Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F003105.700ON1259125957960.0
Skud_9.215.700ON1221100328120.0
KAFR0D022405.700ON118798927840.0
NCAS0G002505.700ON118376027240.0
KLLA0A00638g5.700ON1155100725050.0
KLTH0E01100g5.700ON117774720220.0
KNAG0L021105.700ON120050716170.0
YIL147C (SLN1)5.700ON122047815590.0
Smik_9.225.700ON123047815490.0
Suva_9.415.700ON121947215440.0
ZYRO0G06644g5.700ON116648415290.0
CAGL0H06567g5.700ON116949414780.0
Kwal_55.197075.700ON114347814600.0
TDEL0B022105.700ON109548014540.0
TPHA0D045905.700ON112749614311e-177
Ecym_40205.700ON112550414131e-174
Kpol_2001.745.700ON111347214111e-174
AFR284W5.700ON110349313921e-172
SAKL0E14872g5.700ON114048813941e-172
TBLA0I016805.700ON121448813451e-164
TPHA0E002505.700ON106848712221e-147
Kpol_1043.685.700ON104236711131e-132
TBLA0E021005.700ON114049610071e-116
KNAG0M001804.385ON6151221532e-09
ADL388W4.385ON4821601504e-09
Ecym_74744.385ON4961221487e-09
KAFR0J007005.230ON6201281497e-09
YHR206W (SKN7)4.385ON6221561488e-09
ZYRO0G00484g4.385ON6471251471e-08
KLLA0A10219g4.385ON4751201461e-08
KAFR0B069904.385ON5451221452e-08
Skud_8.2734.385ON6231561434e-08
CAGL0F09097g4.385ON6301191424e-08
TDEL0D003204.385ON5471251415e-08
NCAS0A064504.385ON6091221416e-08
Suva_15.4124.385ON6171561416e-08
SAKL0B12408g4.385ON4651221406e-08
Ecym_50775.230ON7951501409e-08
ZYRO0A11154g5.230ON7761831391e-07
Smik_8.2964.385ON6251201391e-07
NDAI0D034304.385ON5971591381e-07
TBLA0A107004.385ON5871201381e-07
KLTH0D17182g4.385ON4641691372e-07
KNAG0B051405.230ON6481291363e-07
Suva_10.845.230ON6951621354e-07
Kpol_265.24.385ON5491221344e-07
TDEL0E039805.230ON7301921344e-07
TPHA0C001504.385ON5101211335e-07
CAGL0D02882g5.230ON6671641336e-07
YLR006C (SSK1)5.230ON7121491328e-07
Kwal_47.167704.385ON4611221301e-06
Smik_12.685.230ON7121491292e-06
Skud_12.725.230ON7021491282e-06
ADR343C5.230ON7491501282e-06
KLTH0B02684g5.230ON5951441263e-06
TPHA0N008505.230ON6701511239e-06
Kwal_33.152885.230ON5871451239e-06
Kpol_1004.45.230ON7141541212e-05
KLLA0E09505g5.230ON635741212e-05
NCAS0D029005.230ON7621411212e-05
NDAI0I020005.230ON8901461122e-04
TBLA0D031705.230ON7651571060.001
SAKL0G12100g5.230ON738731010.003
Kwal_33.148197.368ON56568860.21
TBLA0E049804.385ON79173753.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F00310
         (1259 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...  2237   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...  1087   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...  1077   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...  1053   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   969   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   783   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   627   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   605   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   601   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   599   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...   593   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   573   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...   566   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   564   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   555   e-177
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   548   e-174
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   548   e-174
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   540   e-172
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...   541   e-172
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   522   e-164
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   475   e-147
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   433   e-132
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   392   e-116
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    64   2e-09
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    62   4e-09
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    62   7e-09
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    62   7e-09
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    62   8e-09
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    61   1e-08
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    61   1e-08
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    60   2e-08
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    60   4e-08
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    59   4e-08
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    59   5e-08
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    59   6e-08
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    59   6e-08
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    59   6e-08
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    59   9e-08
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    58   1e-07
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    58   1e-07
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     58   1e-07
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    58   1e-07
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    57   2e-07
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    57   3e-07
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    57   4e-07
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    56   4e-07
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    56   4e-07
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    56   5e-07
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    56   6e-07
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    55   8e-07
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    55   1e-06
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    54   2e-06
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    54   2e-06
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    54   2e-06
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    53   3e-06
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    52   9e-06
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    52   9e-06
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    51   2e-05
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    51   2e-05
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    51   2e-05
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    48   2e-04
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    45   0.001
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    44   0.003
Kwal_33.14819 s33 complement(828099..829796) [1698 bp, 565 aa] {...    38   0.21 
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    33   3.9  

