 FGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXX 184
            GAF CLILSS FHC KSHSL+VA  GNKLDYLGIV LIV SM+SI+Y+GF  NP     
Sbjct: 122 LGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGI 181

Query: 185 XXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIR 244
                   G ACA VSLKD FRSREWRPYRA LFV FGLSA+LPILAG F YG  ET+ R
Sbjct: 182 FSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTR 241

Query: 245 IQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLS 304
           IQLKW+ILEG FYIFGAFLYG+RFPEK  PGSFD+WGHSHQIFHILVVVAA CHL+ LL 
Sbjct: 242 IQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLG 301

Query: 305 SYEIVHSR 312
           SY +VH R
Sbjct: 302 SYSLVHYR 309

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  395 bits (1015), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 189/312 (60%), Positives = 234/312 (75%), Gaps = 5/312 (1%)

Query: 1   MPKTIQKRGNTSTT--TVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHII 58
           M  +  KR     T  T  + ++   + G++I  +++  + +LY W+EIP+WQKDNEHII
Sbjct: 1   MISSRPKRSTRKVTIDTAFQDVVEQ-NKGETIRSLEK--IIQLYNWNEIPDWQKDNEHII 57

Query: 59  SGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYL 118
           SGYV+ETNSF  C+ SLFY+HNES NVYSHL+P V F  T +LNK  +  + TT+++DYL
Sbjct: 58  SGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYL 117

Query: 119 MIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDN 178
            IDLFF GAF CLILSS FHCFKSHSL++AT GNKLDYLGIV+LI TSMIS++Y+GF+D 
Sbjct: 118 YIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDT 177

Query: 179 PXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGI 238
           P             G ACATVSLKD FRSRE R YRA LFV FGLSA+LP++ G ++YG 
Sbjct: 178 PSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGF 237

Query: 239 EETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCH 298
             T+ RIQLKW++LEG FYIFGAFLYG+RFPEKY PG +DIWGHSHQ+FHILVV+AA CH
Sbjct: 238 YNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCH 297

Query: 299 LRGLLSSYEIVH 310
            + L+ SYE VH
Sbjct: 298 FKALMCSYEHVH 309

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  392 bits (1008), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 181/317 (57%), Positives = 228/317 (71%), Gaps = 4/317 (1%)

Query: 1   MPKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVK----RKVVYKLYRWDEIPEWQKDNEH 56
           M  +++KR   S TT     +   +    ++  K     K   KLY WDEIP WQ+DNEH
Sbjct: 1   MSDSLKKRSQCSLTTDQTSTVTKEETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEH 60

Query: 57  IISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVD 116
           I+SGYV ET S   C  SLFY+HNES N+Y+HLLPG+ F F +  +K+ +T + TT+++D
Sbjct: 61  ILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLID 120

Query: 117 YLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFF 176
           Y+MIDLF   +F CL LSS+FHC K+HS  VAT GNKLDYLGIV+L+VTSM+SIMY+GFF
Sbjct: 121 YVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFF 180

Query: 177 DNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYY 236
           + P             G ACA VSLK+ FR+REWRPYRA +FVAFGLSA+LPI+ G FYY
Sbjct: 181 ETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYY 240

Query: 237 GIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAF 296
           G  E ++RIQ+KW++L G FYI GA LYGVRFPEKY PG +DIWGHSHQ+FH+LVVVAA 
Sbjct: 241 GFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAAL 300

Query: 297 CHLRGLLSSYEIVHSRL 313
           CHL GL+ SY +VH ++
Sbjct: 301 CHLYGLIKSYNLVHLKM 317

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  391 bits (1004), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 182/312 (58%), Positives = 230/312 (73%), Gaps = 6/312 (1%)

Query: 2   PKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGY 61
           P+  ++R       +V+      +   S   + +K V +LY W+EIP+WQKDNEHI  GY
Sbjct: 3   PEPNRRRLQIKRANIVK------EETMSTGTINKKRVRRLYSWEEIPDWQKDNEHIRHGY 56

Query: 62  VRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMID 121
           VRETNSF GC  SLFY+HNES N+Y+HLLPG+ FFF ++ +K  I ++ TT+ +DY+M+D
Sbjct: 57  VRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVD 116

Query: 122 LFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXX 181
           LFF GAF CLILSS FHC K+HSL++A LGNKLDYLGIV LIV+SMISIMY+GFFD+   
Sbjct: 117 LFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKF 176

Query: 182 XXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEET 241
                      G ACA  SL D FRSREWRPYRA LFVAFGLSA+LPI +G   YG +ET
Sbjct: 177 FYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKET 236

Query: 242 FIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRG 301
           ++++Q+KW++L G FYI GA LY +R PE+  PG FDIWGHSHQIFHILVV+AA CHL+ 
Sbjct: 237 WVKVQVKWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKA 296

Query: 302 LLSSYEIVHSRL 313
           +L+SYE+VH +L
Sbjct: 297 VLNSYELVHKKL 308

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  389 bits (999), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 180/293 (61%), Positives = 223/293 (76%), Gaps = 2/293 (0%)

Query: 21  INNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHN 80
           +       S   +KR V  +L  W+ +P+WQKDNEHI+SGYV+ETNS K CLHSL ++HN
Sbjct: 23  VEKDGAKSSYSYIKRGV--QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHN 80

Query: 81  ESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCF 140
           ES N++SHL+P   F  T++ +KY +  Y TT++ DYLM+DLF FGAF CL++SS FHC 
Sbjct: 81  ESVNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCL 140

Query: 141 KSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVS 200
           K+HS  V++ GNKLDYLGIV+LIV+SM SI+Y+GF+DN              G +CA VS
Sbjct: 141 KAHSPYVSSFGNKLDYLGIVVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVS 200

Query: 201 LKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFG 260
           L + FR+REWRPYRA +FVAFGLSA+LPI AG  YYG++ET IR+QLKW++LEG FYIFG
Sbjct: 201 LGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFG 260

Query: 261 AFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313
           A LYGVRFPE+  PG FDIWGHSHQ+FHILVVVAA CHLRGLL SY IVH+RL
Sbjct: 261 ALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVHTRL 313

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  376 bits (966), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 176/300 (58%), Positives = 218/300 (72%), Gaps = 7/300 (2%)

Query: 18  EGIINNTD----NGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLH 73
           EG++        NG  IE+  R+   +LY+WDEIPEWQKDNEHI++GY+ ET S   CL 
Sbjct: 17  EGVMTEETTTLLNGSRIEERTRR---RLYKWDEIPEWQKDNEHILNGYILETKSVGACLK 73

Query: 74  SLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLIL 133
           SL Y+HNES N+Y+HL+PG  F    + N+  I  Y TT ++DY+MIDLFF G F CL++
Sbjct: 74  SLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMIDLFFLGGFTCLMM 133

Query: 134 SSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXG 193
           SS FHCFK HSL VA LGNKLDYLGIV L+VTSM+SI+++GF DN              G
Sbjct: 134 SSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNLYFYVFSGLTIMFG 193

Query: 194 GACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILE 253
            AC  VSL D FRSR+WRPYRA LFVAFGLSA+ P++AG  +YG + T+ RIQLKW+ LE
Sbjct: 194 LACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKVTWTRIQLKWVFLE 253

Query: 254 GFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313
           G FYI GA LYGVRFPE+  PG+FDIWG SHQ+FH+LVV+AA CHLR LL +Y+ VHS++
Sbjct: 254 GVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLRALLGAYKWVHSQM 313

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  374 bits (959), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 185/315 (58%), Positives = 223/315 (70%), Gaps = 6/315 (1%)

Query: 1   MPKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVV--YKLYRWDEIPEWQKDNEHII 58
           M   +Q+R  TS+T   EG+      GD+ +Q+        +LY WDEIP WQ DNE+I 
Sbjct: 1   MVTEVQRRKLTSSTE--EGV--ELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIY 56

Query: 59  SGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYL 118
           +GYVRETNS K    SLFY+HNES N+Y+HL+P   F   ++ N YG+  + TT+  DY+
Sbjct: 57  TGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYV 116

Query: 119 MIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDN 178
            IDLFF GAF CL LSS FHCFKSHSLK++  GNKLDYLGIVILI TS+IS++YFG+ D+
Sbjct: 117 AIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDD 176

Query: 179 PXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGI 238
           P             G AC   SLKD FR+REWRPYRA LFV FGLS +LPI+AG   YGI
Sbjct: 177 PFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGI 236

Query: 239 EETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCH 298
            E F R+QLKWII EG  YIFGAFLYG RFPEK++PG  DIWG SHQIFH+LVV+AA CH
Sbjct: 237 REVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCH 296

Query: 299 LRGLLSSYEIVHSRL 313
           LRGL+ SYE+VH +L
Sbjct: 297 LRGLIGSYELVHQKL 311

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  372 bits (954), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 176/293 (60%), Positives = 213/293 (72%), Gaps = 1/293 (0%)

Query: 21  INNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHN 80
           +N       IE V  +    LY W+EIP+WQKDNEHI+ GYVRETNS + CL SL Y+HN
Sbjct: 23  VNQEQTTIKIEPVNTQKKL-LYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHN 81

Query: 81  ESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCF 140
           ES N+Y+H LPG+ F  T + +K+ I  + TT+ +DY+ ID FFFGAF CLILSS FHCF
Sbjct: 82  ESINIYTHFLPGLCFLATCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCF 141

Query: 141 KSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVS 200
           KSHS +V+  GNKLDYLGIVILIV SMISI+Y+ F D+              G +C   S
Sbjct: 142 KSHSSRVSVFGNKLDYLGIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIAS 201

Query: 201 LKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFG 260
             D FRSREWRPYRAGLFVAFGLSA+LPI+ G   YG  ET+ RIQ+KW+ILEG FYIFG
Sbjct: 202 FDDTFRSREWRPYRAGLFVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFG 261

Query: 261 AFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313
           AFLY +RFPE+  PG+FD  GHSHQIFH+LVV+AA CHL  L++SYE+VH+ L
Sbjct: 262 AFLYSIRFPERLAPGAFDFVGHSHQIFHVLVVIAALCHLVALMNSYELVHTNL 314

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  369 bits (947), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 173/289 (59%), Positives = 216/289 (74%), Gaps = 2/289 (0%)

Query: 22  NNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNE 81
           N++   DS   +K++   +LY WDEIPEWQ+DNEHI+ GY+ ET S   CL SL Y+HNE
Sbjct: 24  NSSLLKDS--NLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNE 81

Query: 82  SGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFK 141
           S N+Y+HLLPG  F    V N+  I  + TT ++DY+MIDLFF G F CL++SS+FHCFK
Sbjct: 82  SVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFK 141

Query: 142 SHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSL 201
            HSL VA LGNKLDYLGIV L+VTS++SI+++GF D               G ACATVSL
Sbjct: 142 CHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSL 201

Query: 202 KDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGA 261
            + FRSREWRPYRA LFVAFGLSA+LP++AG  +YG++ET+ RIQL+W++L G FYI GA
Sbjct: 202 SNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGA 261

Query: 262 FLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVH 310
            LYG+RFPE+  PG FDIWGHSHQ+FHILVVVAA CHLR LL +Y++ H
Sbjct: 262 VLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 182/319 (57%), Positives = 226/319 (70%), Gaps = 10/319 (3%)

Query: 5   IQKR-GNT--STTTVVEGIINNTDNGDSIEQVKRKVVYKLYR-------WDEIPEWQKDN 54
           +QKR G T  S++ V E      ++G    +   K++ +  R       WD++P+WQKDN
Sbjct: 7   LQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDN 66

Query: 55  EHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSI 114
           EHI  GYV+ETNSF  C  SLF++HNES N+YSH++PG+   F ++++   I  + TT+ 
Sbjct: 67  EHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTF 126

Query: 115 VDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFG 174
           VDY MIDLF  GAF CLILSS FH  KSHSL VA  GNKLDYLGIVILIVTSMISI+Y+G
Sbjct: 127 VDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYG 186

Query: 175 FFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTF 234
           F+D P             G AC TVSL + FRSREWRPYRA LFV FGLSA+ P+L G +
Sbjct: 187 FYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIW 246

Query: 235 YYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVA 294
           YYG+E+TF RIQLKWI+ EGFFYIFGAFLY +R+PE+  PG+FD+WGHSHQIFH+ VV+A
Sbjct: 247 YYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIA 306

Query: 295 AFCHLRGLLSSYEIVHSRL 313
           A+ H  GLLS+YE  H  L
Sbjct: 307 AYSHFHGLLSAYEYAHEML 325

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  364 bits (934), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 173/310 (55%), Positives = 225/310 (72%), Gaps = 1/310 (0%)

Query: 4   TIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVR 63
           T+ +R  +            + N   + + K KV+ +LY WDEIPEWQ+DN+ I+ GYV+
Sbjct: 3   TLLERTKSVQELKKRAAGKTSANPAEVAKAK-KVLRRLYSWDEIPEWQRDNDFILHGYVK 61

Query: 64  ETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLF 123
           ET+SF     SLFY+HNES N+YSHL+P + FF  ++L+K  I +++TT+ +D+++IDLF
Sbjct: 62  ETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLF 121

Query: 124 FFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXX 183
           + GAF CLILSS FHC KSHSL++ATLGNKLDYLGI ILIVTSM+SI+Y+G+F+      
Sbjct: 122 YSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFC 181

Query: 184 XXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFI 243
                    G AC+ VSLKD FR REWRPYRAGLFV FGLS+I+PI +G + Y   E + 
Sbjct: 182 LFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWT 241

Query: 244 RIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLL 303
           +IQL W++L G  YI GA LYG+RFPEK  PG FDIWGHSHQ+FH LVV+AA CHLRGLL
Sbjct: 242 QIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLL 301

Query: 304 SSYEIVHSRL 313
           +SYE+VH ++
Sbjct: 302 NSYELVHIKM 311

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  362 bits (929), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 228/310 (73%), Gaps = 1/310 (0%)

Query: 4   TIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVR 63
           T+ +R N+          N   N   + + K KV+ ++Y WDEIPEWQ+DN++I+ GYV+
Sbjct: 13  TLLERTNSVQELKKRAAGNTAANPAEVAKAK-KVLKRVYSWDEIPEWQRDNDYILHGYVK 71

Query: 64  ETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLF 123
           ET+SF     SLFY+HNES N+YSHL+P V F   ++L+K  IT++ TT+ +D++MIDLF
Sbjct: 72  ETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMIDLF 131

Query: 124 FFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXX 183
           F GAF CLILSS FHCFKSHSLK+ATLGNKLDYLGI ILIVTSM+SI+Y+G++D      
Sbjct: 132 FTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPAFC 191

Query: 184 XXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFI 243
                    G AC+ VSLKD FR REWRPYRAGLFV FGLS+I+PI +G +YY   E + 
Sbjct: 192 LFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEIWN 251

Query: 244 RIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLL 303
           +IQL W++L G  YI GA LYG+RFPEK  PG FDIWGHSHQ+FH LVV+A+ CH+RG+L
Sbjct: 252 QIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRGVL 311

Query: 304 SSYEIVHSRL 313
           +SYE+VH ++
Sbjct: 312 NSYELVHIKM 321

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  362 bits (928), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/289 (57%), Positives = 210/289 (72%)

Query: 25  DNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGN 84
           ++ +    +  K   KL+ W EIPEWQ+DNEHI+ GYV+ETNSFK  LHSL Y+HNES N
Sbjct: 32  EDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVN 91

Query: 85  VYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHS 144
           +Y+HL+PGV FF  + LNKY I+ + TT+  DY +ID FF GAF CL++S  +HC KSHS
Sbjct: 92  IYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHS 151

Query: 145 LKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDH 204
             V+ +GN+LDY+GIVILI TSM S++Y+GF+++              G  C  V+L   
Sbjct: 152 YPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSR 211

Query: 205 FRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLY 264
           FRSR WRPYRA +FVAFGLS+ILPILA   YYG EET+  +QL WIILEG  YIFGAF+Y
Sbjct: 212 FRSRLWRPYRASIFVAFGLSSILPILASILYYGSEETWNSVQLGWIILEGVLYIFGAFIY 271

Query: 265 GVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313
           G+RFPE   PGSFDIWGHSHQ+FH+LVV+AA CH + +  SYE+VH RL
Sbjct: 272 GIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVHFRL 320

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  361 bits (927), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 168/275 (61%), Positives = 201/275 (73%)

Query: 38  VYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFF 97
           V  L  WD++P+WQKDNEHI+SGYVRETNS++    SLFY+HNES N+YSHL+PG+ F F
Sbjct: 49  VSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLF 108

Query: 98  TMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYL 157
             + NKY +  YSTT+  DYLMID+F  GA  CL LS ++HC KSHSL+V+  GNKLDY+
Sbjct: 109 IALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYI 168

Query: 158 GIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGL 217
           GIV LI  SMIS MY+GF+D+                ACA VSL  HFRSREWR YRA +
Sbjct: 169 GIVALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAI 228

Query: 218 FVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSF 277
           F AFGLS +LP++   FYYG  E + RIQLKW+ LEG  YI GA LYGVRFPEK  PGSF
Sbjct: 229 FTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSF 288

Query: 278 DIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSR 312
           DIWGHSHQ+FH+LVV+AA CHLR LLS Y+ VH+ 
Sbjct: 289 DIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  361 bits (926), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 172/310 (55%), Positives = 222/310 (71%), Gaps = 1/310 (0%)

Query: 4   TIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVR 63
           T+ +R  +              N   + + K KV+ +LY WDEIPEWQ+DN++I+ GYVR
Sbjct: 13  TLLERTKSVQELKKRAAGKTPANPAEVAEAK-KVLKRLYSWDEIPEWQRDNDYILHGYVR 71

Query: 64  ETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLF 123
           ET SF     SLFY+HNES N+YSHL+P + FF  ++L+K  I ++ TT+  D+++IDLF
Sbjct: 72  ETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIIDLF 131

Query: 124 FFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXX 183
           + GAF CLILSS FHC KSHSL++ATLGNKLDYLGI ILIVTSM SI+Y+G+++      
Sbjct: 132 YSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSLFC 191

Query: 184 XXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFI 243
                    G AC+ V+LKD FR REWRPYRAGLFV FGLS+I+PI +G + Y   E + 
Sbjct: 192 LFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEIWT 251

Query: 244 RIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLL 303
           +IQL W++L G  YI GA LYG+RFPEK  PG FDIWGHSHQ+FH LVV+A+FCHLRGLL
Sbjct: 252 QIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRGLL 311

Query: 304 SSYEIVHSRL 313
           +SYE+VH ++
Sbjct: 312 NSYELVHLKM 321

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  360 bits (924), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 223/310 (71%), Gaps = 1/310 (0%)

Query: 4   TIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVR 63
           T+ +R  +            + N   + + K KV+ +LY WDEIPEWQ+DN+ I+ GYVR
Sbjct: 13  TLLERTKSVQELKKRAAGKTSANPAEVAEAK-KVLKRLYSWDEIPEWQRDNDFILHGYVR 71

Query: 64  ETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLF 123
           ET+SF     SLFY+HNES N+YSHL+P + FF  ++L+K  I ++ TT+  D+++IDLF
Sbjct: 72  ETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVIDLF 131

Query: 124 FFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXX 183
           + GAF CLILSS FHC KSHSL++ATLGNKLDYLGI ILIVTSM+SI+++G+++      
Sbjct: 132 YSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSLFC 191

Query: 184 XXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFI 243
                    G AC+ VSLKD FR REWRPYRAGLFV FGLS+I+PI +G + Y   E + 
Sbjct: 192 LFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEIWT 251

Query: 244 RIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLL 303
           +IQL W++L G  YI GA LYG+RFPEK  PG FDIWGHSHQ+FH LVV+A+ CHLRGLL
Sbjct: 252 QIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRGLL 311

Query: 304 SSYEIVHSRL 313
           +SYE+VH ++
Sbjct: 312 NSYELVHIKM 321

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  355 bits (912), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 173/303 (57%), Positives = 211/303 (69%), Gaps = 4/303 (1%)

Query: 12  STTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGC 71
           S  T    +I  T       +V  +   ++Y WDEIP+WQKDNEHI+ GYVRET S+K  
Sbjct: 7   SVVTEETALIEETPGTKKTVRVYER---RVYSWDEIPDWQKDNEHILHGYVRETQSWKEL 63

Query: 72  LHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYG-ITIYSTTSIVDYLMIDLFFFGAFCC 130
            HSLFY+HNES N+Y+HL+P V  FF M+   +  I  Y TTS +DY MI+LFFFG   C
Sbjct: 64  FHSLFYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATC 123

Query: 131 LILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXX 190
           L +SS+FH  K HSL +AT GNKLDYLGIV+LI TSMISI+++GF D+            
Sbjct: 124 LTMSSMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTS 183

Query: 191 XXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWI 250
             G  C  +SLKD FRSREWRPYRA +FV FGLSA+ PI+AG   YG +ET+ R+QL W+
Sbjct: 184 LFGLICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWV 243

Query: 251 ILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVH 310
           I EG  YIFGAFLYGVRFPE+  PG FDIWGHSHQ+FH+LVVVAA CHL+ L+ SY +VH
Sbjct: 244 IWEGVLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVSYGLVH 303

Query: 311 SRL 313
             L
Sbjct: 304 QAL 306

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  278 bits (712), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 133/296 (44%), Positives = 187/296 (63%), Gaps = 11/296 (3%)

Query: 21  INNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHN 80
           + N  N  S EQ K+     L R++E+PEWQ+DNE I++GYVRET S + CL SL Y HN
Sbjct: 18  LKNGKNSKSAEQTKKSA---LCRFEELPEWQRDNEKILAGYVRETRSMRKCLESLTYFHN 74

Query: 81  ESGNVYSHLLPG-----VFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSS 135
           E+ N+Y+HL+P      +  FFT V   + I  + +T++ DY+MI+ +  GAF CL+ S+
Sbjct: 75  ETLNIYTHLIPSGTYLVLLMFFTDV---FLIPHFPSTTMSDYIMINFYLLGAFLCLLCST 131

Query: 136 LFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGA 195
            FHC K HS   + + +K+DY+GI++LI  S +S++Y+GF D               G  
Sbjct: 132 CFHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVVLGSC 191

Query: 196 CATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGF 255
           CA   L D F ++ WR  RAG FV FG S I+PI+ G   +G+ E+  R+QL++++LE F
Sbjct: 192 CAAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVLLEAF 251

Query: 256 FYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHS 311
           FYI GA +YG R PE  +PG FD  GHSHQIFHILVV+ + CH R L+ SY  +H+
Sbjct: 252 FYIGGAIIYGFRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMHT 307

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  268 bits (686), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 189/311 (60%), Gaps = 7/311 (2%)

Query: 4   TIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVR 63
           T++KR + S      G     ++G      + K    L+ ++E+PEWQKDN+ I+ GYVR
Sbjct: 6   TLRKRASKSV-----GESGGRNDGSIHAHGEEKSEKLLWHFNELPEWQKDNDKILRGYVR 60

Query: 64  ETNSFKGCLHSLFYVHNESGNVYSHLLPGVFF--FFTMVLNKYGITIYSTTSIVDYLMID 121
           ETNSFK CL SL Y++NES N+Y+HL+P VF+      + N + I +Y +TS VDY++I+
Sbjct: 61  ETNSFKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANVFLIPVYPSTSSVDYVIIN 120

Query: 122 LFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXX 181
           +FF GAF CL+ SS FHC K HS     + +KLDYLGI+ LI  S + ++Y+G+FD+   
Sbjct: 121 VFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIICLISCSTVPMIYYGYFDHISE 180

Query: 182 XXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEET 241
                         C+   L D F + E+RP RA  F  FG S I+P+ AG   +G E  
Sbjct: 181 FTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLFGFSGIIPLGAGFLKFGAEGV 240

Query: 242 FIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRG 301
             RI L +I LE  FYI GA +YG RFPE   PG FD +G SHQIFHI+VV+ + CHL  
Sbjct: 241 LQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFGSSHQIFHIMVVLGSICHLFA 300

Query: 302 LLSSYEIVHSR 312
           ++ SY ++HS 
Sbjct: 301 MVESYHLIHSN 311

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  268 bits (685), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 177/273 (64%), Gaps = 8/273 (2%)

Query: 44  WDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPG-----VFFFFT 98
           ++E+P+WQ+DN+ I++GYVRETNS K C  SL Y HNE+ N+Y+HL+P      +  FFT
Sbjct: 37  FEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVMLMFFT 96

Query: 99  MVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLG 158
              + + I  + TT++ DY+MI+ F  GAF CL+ S+ FHC K HS   + + +K+DY+G
Sbjct: 97  ---DLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDYMG 153

Query: 159 IVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLF 218
           I++LI  S +S++Y+GF+D               G  CA   L D F ++ WR  RAG F
Sbjct: 154 IIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFF 213

Query: 219 VAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFD 278
           V FG S I+PI+ G   +GI E+  R+QL++++LE  FYI GA +YG R PE  +PG FD
Sbjct: 214 VTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYGFRIPETLLPGKFD 273

Query: 279 IWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHS 311
             GHSHQIFHILVV+ + CH R LL SY  +H+
Sbjct: 274 FVGHSHQIFHILVVLGSLCHFRALLGSYFFMHT 306

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  266 bits (681), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 136/319 (42%), Positives = 194/319 (60%), Gaps = 11/319 (3%)

Query: 1   MPKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYK----LYRWDEIPEWQKDNEH 56
           M  T  +R N  +          T     +E V  + V++    L+ +DE+PEWQKDN+ 
Sbjct: 1   MSITTTRRRNQDSVCC-----KATRASIKVEAVSGQTVFEKQKLLHNFDELPEWQKDNDK 55

Query: 57  IISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPG-VFFFFTMVLNKYG-ITIYSTTSI 114
           I++GYVRET S+K CL+SLFY +NE+ N+Y+HL+P  V+F F + L  Y  I ++ +TS 
Sbjct: 56  ILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITLTNYFLIPVFPSTSW 115

Query: 115 VDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFG 174
            DY +I++F  GAF CL+ SS FHC K HS K +   +KLDYLGI+ LI  SMI I+YFG
Sbjct: 116 SDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFG 175

Query: 175 FFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTF 234
           +FD+                 C    L D F +  +RP+RA  F+ FG S +LP+  G F
Sbjct: 176 YFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGFF 235

Query: 235 YYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVA 294
            +GI+    RI++ ++  E  FYI GA +YG R PE   PG FD +G SHQIFHI+VV+ 
Sbjct: 236 KFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLG 295

Query: 295 AFCHLRGLLSSYEIVHSRL 313
           + CHL+ ++ SY+++HS +
Sbjct: 296 SVCHLKAIIDSYKLMHSHI 314

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  265 bits (678), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 129/302 (42%), Positives = 187/302 (61%), Gaps = 2/302 (0%)

Query: 12  STTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGC 71
           S+TT V      T    +      K   +L  ++E+P+WQKDNE I+ GYVRET S   C
Sbjct: 2   SSTTTVRQRRKTTQKASAESIATAKGRKRLCTFEELPDWQKDNELILDGYVRETRSVSEC 61

Query: 72  LHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITI--YSTTSIVDYLMIDLFFFGAFC 129
             SL Y HNE+ N+Y+HL+PGV +   ++     I I  + ++++ DY++I+ F  GAF 
Sbjct: 62  FKSLLYFHNETVNIYTHLVPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAFV 121

Query: 130 CLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXX 189
           CL+ SS FHC K HS + + + +K+DY+GI++LI  SM+SI+Y+GF D+           
Sbjct: 122 CLMCSSCFHCLKQHSEEHSDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVVT 181

Query: 190 XXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKW 249
              G  CA   L D F S+ +R +RA  FV+FG S ++PI+ G   +GI E+  R+QLK+
Sbjct: 182 VILGSCCAAFVLNDRFNSKNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLKY 241

Query: 250 IILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIV 309
           + LE  FYI GA  YG R PE + PG FD+ GHSHQIFH++VV+ + CHLR ++ SY  +
Sbjct: 242 VGLEAVFYIGGAVFYGFRIPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIFM 301

Query: 310 HS 311
           H+
Sbjct: 302 HT 303

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  266 bits (679), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 136/317 (42%), Positives = 194/317 (61%), Gaps = 7/317 (2%)

Query: 1   MPKTIQKRGNTSTT--TVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHII 58
           M  T  +R N  +   +V  G I       +    K+K+   L+ +DE+PEWQKDN+ I+
Sbjct: 1   MSLTTTRRRNQESVCCSVTTGSIKVEAVSSTTVSEKKKL---LHNFDELPEWQKDNDKIL 57

Query: 59  SGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFF-FTMVLNKY-GITIYSTTSIVD 116
           +GYVRET S+K CL+SLFY +NE+ N+Y+HL+P V +F F + L  Y  I ++ +TS  D
Sbjct: 58  TGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAVIYFVFAITLTNYFLIPVFPSTSWSD 117

Query: 117 YLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFF 176
           Y +I++F  GAF CL+ SS FHC K HS K +   +KLDYLGI+ LI  SMI I+YFG+F
Sbjct: 118 YTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGIISLISCSMIPIIYFGYF 177

Query: 177 DNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYY 236
           D+                 C    L + F +  +RP+RA  F+ FG S +LP+  G F +
Sbjct: 178 DHISYFSLFTIVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFFKF 237

Query: 237 GIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAF 296
           GI+    RI++ ++  E  FYI GA +YG R PE   PG FD  G SHQIFHI+VV+ + 
Sbjct: 238 GIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFLGSSHQIFHIMVVLGSI 297

Query: 297 CHLRGLLSSYEIVHSRL 313
           CHL+ ++ SY+++HS +
Sbjct: 298 CHLKAIIGSYKLMHSHI 314

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  264 bits (675), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 133/317 (41%), Positives = 193/317 (60%), Gaps = 12/317 (3%)

Query: 1   MPKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYK----LYRWDEIPEWQKDNEH 56
           M  T  +R N       E +   T     +E +K KV  +    L+ + E+P+WQ+DN+ 
Sbjct: 1   MSITATRRRNQ------ENVCCKTSTSIKVEALKSKVTLRKEKLLHDFHELPDWQRDNDK 54

Query: 57  IISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPG-VFFFFTMVLNKYG-ITIYSTTSI 114
           I++GYVRET S+K CL+SLFY +NE+ N+Y+HL+P  V+F F + L  Y  I ++ +T+ 
Sbjct: 55  ILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNYFLIPVFPSTTW 114

Query: 115 VDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFG 174
            DY +I++F  GAF CL+ SS FHC K HS K +   +KLDYLGI+ LI  SMI I+YFG
Sbjct: 115 SDYTVINIFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLISCSMIPIIYFG 174

Query: 175 FFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTF 234
           +FD+                 C    L D F +  +RP+RA  F+ FG S +LP+  G F
Sbjct: 175 YFDHASYFSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGFSGLLPLTTGLF 234

Query: 235 YYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVA 294
            +G++    RI++ ++  E  FYI GA +YG R PE   PG FD +G SHQIFHI+VV+ 
Sbjct: 235 KFGLQGVLNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSSHQIFHIMVVLG 294

Query: 295 AFCHLRGLLSSYEIVHS 311
           + CHL+ ++ SY+++HS
Sbjct: 295 SVCHLKAIIDSYKLMHS 311

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  263 bits (673), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 191/319 (59%), Gaps = 11/319 (3%)

Query: 1   MPKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYK----LYRWDEIPEWQKDNEH 56
           M  T  +R N  +          T     +E V+ K   +    L+ +DE+PEWQKDN+ 
Sbjct: 1   MSITTTRRRNQESVCC-----KATTASIKVEAVQSKTASEKEKLLHNFDELPEWQKDNDK 55

Query: 57  IISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGV-FFFFTMVLNKY-GITIYSTTSI 114
           I++GYVRET S+K CL SLFY +NE+ N+Y+HL+P + +F F + L  Y  I ++ +TS 
Sbjct: 56  ILTGYVRETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITLTNYFLIPVFPSTSW 115

Query: 115 VDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFG 174
            DY +I++F  GAF CL+ SS FHC K HS + +   +KLDYLGI+ LI  SMI I+YFG
Sbjct: 116 SDYTVINIFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGIISLISCSMIPIIYFG 175

Query: 175 FFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTF 234
           +FD+                 C    L + F +  +RP+RA  F+ FG S +LP+  G F
Sbjct: 176 YFDHVSYFSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFILFGFSGLLPLTTGFF 235

Query: 235 YYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVA 294
            +GI+    RI++ ++  E  FYI GA +YG R PE   PG FD  G SHQIFHI+VV+ 
Sbjct: 236 KFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFLGSSHQIFHIMVVLG 295

Query: 295 AFCHLRGLLSSYEIVHSRL 313
           + CHL+ ++ SY+++HS +
Sbjct: 296 SLCHLKAIIDSYKLMHSHI 314

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  259 bits (663), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 137/312 (43%), Positives = 192/312 (61%), Gaps = 5/312 (1%)

Query: 4   TIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVR 63
           T  +R  T    V  G  N   +GD   + KR    +L+ ++E+PEWQ+DN+ I++GYVR
Sbjct: 5   TTTRRKPTKVQAVAVGSSNKHADGD---KTKRNWKRRLFNFNELPEWQRDNDKILTGYVR 61

Query: 64  ETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMV--LNKYGITIYSTTSIVDYLMID 121
           ET SFK CL SL Y +NE+ N+Y+HL+P +F+    V  +N   +  + TTSI+DY +I+
Sbjct: 62  ETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDYFVIN 121

Query: 122 LFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXX 181
           +F  GAF CLILSS FHC K HS +  TL +KLDY+GI+ILI  S+I ++YFG+FD+   
Sbjct: 122 VFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFDHLYY 181

Query: 182 XXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEET 241
                         C+   L + F    +RP+RA +F+ F  S  +PIL G + +G    
Sbjct: 182 VNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFGFHGV 241

Query: 242 FIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRG 301
           F R+ LK++  E  FYI GA LYG R PE + PG FD  G SHQIFHILVV+ + CH R 
Sbjct: 242 FERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSICHFRA 301

Query: 302 LLSSYEIVHSRL 313
           ++ SY ++HS +
Sbjct: 302 VIKSYILMHSSM 313

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  260 bits (664), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 188/311 (60%), Gaps = 5/311 (1%)

Query: 8   RGNTSTTTVVEGIINNTDNGDSI---EQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRE 64
           RG   ++ +     + + NG  +    ++      KLY + E+PEWQKDNE II GYVRE
Sbjct: 9   RGEEQSSKLSRRRFSVSKNGTVLLESTEIVETYSKKLYSFHELPEWQKDNELIIQGYVRE 68

Query: 65  TNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITI--YSTTSIVDYLMIDL 122
           TNS+  C HSL Y HNES N+Y+HL+PG+ +F  ++     + +  + +T+I+DY++ID 
Sbjct: 69  TNSWFKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIVIDF 128

Query: 123 FFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXX 182
           +  GAF CL+ SS FHC K HS   +   +K+DY+GI+ LI  S+IS++Y+G+FD+    
Sbjct: 129 YLLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHFIYF 188

Query: 183 XXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETF 242
                        C    L + F ++ +RP RAG FV F  SA++PI  G   +   E  
Sbjct: 189 KVFTLITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYVEVI 248

Query: 243 IRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGL 302
            RIQL+++  E FFY+ GA LYG R PE + PG FD+ G SHQIFH++VV+ +  HL+ +
Sbjct: 249 NRIQLRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKAV 308

Query: 303 LSSYEIVHSRL 313
           + SYE +H  L
Sbjct: 309 IGSYEFMHKSL 319

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  259 bits (661), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 186/305 (60%), Gaps = 19/305 (6%)

Query: 28  DSIEQVKRKVV----------YK-------LYRWDEIPEWQKDNEHIISGYVRETNSFKG 70
            SI +VKR+ V          YK       LY + E+PEWQ+DN+ I++GY+RET S   
Sbjct: 2   SSITEVKRRRVPIGNGNGEGLYKEVLEEKTLYDFHELPEWQQDNDKILTGYIRETKSVLK 61

Query: 71  CLHSLFYVHNESGNVYSHLLPGVFFFFTM--VLNKYGITIYSTTSIVDYLMIDLFFFGAF 128
           C+ SLF  +NE+ N+Y+HL+  V +F  M  + +   +  + T++  DY +I+ +  GAF
Sbjct: 62  CVRSLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAF 121

Query: 129 CCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXX 188
            CL+ SS FH FK HS   +   +K+DY+GI++LI  SMIS++Y+GFFD+          
Sbjct: 122 GCLMCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVL 181

Query: 189 XXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLK 248
                 AC    L D F  +++RP RAG F+AFGLS + P+ AG   +GI+    R+QLK
Sbjct: 182 TLTLATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLK 241

Query: 249 WIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEI 308
           ++ LE  FYI GA +YG R PE   PG FD WGHSHQIFH+LVV+A+F HL+ ++ SY  
Sbjct: 242 YLGLEAIFYIAGALIYGFRIPETMFPGRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIF 301

Query: 309 VHSRL 313
            HS L
Sbjct: 302 KHSHL 306

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  257 bits (656), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 125/305 (40%), Positives = 188/305 (61%), Gaps = 2/305 (0%)

Query: 11  TSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKG 70
           +STTT+ +      +   + +     +  KLY ++E+PEWQ+DN+ I++GYVRET S   
Sbjct: 2   SSTTTIRQRKTTVQETQKARDSKDGIMGKKLYHFNELPEWQQDNDKILTGYVRETKSVLR 61

Query: 71  CLHSLFYVHNESGNVYSHLLPGVFFFFTMVL--NKYGITIYSTTSIVDYLMIDLFFFGAF 128
           CL SL Y +NES N+Y+HLL  V +F  ++   +   I  + +T++ DY++I+ +  GAF
Sbjct: 62  CLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIINFYLLGAF 121

Query: 129 CCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXX 188
            CL+ SS FHCFK HS   +   +K+DY+GI+ LI  S+IS++Y+G+FD+          
Sbjct: 122 VCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFYFKLFSVI 181

Query: 189 XXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLK 248
                 AC+   L D F + + RP RA  F+ F  S+++PI  G F +G  E F R+QL+
Sbjct: 182 TVVLAMACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEVFHRVQLR 241

Query: 249 WIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEI 308
           ++  E FFY+ GA LYG R PE   PG FD  G SHQ+FH+LVV+ +FCHLR ++ SY  
Sbjct: 242 FVGWEAFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRAVMGSYMF 301

Query: 309 VHSRL 313
           +H+ +
Sbjct: 302 MHAHI 306

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  257 bits (656), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 130/305 (42%), Positives = 183/305 (60%), Gaps = 10/305 (3%)

Query: 6   QKRGNTSTT--TVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVR 63
           ++RG    T   + + + + T  G       +K + KLY +DE+P WQKDNE I+SGYVR
Sbjct: 3   EERGMKEQTISEMAQEMAHTTSEG------LKKRIRKLYTFDELPAWQKDNELILSGYVR 56

Query: 64  ETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFF--FTMVLNKYGITIYSTTSIVDYLMID 121
           ETNS K CL ++ Y +NES N+Y+HL+PGV +   F +  +     +       ++ M+ 
Sbjct: 57  ETNSVKECLRAMTYFNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLR 116

Query: 122 LFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXX 181
            +  GAF CL  SS FHC K HS   + L +K+DYLGI+  I  S IS++Y+G+   P  
Sbjct: 117 FYLLGAFTCLACSSCFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSH 176

Query: 182 XXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEET 241
                        ACA + L D F +  +RP RA LF+AFGLS ++P+LAG++ +G  E 
Sbjct: 177 FVFFSTLTVALCSACAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEW 236

Query: 242 FIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRG 301
             RIQLK+++ E  FYI GA +YG R PE++ PG FD+ GHSHQIFH+LVV+   CH R 
Sbjct: 237 AARIQLKYVLYEAVFYITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRA 296

Query: 302 LLSSY 306
           +  SY
Sbjct: 297 VTGSY 301

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  252 bits (644), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 124/276 (44%), Positives = 176/276 (63%), Gaps = 2/276 (0%)

Query: 40  KLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTM 99
           KL  + E+P+WQKDNE I++GYVRETNS K CL SL   +NES N+YSHL+  + +F  +
Sbjct: 40  KLCHFHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVL 99

Query: 100 VL--NKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYL 157
           +   +   I  + +T+ VDY++IDL+  GAF CLI SSLFHC K HS   + + +K+DY+
Sbjct: 100 LFYTDILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYI 159

Query: 158 GIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGL 217
           GI+ LI  S+IS++Y+G+ D+                 C    L   F S+ +RP RAG 
Sbjct: 160 GIICLITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGF 219

Query: 218 FVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSF 277
           F+ F +SA++PI AG   +G  E   RIQL+++  E FFY+ GA LYG R PE   PG+F
Sbjct: 220 FILFSMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNF 279

Query: 278 DIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313
           D+ G SHQIFHI+V++ +  HL+ +L SY  +HS +
Sbjct: 280 DLVGSSHQIFHIMVILGSVFHLKAVLGSYTFMHSNI 315

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  252 bits (643), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 128/310 (41%), Positives = 191/310 (61%), Gaps = 4/310 (1%)

Query: 5   IQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRE 64
           ++ R N+         + + D     +  +RK    L ++DE+PEWQKDN+ I++GYVRE
Sbjct: 17  LRSRSNSVGGIFETNHLEDNDTSQKPKTNRRKRKIHLSKFDELPEWQKDNDKILTGYVRE 76

Query: 65  TNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFT----MVLNKYGITIYSTTSIVDYLMI 120
           TNSF  C  SLFY++NE+ N+Y+HL+P + +       + +N   I  + TTS++DY++I
Sbjct: 77  TNSFIHCFQSLFYLNNETINIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVI 136

Query: 121 DLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPX 180
           ++F  GAF CL+LSS FHC K HS K  TL +KLDY+GI+ILI  S+I I+YFG+FD   
Sbjct: 137 NIFILGAFTCLLLSSCFHCLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLS 196

Query: 181 XXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEE 240
                          C+ + L + F    +RP RAGLF+ F  + ++P++ G + +G + 
Sbjct: 197 YFKFFTILTFSFAIVCSIIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKG 256

Query: 241 TFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLR 300
              RI L +++LE  FYI G  LYG R PE + PG+FD++G SHQIFHI VV+ + CH  
Sbjct: 257 VMERISLNFVLLEAIFYIIGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICHFG 316

Query: 301 GLLSSYEIVH 310
            ++ SY ++H
Sbjct: 317 AVIKSYCLMH 326

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  249 bits (637), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 175/275 (63%), Gaps = 2/275 (0%)

Query: 34  KRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGV 93
           K+    +LY +DE+PEWQKDNE I  GYVRETNSF  CL S+ Y +NES N+Y+HL+P V
Sbjct: 15  KKNFNRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSV 74

Query: 94  FFFFTMVLNKYGIT--IYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLG 151
            +F  ++L    +   ++  T++ +Y+MID + FG F CL+ S+ FHC K HS     + 
Sbjct: 75  TYFILLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIW 134

Query: 152 NKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWR 211
           +K+DY+GI++ I +S++SI+Y+GF+D+              G  C T  L D F + ++R
Sbjct: 135 SKVDYIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYR 194

Query: 212 PYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEK 271
             RA  F  FG S ++P+L G + +G+ E   RIQLK+++    FYIFGA +YG R PE 
Sbjct: 195 LLRAIFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEA 254

Query: 272 YVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSY 306
             PG FD  GHSHQIFH+LVV+ + CH R ++ SY
Sbjct: 255 LAPGKFDFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  246 bits (628), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 126/303 (41%), Positives = 187/303 (61%), Gaps = 3/303 (0%)

Query: 12  STTTVVEGIINNTDNGDSIEQVK-RKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKG 70
           S TT +    + ++  + +  V     + +LYR+ E+PEWQ+DN+ II+GY+RET S K 
Sbjct: 2   SATTTIRHRRSISEKLEQLTPVAISSTIKRLYRYSELPEWQQDNDKIITGYIRETKSVKE 61

Query: 71  CLHSLFYVHNESGNVYSHLLPGVFFFFTMV--LNKYGITIYSTTSIVDYLMIDLFFFGAF 128
           C+ SLF  HNES N+YSHL+P + +   +V   + + +  +  ++++  +MI  F  G+ 
Sbjct: 62  CVKSLFLFHNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSV 121

Query: 129 CCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXX 188
            CL  SS FHC K HS     + +K+DY+GI+I+I  S+IS++Y+GF D+          
Sbjct: 122 LCLGCSSFFHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVF 181

Query: 189 XXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLK 248
               G  C   +L D F S+ +RP+RA  +V FGLS I+PI+ G + +G  E   R+QLK
Sbjct: 182 TVILGTICTVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLK 241

Query: 249 WIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEI 308
           +++LE  FYI GA +YG RFPE   PG FD  GHSHQIFHI+VV+ + CH R +L SY  
Sbjct: 242 YVLLEAMFYIAGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVF 301

Query: 309 VHS 311
           +H+
Sbjct: 302 MHT 304

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  239 bits (610), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 120/313 (38%), Positives = 182/313 (58%), Gaps = 10/313 (3%)

Query: 6   QKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRET 65
           + R  + +    +  I  T +  SI+  KR     LY + E+P WQ+DN+ I+ GYVRET
Sbjct: 8   RTRKRSKSFRSAKSTITRTRSDSSIKIEKRI----LYHFHELPTWQQDNDKILGGYVRET 63

Query: 66  NSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVL------NKYGITIYSTTSIVDYLM 119
           NSF  C+ SLFY++NES N+YSHL+P + +    V+          I IY TT+  D++ 
Sbjct: 64  NSFTKCIESLFYLNNESINIYSHLIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFIF 123

Query: 120 IDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNP 179
           I++F  GAF CL+ S  FH  K HS       +++DY+GI++LI  SM+ ++Y+GFFD+ 
Sbjct: 124 INIFLVGAFLCLLGSGCFHLLKQHSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHI 183

Query: 180 XXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIE 239
                           C+ + + + F   ++R  RA +F AFG S ++P++ G   +G+ 
Sbjct: 184 VLFYCFITLTLAFASVCSIIVMSETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLS 243

Query: 240 ETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHL 299
             F RI LK+I  E  FY+ GA LYG R PE  +PG FD++G SHQ+FH  VV+ +  H 
Sbjct: 244 GVFQRISLKFIFWESVFYLVGATLYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLHF 303

Query: 300 RGLLSSYEIVHSR 312
           + ++ SY ++HSR
Sbjct: 304 KAVIESYILMHSR 316

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  237 bits (604), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 192/327 (58%), Gaps = 19/327 (5%)

Query: 1   MPKTIQKR----GNTS--TTTVVEG-----IINNTDNGDSIEQVKRKVVYKLYRWDEIPE 49
           M   ++KR    G T+  T TV  G     ++  T +G    Q  R     L R++E+P 
Sbjct: 1   MSSELRKRAVSLGETAIETATVSRGSRGKLLVTGTSSGAPSGQRGR-----LCRYEELPA 55

Query: 50  WQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFF--TMVLNKYGIT 107
           WQ+DN+ I +GYVRET S + CL SL Y +NES N+YSHL+P V +    T+ L+++G+ 
Sbjct: 56  WQQDNDCIRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVP 115

Query: 108 IYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSM 167
            + TT+  DYL+I+ F  GA  CL+ SSLFHC K HS +     +++DY+GI++LI  S 
Sbjct: 116 RFPTTTWSDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACST 175

Query: 168 ISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSL-KDHFRSREWRPYRAGLFVAFGLSAI 226
           I ++YFG+FD               G AC+ V L    F S  ++  RA  F+AF  + +
Sbjct: 176 IPMIYFGYFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGL 235

Query: 227 LPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQI 286
           +P+  G   +GI     RI LK++  E  FYI GA LYG R PE ++PG  D+WG+SHQ+
Sbjct: 236 IPMATGFVKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQM 295

Query: 287 FHILVVVAAFCHLRGLLSSYEIVHSRL 313
           FH++VV  + CHL+ +L SY ++H  L
Sbjct: 296 FHVMVVFGSLCHLKAVLESYSLMHRHL 322

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  233 bits (595), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 176/295 (59%), Gaps = 12/295 (4%)

Query: 27  GDSIEQVKRKVVYKL-YRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGNV 85
             + E VK+K+   L Y ++E+P WQ+DNE I++GY+RETNS+K CL SL + HNE+ N+
Sbjct: 28  SQAAEDVKQKITDTLLYTYEELPSWQQDNEMILTGYIRETNSWKLCLRSLTFFHNETINI 87

Query: 86  YSH-------LLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFH 138
           YSH       LL  VFFF  ++     +  + TT++ DYL++D++  GA  CL LSS FH
Sbjct: 88  YSHGISAAIYLLLLVFFFTNLIY----LPSFPTTTLHDYLVLDIYLLGAATCLTLSSCFH 143

Query: 139 CFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACAT 198
           C K HS   + + +K+DY+GI+ LI  S IS++YFG+ D+                 C  
Sbjct: 144 CLKQHSQSQSDIWSKMDYIGIICLITCSTISLLYFGYRDHFNYFKFFAISTFILAITCTV 203

Query: 199 VSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYI 258
               + F +R+W+  RA  F+AF  S ++P++ G   +G  E + R+QL  + LE   Y+
Sbjct: 204 FVTMEKFNTRDWKHVRALFFIAFAGSGLIPLITGINIFGFPEVWQRVQLPSLTLELICYV 263

Query: 259 FGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313
            GA LYG R PE + PG FD  G+SHQ FHI VV+ +  HLR L+ SY  +HS L
Sbjct: 264 IGALLYGYRIPEVFAPGKFDNIGNSHQWFHIFVVLGSLLHLRALVGSYYFMHSFL 318

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  154 bits (389), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/290 (30%), Positives = 147/290 (50%), Gaps = 34/290 (11%)

Query: 40  KLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTM 99
           +L  ++++P+WQKDN  I++ YVRETNS    L S+F  H+ES N+++HL+P + +    
Sbjct: 7   QLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPALLY---- 62

Query: 100 VLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYLGI 159
              K+     +T   V Y ++  +      C +LSSLFH FK  S++      KLDY+GI
Sbjct: 63  --AKFTYNAITTLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGI 119

Query: 160 VILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACAT-----VSLKDHFRSRE----- 209
            +LI  +++S+   GF ++                +C T     +++K H +  E     
Sbjct: 120 SLLINATIVSMALLGFNES---RYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDN 176

Query: 210 --------------WRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGF 255
                          +  RA LF + GLS ++P++ G + YG +  + +I +  +I    
Sbjct: 177 DGTLSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVL 236

Query: 256 FYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSS 305
            YI G  +Y  + PEK+ PG FD+ G SHQ+FHI +V    CH   + ++
Sbjct: 237 CYIVGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAIQTA 286

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  145 bits (366), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/277 (34%), Positives = 151/277 (54%), Gaps = 13/277 (4%)

Query: 45  DEIPEWQKD--NEHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVF--FFFTMV 100
            E+P+WQK   N  II+GYVRETNS   CLH++ Y +N++ N+   +L  VF   +FT++
Sbjct: 45  KELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNI---ILNTVFSTVYFTLL 101

Query: 101 L---NKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYL 157
           L   + Y I     T++ DY+M++ + FGAF    L+S+F+  +SHSL    L  KL +L
Sbjct: 102 LFFTDLYLIPSSPATTMSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHL 161

Query: 158 GIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGL 217
             +  I TS+I+ +Y+ FFDN                  A  +L + F  R+ R  R  +
Sbjct: 162 AFINYISTSIITQLYYTFFDNVFYFKFLTISTLLISSIFAIFTLSEQFL-RKNRSQRNMV 220

Query: 218 FVAFGLS-AILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGS 276
            + F +S  ILP  +  F +       R++ K I+LE   Y+F   L  V+ PE++   +
Sbjct: 221 SITFIVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERF-SEN 279

Query: 277 FDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313
           FD  G+S  I+HI +++ +  H + LL+SY  +HS L
Sbjct: 280 FDFIGNSENIYHICIILGSLLHFKMLLNSYFFMHSGL 316

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  130 bits (326), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 89/299 (29%), Positives = 160/299 (53%), Gaps = 19/299 (6%)

Query: 27  GDSIEQVKR-KVVYKL-----YRWDEIPEWQKD--NEHIISGYVRETNSFKGCLHSLFYV 78
            D+    KR  V+ KL     Y+  E+PEWQ++  +  +I+G+++ETNSFK CL S  Y 
Sbjct: 13  NDNYPTSKRYTVISKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYW 72

Query: 79  HNESGNVYSHLLPG-----VFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLIL 133
           HN S N+  + +       + FFFT   + Y I  + +T++ DY++++L+   A    ++
Sbjct: 73  HNSSINISLNGIAATVYFMLLFFFT---DCYLIPSFPSTTMSDYIVLNLYLLTATQNFMV 129

Query: 134 SSLFHCFKSHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXG 193
            ++F+  KSHS + A L  KL+ +G++  I +S+++++Y+ +FD                
Sbjct: 130 GTIFYIMKSHSKQQAFLWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLI 189

Query: 194 GACATVSLKDHFRSREWRPYRAGLFVAF-GLSAILPILAGTFYYGIEETFIRIQLKWIIL 252
                  + D F ++  R  +  L +A+  L  ++P L     +G+ +   RI L  IIL
Sbjct: 190 TLFTCSIISDSF-NKMTRIRKNFLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIIL 248

Query: 253 EGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHS 311
           E F Y FG  +   + PE++   SFD  G+S  ++ + ++V +F H + L++SY ++HS
Sbjct: 249 EIFIYAFGLTIRTSQLPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMHS 306

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 92.4 bits (228), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 137/297 (46%), Gaps = 24/297 (8%)

Query: 34  KRKVVYKLYRWDEIPEWQKD--NEHIISGYVRETN-SFKGCLHSLFYVHNESGNVYSHLL 90
           K+ V  K+   +++P W +   N  I +GY   TN ++ GCL  L   +N+S ++Y +L+
Sbjct: 3   KKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNLV 62

Query: 91  PGV-----FFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSL 145
            G+       F+T V     I  + +T++ DY++I+LF           +L    K HS 
Sbjct: 63  CGLISGVMLLFYTDV---RLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSE 119

Query: 146 KVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHF 205
               L N+   L +V+L+  S+++++Y+ FFD+                  + V + D +
Sbjct: 120 YQGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQY 179

Query: 206 RSREWRPYRAGLFVAFG-LSAILPILAGTFYYGIEETF--IRIQLKWIILEGFFYIFGAF 262
           +    R  +    V FG LS  LPI      +G+ +++   RI  + +  E   Y   A 
Sbjct: 180 K----RVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAM 235

Query: 263 LYGVRFPE---KYVPGSF---DIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSRL 313
           L   R PE     +  SF   D  G+S Q+  ++ + A   H   ++ +YE+VH+ +
Sbjct: 236 LQLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVHASI 292

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 105/230 (45%), Gaps = 4/230 (1%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYG 105
           ++P   ++N +II+ Y R  +S K  L S+F +HNE+ N++SHLL  ++F + +  +   
Sbjct: 197 QLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDLPN 255

Query: 106 ITIYSTTSI--VDYLMIDLFFFGAFCCLILSSLFHCFKSHS-LKVATLGNKLDYLGIVIL 162
             I S++ +     L + LF F +  C++ S+ +H F   S LK+      +DY GI IL
Sbjct: 256 SIIVSSSMVPTTAKLFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGISIL 315

Query: 163 IVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFG 222
           I +S++SI +   +D P             G     ++    F S E RP R   F+   
Sbjct: 316 ITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFILLS 375

Query: 223 LSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKY 272
                 +L   F        I + L        +Y+ G   YG   PE++
Sbjct: 376 SCGAFALLHLVFLEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPERF 425

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 75.9 bits (185), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 83/318 (26%), Positives = 143/318 (44%), Gaps = 35/318 (11%)

Query: 2   PKTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGY 61
           PKT  ++ + +T  V       T N D    V+ K   K + + ++ +WQK         
Sbjct: 14  PKTATEKYSDATGAV-------TSNAD----VETKETKKGFPFHDLAKWQKQ-------- 54

Query: 62  VRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIY-STTSIVDYLMI 120
            +  +S    L +L Y+    G++ S  L     FFT   + Y I ++ +TT++ DY++ 
Sbjct: 55  YKNKSSRSESLVALIYL---LGSMSSFCL---LIFFT---DFYLIPLFPTTTTMTDYIVF 105

Query: 121 DLFFFGAFCCLILSSLFHCFKSHSLKV-ATLGNKLDYLGIVILIVTSMISIMYFGFFDNP 179
           + +    F   ++  ++H  K+ SL+    +  K  YL  + L+++S I+I+Y+ F+D  
Sbjct: 106 NFYLLNVFVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDYV 165

Query: 180 XXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAI-LPILAGTFYY-G 237
                        G A   V L D   S + R  +   F++  +    LP+L     + G
Sbjct: 166 FFFKIFTLLMTFIGLAAYFVILTDKLNSYK-RFNKTVFFISVSVVCCSLPLLTAIITFDG 224

Query: 238 IEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSF--DIWGHSHQIFHILVVVAA 295
           +E    RI+L  I  E    +  + +Y  RFPE     +   + W HS   FH+L+   A
Sbjct: 225 LENLKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGTA 284

Query: 296 FCHLRGLLSSYEIVHSRL 313
           F H   L+ SY ++HS L
Sbjct: 285 FYHFFILIQSYILMHSSL 302

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 70.9 bits (172), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 138/318 (43%), Gaps = 28/318 (8%)

Query: 4   TIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVR 63
           T  ++      T  E   N+T   +S    K K   K + + ++ +WQ+  ++  S    
Sbjct: 5   TTVEQSPAKCNTTPEKCNNSTAEINSTVGAKTKETKKGFPFHDLAKWQEQYKNKSS---- 60

Query: 64  ETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVL--NKYGITIY-STTSIVDYLMI 120
                           NES     +LL  +  F  ++   + Y I ++ +TT++ DY++ 
Sbjct: 61  ---------------RNESVVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVF 105

Query: 121 DLFFFGAFCCLILSSLFHCFKSHSLKV-ATLGNKLDYLGIVILIVTSMISIMYFGFFDNP 179
           + +    F   ++  ++H  K+ SL+       K  YL  + L+++S I+I+Y+ F+D  
Sbjct: 106 NFYLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYV 165

Query: 180 XXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFG-LSAILPILAGTFYY-G 237
                        G       L D   S + R  +   F++   +   LP+L     + G
Sbjct: 166 FFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFDG 224

Query: 238 IEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSF--DIWGHSHQIFHILVVVAA 295
           +E    RI++  I  E    +  + +Y  RFPE ++ G    + W HS  +FH+++  AA
Sbjct: 225 LENLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAA 284

Query: 296 FCHLRGLLSSYEIVHSRL 313
           F H   L+ SY ++HS L
Sbjct: 285 FYHFFILIQSYILMHSSL 302

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 142/317 (44%), Gaps = 27/317 (8%)

Query: 4   TIQKRGNTSTTTVVEGIINNT-DNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYV 62
           T+++      TT  +G  N T +  +S    + K + K + + ++ +WQ+          
Sbjct: 6   TVEQSPAKCKTTTEKG--NGTGETTNSNVDAETKEIKKGFPFHDLAKWQQQ--------Y 55

Query: 63  RETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIY-STTSIVDYLMID 121
           R  +S    L +L Y+    G++ S  L     FFT   + Y I ++ +TT++ DY++ +
Sbjct: 56  RNKSSRNESLVALIYL---LGSMSSFCL---LIFFT---DFYLIPLFPTTTTMTDYIVFN 106

Query: 122 LFFFGAFCCLILSSLFHCFKSHSLKVATLG-NKLDYLGIVILIVTSMISIMYFGFFDNPX 180
            +    F   ++  ++H  K+ SL+       K  YL  + L+++S I+I+Y+ F+D   
Sbjct: 107 FYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVF 166

Query: 181 XXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAI-LPILAGTFYY-GI 238
                       G       L D   S + R  +   F++  +    LP+L     + G+
Sbjct: 167 FFKIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGL 225

Query: 239 EETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYV--PGSFDIWGHSHQIFHILVVVAAF 296
           E    RI++K I  E    +  + +Y  RFPE         + W HS  +FH+++   AF
Sbjct: 226 ENLKERIKVKAITCELVALVAASIIYVTRFPESLFRRNKKEESWNHSEYLFHLVISGTAF 285

Query: 297 CHLRGLLSSYEIVHSRL 313
            H   L+ SY ++HS L
Sbjct: 286 YHFFILIQSYILMHSSL 302

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 67.4 bits (163), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 137/314 (43%), Gaps = 26/314 (8%)

Query: 6   QKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRET 65
           Q      TTT  E   N+T   DS E  + K   K + + ++ + QK          +  
Sbjct: 9   QSPVKCETTTEKES--NDTRGTDSNENAETKETKKGFPFHDLAKLQKQ--------YKNK 58

Query: 66  NSFKGCLHSLFYVHNESGNVYSHLLPGVFFFFTMVLNKYGITIY-STTSIVDYLMIDLFF 124
           +S    L +L Y+    G++ S  L     FFT   + Y I ++ +TT++ DY++ + + 
Sbjct: 59  SSRNESLVALIYL---LGSMLSFCL---LIFFT---DFYLIPLFPTTTTMTDYIVFNFYL 109

Query: 125 FGAFCCLILSSLFHCFKSHSLKVATLG-NKLDYLGIVILIVTSMISIMYFGFFDNPXXXX 183
              F   ++  ++H  K+ SL+       K  YL  + L+++S I+I+Y+ F+D      
Sbjct: 110 LNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFK 169

Query: 184 XXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAI-LPILAGTFYY-GIEET 241
                    G       L D   S + R  +   F++  +    LP+L     + G+E  
Sbjct: 170 IFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENL 228

Query: 242 FIRIQLKWIILEGFFYIFGAFLYGVRFPEKYV--PGSFDIWGHSHQIFHILVVVAAFCHL 299
             RI++  I  E    +  + +Y  RFPE         + W HS  +FH+L+   AF H 
Sbjct: 229 KERIKVNAITWELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHF 288

Query: 300 RGLLSSYEIVHSRL 313
             L+ SY ++HS L
Sbjct: 289 FILIQSYILMHSSL 302

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 103/236 (43%), Gaps = 14/236 (5%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSLFYV---HNESGNVYSHLLPGVFFFFTMVLN 102
           ++P   ++N +II  Y R  +S K  L S+F     HNES N+++HLL  ++  +  + +
Sbjct: 254 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNESSNIWTHLLGAIYLIYLSIYD 312

Query: 103 KYGITIYSTTSI--VDYLMIDLFFFGAFCCLILSSLFHCFKSHS-LKVATLGNKLDYLGI 159
                I+ +  +     L++ LF F A  CL+ S  +H F   S LK+ +    +DY GI
Sbjct: 313 FPNSEIFQSEKVPTTAKLIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDYSGI 372

Query: 160 VILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFV 219
            ILI  S+++  +   + +              G     ++    F   E RP R   F+
Sbjct: 373 TILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIKFFI 432

Query: 220 AFGLSAILPILAGTFYYGIEET---FIRIQLKWIILEGFFYIFGAFLYGVRFPEKY 272
                 +L  L  T+   ++        +  K I+    +Y+ G   YG   PE++
Sbjct: 433 LLASMGVLSFLHLTYLTNLQYATWLLTPVTNKSIV----WYLVGVVFYGSFIPERF 484

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/301 (20%), Positives = 118/301 (39%), Gaps = 33/301 (10%)

Query: 36  KVVYKLYRWD--------------EIPEWQKDNEHIISGYVRETNSFKGCLHSLFYV--H 79
           K   + Y WD              E+P   ++N +II GY    +  K  L  + +   H
Sbjct: 279 KKTIQFYNWDNACDLGRQRHLHFYELPFPWRENRYIIHGYRFYDSHVKSVLSVVNWYGWH 338

Query: 80  NESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDY--LMIDLFFFGAFCCLILSSLF 137
           NE+ N++SHL   V+  + + +      ++ +  +  +  L+I +F      CL+ SS++
Sbjct: 339 NETLNIWSHLFGAVYLAYLLFIQLPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVW 398

Query: 138 HCFK-SHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGAC 196
           H    +  L +      +DY GI +LI  S++S  +   ++                  C
Sbjct: 399 HTLNGTCCLPLRCKFACIDYTGITVLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLC 458

Query: 197 -----ATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWII 251
                + ++    F   E RP+R   +V      ++  L  T   GI+ +    +  W  
Sbjct: 459 LGIFGSFMNWSPRFDRPESRPFRIAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVW-N 517

Query: 252 LEGFFYIFGAFLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHS 311
               +Y+ G   YG   PE+        W    ++ + +   A  C    +L+ ++ VH 
Sbjct: 518 RSLIWYLIGVVFYGSFIPER--------WRTDVELDYTIPTDAELCSNLDILTKHKHVHF 569

Query: 312 R 312
           R
Sbjct: 570 R 570

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 101/236 (42%), Gaps = 14/236 (5%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSLFYV---HNESGNVYSHLLPGVFFFFTMVLN 102
           ++P   ++N +II  Y R  +S K  L S+F     HNE+ N+++HL+ G++  +  V +
Sbjct: 220 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYD 278

Query: 103 --KYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFK-SHSLKVATLGNKLDYLGI 159
             +  I +         L++ LF F A  CL  S  +H F  + +LK+ +    +DY GI
Sbjct: 279 FPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYSGI 338

Query: 160 VILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFV 219
            ILI  S+++  +   + +              G     ++    F   E RP R   FV
Sbjct: 339 SILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKFFV 398

Query: 220 AFGLSAILPILAGTFYYGIEET---FIRIQLKWIILEGFFYIFGAFLYGVRFPEKY 272
                 +L  L  TF    +        +  K I+    +Y  G   YG   PE++
Sbjct: 399 LLASMGVLSFLHLTFLTDWKYATWLLAPVTNKSIV----WYCIGVVFYGSFIPERF 450

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/266 (22%), Positives = 119/266 (44%), Gaps = 20/266 (7%)

Query: 17  VEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLF 76
           VE +I   ++  + ++ + K+++    + E+P   ++N +II  Y    ++ K  L ++ 
Sbjct: 196 VEALITAYNHDVAFQEGREKLLH----YYELPFPWRENRYIIHNYRFYDSNVKSLLSAIN 251

Query: 77  YV--HNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVD---YLMIDLFFFGAFCCL 131
           +   HNE+ N++SH L G F+   + + ++  ++   +  +      ++ +F F A  CL
Sbjct: 252 WYGWHNETSNIWSHFL-GFFYVVYLAVYEFPQSVVFQSDRIPSSAKFVVYIFLFAAMKCL 310

Query: 132 ILSSLFHCFKSHS-LKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXX 190
           I S+ +H F   + LK+      +DY GI ILI  S+++  +    D+            
Sbjct: 311 IASAFWHTFNGTAFLKMRRRFACVDYSGISILITASILTAEFVTLNDHRPMMILYMTISL 370

Query: 191 XXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFY----YGIEETFIRIQ 246
             G     ++    F + E RP R   F+      +L  +  ++     Y + +    I 
Sbjct: 371 TLGIIGVFLNCSPQFDTPEARPLRIRFFMLLAAMGVLSFINASYLESWAYAV-DLLSPIT 429

Query: 247 LKWIILEGFFYIFGAFLYGVRFPEKY 272
            K I+    +Y+ G   YG   PE++
Sbjct: 430 NKSIV----WYLVGVVFYGSFIPERF 451

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 100/237 (42%), Gaps = 15/237 (6%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSLFY---VHNESGNVYSHLLPGVFFFFTMVLN 102
           E+P   ++N++II GY R  + F   + S+F    VHNE+ N+++H+L   +  + + ++
Sbjct: 248 ELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVD 306

Query: 103 KYGITIYSTTSIVDYL---MIDLFFFGAFCCLILSSLFHCFK-SHSLKVATLGNKLDYLG 158
                I   T  V      +I +F      C+  S  +H F  + S+++      +DY G
Sbjct: 307 FQKTFIVLDTEHVPATTKYIIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCVDYTG 366

Query: 159 IVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLF 218
           I +LI  S++S  Y   +D P                   ++    F S E RP R   F
Sbjct: 367 ITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSPKFDSPEARPLRIKFF 426

Query: 219 VAFGLSAILPILAGTFYYGIEET---FIRIQLKWIILEGFFYIFGAFLYGVRFPEKY 272
           V       L  +      G+      F  +  K +I    +YI G F YG   PE++
Sbjct: 427 VLLAAVGGLSFVNLVCLEGLSRAIWLFSPVTNKSVI----YYIIGVFFYGSFIPERF 479

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 98/240 (40%), Gaps = 22/240 (9%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSL---FYVHNESGNVYSHLLPGVFFFFTMVLN 102
           ++P   ++N +II GY R  +S   CL S+   +  HNE+ N++SHL   +   +  V  
Sbjct: 118 QLPFPWRENRYIIKGY-RFYDSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFV 176

Query: 103 KYGITIYSTTSIVDYLMIDLFFF--GAFCCLILSSLFHCFK---SHSLKVATLGNKLDYL 157
                +Y +  I     + LF F      C++ S  +H F    S++L+       +DY 
Sbjct: 177 YPNTEVYQSELIPTTAKMLLFVFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCC--VDYT 234

Query: 158 GIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGL 217
           GI ILI  S+++  Y      P             G     ++    F   E RP R   
Sbjct: 235 GITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRIKF 294

Query: 218 FVAFGLSAILPILAGTFYYGIEETFIRIQLKWIIL-----EGFFYIFGAFLYGVRFPEKY 272
           FV       L     +F + I  T +R    W++         +Y+ G F YG   PEKY
Sbjct: 295 FVTLSAMGCL-----SFVHLIFTTSLR-HACWLLAPIISKSTIWYVIGVFFYGSFIPEKY 348

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 114/270 (42%), Gaps = 22/270 (8%)

Query: 14  TTVVEGIINNTDNGD--SIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGC 71
           TT ++  IN+ ++G   S+ + +    Y+L      P   ++N +II GY R  N+    
Sbjct: 192 TTDIKSFINSYNHGKAYSLGETQHLHYYQL------PFPWRENRYIIHGY-RFYNTHSKS 244

Query: 72  LHSLFYV---HNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYL--MIDLFFFG 126
           L S+F     HNE+ N++SHLL  ++  +  + +     ++  + +      ++ +F   
Sbjct: 245 LLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYDFPQSEVWRNSQVPPQARWIVFMFLAA 304

Query: 127 AFCCLILSSLFHCFKSHS-LKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXXXX 185
           A  C++ S  +H F   S LK+ +    +DY GI ILI  S+++  +   +         
Sbjct: 305 ALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMYTY 364

Query: 186 XXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIE---ETF 242
                  G     ++    F   E RP R   F+      +L  L   F   +      F
Sbjct: 365 MSISLALGVFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLHYAATLF 424

Query: 243 IRIQLKWIILEGFFYIFGAFLYGVRFPEKY 272
             +  K ++    +Y+ G   YG   PE++
Sbjct: 425 SPVTYKSVV----WYLVGVVFYGSFIPERF 450

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 100/236 (42%), Gaps = 14/236 (5%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSLFY---VHNESGNVYSHLLPGVFFFFTMVLN 102
           ++P   ++N +II+GY R  +     L S+F     HNE+ N++SHLL  ++F + ++  
Sbjct: 255 QLPFPWRENRYIINGY-RFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFE 313

Query: 103 --KYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFK-SHSLKVATLGNKLDYLGI 159
             K  I            ++ LF      C++ S  +H F  + S+K+      +DY GI
Sbjct: 314 FPKSFIVQSPEVPPSAKYIVYLFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGI 373

Query: 160 VILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFV 219
            ILI  S+++  +   +D+              G     ++    F S E RP R   F+
Sbjct: 374 TILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFI 433

Query: 220 AFGLSAILPILAGTFYYGIEET---FIRIQLKWIILEGFFYIFGAFLYGVRFPEKY 272
                  L      +  G+      +  +  K I+    +Y+ G F YG   PE++
Sbjct: 434 LLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSIV----WYLIGVFFYGSFIPERF 485

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/272 (22%), Positives = 114/272 (41%), Gaps = 22/272 (8%)

Query: 12  STTTVVEGIINNTDNGDS--IEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFK 69
           + TT ++  IN+ ++G +  + + K    Y+L      P   ++N +II GY R  N+  
Sbjct: 189 NPTTDIKSFINSYNHGKAHILGESKHLHYYQL------PFPWRENRYIIHGY-RFYNTHS 241

Query: 70  GCLHSLFYV---HNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYL--MIDLFF 124
             L S+F     HNE+ N++SHLL  ++  +  + +     ++    +      ++ +F 
Sbjct: 242 KSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYDFPQSEVWKNPKVPPQARWIVFMFL 301

Query: 125 FGAFCCLILSSLFHCFKSHS-LKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPXXXX 183
             A  C++ S  +H F   S LK+ +    +DY GI ILI  S+++  +   +       
Sbjct: 302 AAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGITILITASILTTEFVTMYSCYWAMC 361

Query: 184 XXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIE---E 240
                    G     ++    F   E RP R   F+      +L  L   F   +     
Sbjct: 362 TYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFILLATMGVLSFLHLIFLTDLRYAAR 421

Query: 241 TFIRIQLKWIILEGFFYIFGAFLYGVRFPEKY 272
            F  +  K ++    +Y+ G   YG   PE++
Sbjct: 422 LFSPVTYKSVV----WYLVGVAFYGSFIPERF 449

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 99/236 (41%), Gaps = 14/236 (5%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSL---FYVHNESGNVYSHLLPGVFFFFTMVLN 102
           ++P   ++N +II GY R  N+    L S+   +  HNE+ N++SHLL  ++  +  + +
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYD 277

Query: 103 KYGITIYSTTSIVDYL--MIDLFFFGAFCCLILSSLFHCFKSHS-LKVATLGNKLDYLGI 159
                ++   ++      ++ +F   A  C++ S  +H F   S L++ +    +DY GI
Sbjct: 278 FPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGI 337

Query: 160 VILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFV 219
            ILI  S+++  +   +                G     ++    F   E RP R   F+
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 220 AFGLSAILPILAGTFYYGI---EETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKY 272
                 +L  L   F   I      F  +  K ++    +Y+ G   YG   PE++
Sbjct: 398 LLATMGVLSFLHLIFLTDIYYASRLFGPVTYKSVV----WYLVGVVFYGSFIPERF 449

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 100/236 (42%), Gaps = 14/236 (5%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSL---FYVHNESGNVYSHLLPGVFFFFTMVLN 102
           E+P   ++N  II+GY R  NS K  L S+   +  HNE+ N+++HLL G++  + M   
Sbjct: 218 ELPFPWRENRCIINGY-RFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQ 276

Query: 103 KYGITIYSTTSI--VDYLMIDLFFFGAFCCLILSSLFHCFKSHS-LKVATLGNKLDYLGI 159
                ++ +  +     L+  +F   A  CL  S  +H F   S L++      +DY GI
Sbjct: 277 FPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYSGI 336

Query: 160 VILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFV 219
            ILI  S+++  +   +  P             G     ++    F   E RP R   F+
Sbjct: 337 SILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIKFFI 396

Query: 220 AFGLSAILPILAGTFYYGIEET---FIRIQLKWIILEGFFYIFGAFLYGVRFPEKY 272
                 IL  L  TF   +  +      I  K ++    +Y+ G   YG   PE++
Sbjct: 397 LLASMGILSFLHLTFITSLSHSTWLLSPITKKSVV----WYLVGVVFYGSFIPERW 448

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 98/238 (41%), Gaps = 18/238 (7%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLH--SLFYVHNESGNVYSHLLPGVFFFFTMVLNK 103
           ++P   ++N  II GY    + +K  L   + +  HNE+ N+++HL   ++  +  V + 
Sbjct: 136 QLPFPWRENRFIIHGYRFYDSHYKSLLSIVNWYGWHNETANIWTHLGGALYVLWLAVYDF 195

Query: 104 YGITIYSTTSI--VDYLMIDLFFFGAFCCLILSSLFHCFK-SHSLKVATLGNKLDYLGIV 160
              +++ +  +  V   ++ +F   A  C++ S   H F  +  L + +    +DY GI 
Sbjct: 196 PRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFACVDYSGIT 255

Query: 161 ILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVA 220
           +LI  S+++  +   ++ P             G     ++    F   E RP R   F+ 
Sbjct: 256 MLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIMNWSPKFDRPEARPLRIKFFIL 315

Query: 221 F----GLSAILPILAGTFYYG--IEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKY 272
                GLS +   L G + Y   +        L W       Y+ G   YG   PE++
Sbjct: 316 LAAMGGLSFMQLGLLGGWKYASWLMAPVTHKSLVW-------YLLGVAFYGSFVPERF 366

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 96/236 (40%), Gaps = 14/236 (5%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSLFYV--HNESGNVYSHLLPGVFFFFTMVLNK 103
           ++P   ++N +II GY      +K  L  + +   HNE+ N+++HLL  ++  +  V + 
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYDF 278

Query: 104 YGITIYSTTSIVDYLMIDLFFF--GAFCCLILSSLFHCFKSHS-LKVATLGNKLDYLGIV 160
               ++    +       +F F   A  C++ S  +H F   S L + +    +DY GI 
Sbjct: 279 PHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSGIT 338

Query: 161 ILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLFVA 220
           ILI  S+++  +   +                G     ++    F   E RP R   F+ 
Sbjct: 339 ILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIRFFIL 398

Query: 221 FGLSAILPILAGTF----YYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKY 272
                +L  L   F    +Y I   F  +  K ++    +Y+ G   YG   PE++
Sbjct: 399 LATMGVLSFLHLIFLTDLHYAI-WLFSPVTNKSVV----WYLVGVVFYGSFIPERF 449

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 101/239 (42%), Gaps = 20/239 (8%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSLFYV--HNESGNVYSH------LLPGVFFFF 97
           ++P   ++N++II GY    +  K  L  + +   HNE+ N+++H      L+   F+ F
Sbjct: 209 QLPFPYRENKYIIHGYRFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYHF 268

Query: 98  TMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFK-SHSLKVATLGNKLDY 156
                   I +          ++ +F   A  C+  S  +H F  +H L++ +    +DY
Sbjct: 269 PHS----NIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDY 324

Query: 157 LGIVILIVTSMISIMYFGFFDNPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAG 216
            GI ILI  S++++ +   +D               G    +++    F   E RP R  
Sbjct: 325 TGITILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIK 384

Query: 217 LFV---AFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKY 272
            F+     G S+ + ++  T +    +    +  K ++    +Y+ G F YG   PE++
Sbjct: 385 FFILLATVGCSSFIRLVFLTNWRYAADLLTPLTNKSVV----WYLIGVFFYGSFIPERF 439

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 102/235 (43%), Gaps = 11/235 (4%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSLFYV---HNESGNVYSHLLPGVFFFFTMVLN 102
           E+P+  ++N +II G+ R  +S K  L S+  V   HNE+ N++SH+   +   + M+  
Sbjct: 244 ELPQPWRENPYIIYGH-RFYHSHKKSLLSILNVYGWHNETINIWSHIAGAIILLYIMLRG 302

Query: 103 KYGITIYSTTSI--VDYLMIDLFFFGAFCCLILSSLFHCFKSHS-LKVATLGNKLDYLGI 159
                ++++T +  V    I +F      C++ S ++H F     L + +  + +DY GI
Sbjct: 303 FPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSCVDYTGI 362

Query: 160 VILIVTSMISIMYFGFFD-NPXXXXXXXXXXXXXGGACATVSLKDHFRSREWRPYRAGLF 218
            ILI  S+++   F  +   P             G   A  +    F   + R +R   +
Sbjct: 363 TILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVAFY 422

Query: 219 VAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGF-FYIFGAFLYGVRFPEKY 272
           V      ++  +  T +     +  R+ +  +I +   +Y+ G   Y    PE++
Sbjct: 423 VILAGLGLISFVHLTVHSDWSSS--RLMITPLINKSIVWYLIGVVFYATLVPERW 475

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 100/249 (40%), Gaps = 11/249 (4%)

Query: 31  EQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYV---HNESGNVYS 87
           E   R +   L+ W E+P   ++N +II G+ R  +S +  L S+      HNE+ N++S
Sbjct: 95  ESRARGLARHLHYW-ELPYAWRENRYIIYGH-RFYHSHRKSLLSVLNAYGWHNETINIWS 152

Query: 88  HLLPGVFFFFTMVLNKYGITIYSTTSI--VDYLMIDLFFFGAFCCLILSSLFHCFK-SHS 144
           HL+      + +        +Y    +  +    I  F      C+  S  +H F  +  
Sbjct: 153 HLVGAAVLAYLLCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCH 212

Query: 145 LKVATLGNKLDYLGIVILIVTSMISIMYFGFFD-NPXXXXXXXXXXXXXGGACATVSLKD 203
           LK+ +    +DY GI +L+  S+++ +    +  +              G A   ++   
Sbjct: 213 LKLRSRFVCVDYTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVASIGLGTAAGVMNWSP 272

Query: 204 HFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFL 263
           HF   E RP R  ++V  GL+A+  +     +  +      +    +     +Y  G   
Sbjct: 273 HFDRPEARPLRIAVYV--GLAALGLVSFVHVWMQVRWASAHLMAPLVYKSLVWYGIGVVF 330

Query: 264 YGVRFPEKY 272
           Y    PE++
Sbjct: 331 YATLVPERW 339

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 100/242 (41%), Gaps = 21/242 (8%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSLFYV---HNESGNVYSHLLPGVFFFFTMVLN 102
           E+P   ++N  II GY R  NS+   L S+F     HNE+ N+++HL   ++F F +   
Sbjct: 219 ELPFPWRENRFIIHGY-RFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFKG 277

Query: 103 KYGITIYSTTSI--VDYLMIDLFFFGAFCCLILSSLFHCFKS-HSLKVATLGNKLDYLGI 159
               T+Y +  +      M  +F      C + S ++H F     LK  +    +DY GI
Sbjct: 278 FSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCACVDYTGI 337

Query: 160 VILIVTSMISIMYFGFFDNPXXXXXXXX-----XXXXXGGACATVSLKDHFRSREWRPYR 214
            +L+  S+++  +     +                   G     ++    F   E RP R
Sbjct: 338 TVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPLR 397

Query: 215 AG---LFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGF-FYIFGAFLYGVRFPE 270
                L  +FG  + L   +  F   ++ + +   +K + ++   +YI G   YG   PE
Sbjct: 398 IAFYLLLASFGFFSYLH--SRLFNTAVDSSDL---IKPVFMKSLAWYIIGVVFYGTFIPE 452

Query: 271 KY 272
           ++
Sbjct: 453 RW 454

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 96/242 (39%), Gaps = 18/242 (7%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSLFYV--HNESGNVYSHLLPGVFFFFTMVLNK 103
           E+P   ++N  II GY    +  K  L  L +   HNE+ N+++HL   ++  +      
Sbjct: 236 ELPFPWRENRFIIHGYRFYHSHTKSLLSILNWYGWHNETTNIWTHLFGSLYIAYLAFYEF 295

Query: 104 YGITIYSTTSIVDYL--MIDLFFFGAFCCLILSSLFHCFK-SHSLKVATLGNKLDYLGIV 160
              ++Y +  +  +   M+ LF    F CL+ S  +H F  +  L + +    +DY GI 
Sbjct: 296 PQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLRSKFACMDYTGIT 355

Query: 161 ILIVTSMIS---IMYFGFFDNPXXXXXXXXXXXXXGGACAT-----VSLKDHFRSREWRP 212
           +LI  S+++   +  +G  DNP               +        ++    F   E RP
Sbjct: 356 VLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCFGVFMNWSPRFDRPESRP 415

Query: 213 YRAGLFVAFGLSAILPILAGTFYYGIEET--FIRIQLKWIILEGFFYIFGAFLYGVRFPE 270
            R   ++       L  L  T       +   IR  L   +    +Y+ G   YG   PE
Sbjct: 416 LRIAFYLLLAGMGFLAFLHLTLITNFAHSSWLIRPVLDKSVC---WYLIGVIFYGSFIPE 472

Query: 271 KY 272
           ++
Sbjct: 473 RW 474

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 101/242 (41%), Gaps = 21/242 (8%)

Query: 46  EIPEWQKDNEHIISGYVRETNSFKGCLHSLFYV---HNESGNVYSHLLPGVFFFFTMVLN 102
           E+P   ++N  II GY R  NS+K  L S+F     HNE+ N+++HL   ++  + +   
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLLFRG 297

Query: 103 KYGITIYSTTSI--VDYLMIDLFFFGAFCCLILSSLFHCFKS-HSLKVATLGNKLDYLGI 159
                +Y +  +      M  +F      C + S ++H F     L+  +    +DY GI
Sbjct: 298 FSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNGICHLQQRSNCACVDYTGI 357

Query: 160 VILIVTSMISIMYF---GFFDNPXXXXXX--XXXXXXXGGACATVSLKDHFRSREWRPYR 214
            IL+  S+++  +    G  + P               G     ++    F   E RP R
Sbjct: 358 TILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPESRPLR 417

Query: 215 AG---LFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGF-FYIFGAFLYGVRFPE 270
                L  +FG  + L   +  F+  I  + +   +K ++ +   +Y+ G   YG   PE
Sbjct: 418 IAFYLLLASFGFFSYL--HSRIFHTSISSSEL---IKPVLSKSLAWYLIGVVFYGTFIPE 472

Query: 271 KY 272
           ++
Sbjct: 473 RW 474

>KNAG0I00420 Chr9 complement(62534..65791) [3258 bp, 1085 aa] {ON}
           Anc_1.459 YJR035W
          Length = 1085

 Score = 37.4 bits (85), Expect = 0.050,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 47/86 (54%), Gaps = 14/86 (16%)

Query: 9   GNTSTTTVVEGIINNT----DNGDSI-------EQVKRKVVYKLY-RWDEIPEWQKDNEH 56
           GN+S    ++ I+ NT    D+GD I       + +K++ V + Y +W ++PEW+K +  
Sbjct: 235 GNSSAE--LDLILANTGEAKDDGDEIYYQKRLRKWIKKRSVDRKYDKWPDLPEWRKPHPD 292

Query: 57  IISGYVRETNSFKGCLHSLFYVHNES 82
           I +  + +T    G +HSL + + ++
Sbjct: 293 IPTARLNDTFKVPGEIHSLLFNYQKT 318

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 45/86 (52%), Gaps = 10/86 (11%)

Query: 93  VFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGN 152
           +  FFT V   Y +  + +T++ DY+++++F   AF C     +  CF +      T G+
Sbjct: 109 LLVFFTDV---YLVPRHVSTTMTDYVLLNVFLATAFQC-AACHMVQCFTT------TAGS 158

Query: 153 KLDYLGIVILIVTSMISIMYFGFFDN 178
            L  + ++     S ++++Y+ ++DN
Sbjct: 159 VLSTITMLNHWACSAVTLLYYSYYDN 184

>TPHA0M01850 Chr13 (386485..387678) [1194 bp, 397 aa] {ON} Anc_6.342
           YNR032W
          Length = 397

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           VH   GN  S  +   + F+T  LNKYG    S++ +  Y+  DLF +   CC+I   LF
Sbjct: 105 VHLIRGNHESRQITQSYGFYTECLNKYG----SSSKVWQYI-TDLFDYLILCCVIDDRLF 159

Query: 138 HCFKSHSLKVATL 150
                 S  V T+
Sbjct: 160 CVHGGLSPNVQTI 172

>TDEL0A07570 Chr1 (1321568..1322656) [1089 bp, 362 aa] {ON}
           Anc_6.342 YNR032W
          Length = 362

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 5/73 (6%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG       S V + + DLF +   CC+I   LF
Sbjct: 104 IHLLRGNHESRQITQSYGFYTECLNKYG-----DGSKVWHHLTDLFDYLVLCCIIDDELF 158

Query: 138 HCFKSHSLKVATL 150
                 S  V T+
Sbjct: 159 CVHGGLSPNVQTI 171

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1608

 Score = 32.7 bits (73), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 12  STTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIIS 59
           S  + ++ II N +N D+ +  +R V  +L R+D IPE Q+ N  ++S
Sbjct: 398 SELSFIKTIIEN-ENWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVS 444

>NDAI0K02220 Chr11 (503034..504134) [1101 bp, 366 aa] {ON} Anc_6.342
          Length = 366

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG      + + +YL  DLF +   CC+I   +F
Sbjct: 104 IHLLRGNHESRQITQSYGFYTECLNKYG----GNSRVWNYL-TDLFDYLVLCCIIDDEIF 158

>TBLA0I02410 Chr9 (554763..555869) [1107 bp, 368 aa] {ON} Anc_6.342
           YNR032W
          Length = 368

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 5/73 (6%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG      + + +YL  D F +   CC+I   LF
Sbjct: 105 IHLLRGNHESRQITQSYGFYTECLNKYG----GNSKVWNYL-TDFFDYLVLCCIIDDELF 159

Query: 138 HCFKSHSLKVATL 150
                 S  V T+
Sbjct: 160 CVHGGLSPNVQTI 172

>NCAS0A05380 Chr1 (1066582..1067664) [1083 bp, 360 aa] {ON}
           Anc_8.159 YER133W
          Length = 360

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 5/73 (6%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG      + + +YL  DLF +   CC+I   +F
Sbjct: 104 IHLLRGNHESRQITQSYGFYTECLNKYG----GGSKVWNYL-TDLFDYLVLCCIIDDEIF 158

Query: 138 HCFKSHSLKVATL 150
                 S  V T+
Sbjct: 159 CVHGGLSPNVQTI 171

>KAFR0C04600 Chr3 (922688..923824) [1137 bp, 378 aa] {ON} Anc_6.342
           YNR032W
          Length = 378

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 5/73 (6%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG       S V + + D+F     CC+I  S+F
Sbjct: 104 IHLLRGNHESRQITQSYGFYTECLNKYG-----DDSRVWHYLTDVFDHLVLCCIIDDSIF 158

Query: 138 HCFKSHSLKVATL 150
                 S  V T+
Sbjct: 159 CVHGGLSPNVQTI 171

>ZYRO0D08162g Chr4 complement(705432..706523) [1092 bp, 363 aa] {ON}
           highly similar to uniprot|P32838 Saccharomyces
           cerevisiae YNR032W PPG1 Putative serine/threonine
           protein phosphatase required for glycogen accumulation
           interacts with Tap42p which binds to and regulates other
           protein phosphatases
          Length = 363

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 5/73 (6%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG       S V + + D F +   CC+I   +F
Sbjct: 106 IHLLRGNHESRQITQSYGFYTECLNKYG-----ENSKVWHYLTDFFDYLVLCCIIDDEIF 160

Query: 138 HCFKSHSLKVATL 150
                 S  V T+
Sbjct: 161 CVHGGLSPNVQTI 173

>ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} similar
           to uniprot|P21147 Saccharomyces cerevisiae YGL055W OLE1
           Fatty acid desaturase required for monounsaturated fatty
           acid synthesis and for normal distribution of
           mitochondria
          Length = 483

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 33/82 (40%), Gaps = 22/82 (26%)

Query: 221 FGLSAILPILAGT-----FYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKY--- 272
           F LS  +P+  GT     FYY +            I  G+  ++    Y  R+P +    
Sbjct: 102 FSLSGKVPLKLGTAVFAVFYYALGGA--------SITAGYHRLWAHRSYSARWPLRLFFA 153

Query: 273 ------VPGSFDIWGHSHQIFH 288
                 V GS   WGHSH+I H
Sbjct: 154 IFGSASVEGSIKWWGHSHRIHH 175

>KNAG0D00380 Chr4 complement(52001..53170) [1170 bp, 389 aa] {ON}
           Anc_6.342 YNR032W
          Length = 389

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%), Gaps = 5/73 (6%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG       S V   + D+F +   CC+I   +F
Sbjct: 104 IHLLRGNHESRQITQSYGFYTECLNKYG-----PDSRVWQYLTDMFDYLVLCCIIDDEIF 158

Query: 138 HCFKSHSLKVATL 150
                 S  V T+
Sbjct: 159 CVHGGLSPNVQTI 171

>YNR032W Chr14 (686010..687116) [1107 bp, 368 aa] {ON}  PPG1Putative
           serine/threonine protein phosphatase of the type 2A-like
           phosphatase family, required for glycogen accumulation;
           interacts with Tap42p, which binds to and regulates
           other protein phosphatases
          Length = 368

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 5/73 (6%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG      + +  YL  D+F +   CC+I   +F
Sbjct: 104 IHLLRGNHESRQITQSYGFYTECLNKYG----GNSRVWQYL-TDIFDYLVLCCIIDDEIF 158

Query: 138 HCFKSHSLKVATL 150
                 S  V T+
Sbjct: 159 CVHGGLSPNVQTI 171

>Suva_14.386 Chr14 (667275..668381) [1107 bp, 368 aa] {ON} YNR032W
           (REAL)
          Length = 368

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 5/73 (6%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG      + +  YL  D+F +   CC+I   +F
Sbjct: 104 IHLLRGNHESRQITQSYGFYTECLNKYG----GNSRVWQYL-TDIFDYLVLCCIIDDEIF 158

Query: 138 HCFKSHSLKVATL 150
                 S  V T+
Sbjct: 159 CVHGGLSPNVQTI 171

>Skud_14.363 Chr14 (654109..655215) [1107 bp, 368 aa] {ON} YNR032W
           (REAL)
          Length = 368

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 5/73 (6%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG      + +  YL  D+F +   CC+I   +F
Sbjct: 104 IHLLRGNHESRQITQSYGFYTECLNKYG----GNSRVWQYL-TDIFDYLVLCCIIDDEIF 158

Query: 138 HCFKSHSLKVATL 150
                 S  V T+
Sbjct: 159 CVHGGLSPNVQTI 171

>CAGL0M10890g Chr13 (1082128..1083222) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P32838 Saccharomyces cerevisiae
           YNR032w PPG phosphoprotein phosphatase
          Length = 364

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 5/75 (6%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG     +  +  Y+  DLF +   CC+I   +F
Sbjct: 104 IHLLRGNHESRQITQSYGFYTECLNKYG----GSPKVWQYI-TDLFDYLVLCCIIDDEIF 158

Query: 138 HCFKSHSLKVATLGN 152
                 S  V T+  
Sbjct: 159 CVHGGLSPNVQTIDQ 173

>Smik_14.361 Chr14 (643981..645087) [1107 bp, 368 aa] {ON} YNR032W
           (REAL)
          Length = 368

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 5/73 (6%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG      + +  YL  D+F +   CC+I   +F
Sbjct: 104 IHLLRGNHESRQITQSYGFYTECLNKYG----GDSRVWQYL-TDIFDYLVLCCIIDDEIF 158

Query: 138 HCFKSHSLKVATL 150
                 S  V T+
Sbjct: 159 CVHGGLSPNVQTI 171

>TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON} 
          Length = 494

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 14/83 (16%)

Query: 215 AGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKY-- 272
           AG +VAF     +PI   T  + +   F  +     I  G+  ++    Y  R+P +   
Sbjct: 106 AGFYVAF--KQWIPIKRETVLFAL---FYYVYAGITITAGYHRLWAHRAYSARWPLRLFF 160

Query: 273 -------VPGSFDIWGHSHQIFH 288
                  V GS   WGHSH+I H
Sbjct: 161 AFFGSANVEGSIKWWGHSHRIHH 183

>TPHA0D01840 Chr4 complement(383875..385623) [1749 bp, 582 aa] {ON}
           Anc_5.310 YDR294C
          Length = 582

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 21/83 (25%)

Query: 3   KTIQKRGNTSTTTVVEGIINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYV 62
           KT++K   T+T T+ + +I N+D+              L  ++E+P+    N+ +++   
Sbjct: 106 KTVEKEVKTATDTIEKDLIKNSDS--------------LIDFEELPKHGLSNKEVLN--- 148

Query: 63  RETNSFKGCLHSLFYVHNESGNV 85
            E +  + CL    Y H E G V
Sbjct: 149 -ELDKLQNCLP---YSHWEDGRV 167

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
           [1650 nt, 550 aa]
          Length = 549

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 8/89 (8%)

Query: 20  IINNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVH 79
           I+NNT N +S  Q+K+K V KL++  EI  ++K+N++      +  N +   L SL    
Sbjct: 222 ILNNTVNSESFTQLKKK-VEKLHK--EIDSYKKENDNYKIELEKLNNKYYTVLESLLTFK 278

Query: 80  NESGNVYSHLLPGVFFFFTMVLNKYGITI 108
             + N     L G F     +L   GI +
Sbjct: 279 TVNDN-----LIGNFNTLCQILTSQGIDL 302

>SAKL0A01232g Chr1 complement(118646..119767) [1122 bp, 373 aa] {ON}
           highly similar to uniprot|P32838 Saccharomyces
           cerevisiae YNR032W PPG1 Putative serine/threonine
           protein phosphatase required for glycogen accumulation
           interacts with Tap42p which binds to and regulates other
           protein phosphatases
          Length = 373

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 5/60 (8%)

Query: 78  VHNESGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLF 137
           +H   GN  S  +   + F+T  LNKYG      +S V     DLF +   CC+I   +F
Sbjct: 135 IHLIRGNHESRQITQSYGFYTECLNKYG-----GSSKVWQHFTDLFDYLVLCCIIDDEIF 189

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.145    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,805,631
Number of extensions: 1411497
Number of successful extensions: 4774
Number of sequences better than 10.0: 96
Number of HSP's gapped: 4791
Number of HSP's successfully gapped: 97
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 65 (29.6 bits)