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1259

 Score = 2237 bits (5796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1110/1259 (88%), Positives = 1110/1259 (88%)

Query: 1    MKIPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAA 60
            MKIPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAA
Sbjct: 1    MKIPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAA 60

Query: 61   QLKSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNL 120
            QLKSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNL
Sbjct: 61   QLKSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNL 120

Query: 121  FSVAKVYDASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNS 180
            FSVAKVYDASF            DQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNS
Sbjct: 121  FSVAKVYDASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNS 180

Query: 181  STYLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYN 240
            STYLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYN
Sbjct: 181  STYLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYN 240

Query: 241  NVSALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIG 300
            NVSALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIG
Sbjct: 241  NVSALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIG 300

Query: 301  YSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIV 360
            YSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIV
Sbjct: 301  YSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIV 360

Query: 361  RLQKATELISEGRGLKSTNPDSRSVSRNNSLKLPSRNTSHYRNRSSASSVQQYTGEKQIY 420
            RLQKATELISEGRGLKSTNPDSRSVSRNNSLKLPSRNTSHYRNRSSASSVQQYTGEKQIY
Sbjct: 361  RLQKATELISEGRGLKSTNPDSRSVSRNNSLKLPSRNTSHYRNRSSASSVQQYTGEKQIY 420

Query: 421  PTHSYQHNTIRNMSPQRLSPSPLGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHGNN 480
            PTHSYQHNTIRNMSPQRLSPSPLGL                              LHGNN
Sbjct: 421  PTHSYQHNTIRNMSPQRLSPSPLGLSINRHNHNNDINNNNNNNNNISPDNNLNLPLHGNN 480

Query: 481  FQSDSVSNLSPRQGTPELRRSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSD 540
            FQSDSVSNLSPRQGTPELRRSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSD
Sbjct: 481  FQSDSVSNLSPRQGTPELRRSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSD 540

Query: 541  ELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELR 600
            ELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELR
Sbjct: 541  ELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELR 600

Query: 601  TPLNGILGMTAISMEETDISKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRD 660
            TPLNGILGMTAISMEETDISKIRSSLKLIFRSG            FSKNVLKRTTLEKRD
Sbjct: 601  TPLNGILGMTAISMEETDISKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRD 660

Query: 661  FCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKF 720
            FCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKF
Sbjct: 661  FCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKF 720

Query: 721  TPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELLGCSNPIEKTXXXXXXXXXXXX 780
            TPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELLGCSNPIEKT            
Sbjct: 721  TPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELLGCSNPIEKTNESIPSPKSENN 780

Query: 781  XXXXXXXXXXXXXXETSFEDEKSADDLDDEKIATKDAENENTDDTENLDEQTDSVCDNIS 840
                          ETSFEDEKSADDLDDEKIATKDAENENTDDTENLDEQTDSVCDNIS
Sbjct: 781  NSSSTTSGKDTTNSETSFEDEKSADDLDDEKIATKDAENENTDDTENLDEQTDSVCDNIS 840

Query: 841  LVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTL 900
            LVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTL
Sbjct: 841  LVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTL 900

Query: 901  QESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQ 960
            QESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQ
Sbjct: 901  QESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQ 960

Query: 961  TREINFDDMEHPFEDEFNPESRKNRKVKFKLXXXXXXXXXXXXTVTFGTVTDLNHVPENE 1020
            TREINFDDMEHPFEDEFNPESRKNRKVKFKL            TVTFGTVTDLNHVPENE
Sbjct: 961  TREINFDDMEHPFEDEFNPESRKNRKVKFKLARSIRSKKSRASTVTFGTVTDLNHVPENE 1020

Query: 1021 EEIKXXXXXXXXXXXXXXXXXXXXXXXXXXTTHHSEDRXXXXXXXXXXXXXXXXXXXXXX 1080
            EEIK                          TTHHSEDR                      
Sbjct: 1021 EEIKNGSQASVGSSGSSSSDGEESNNSNNSTTHHSEDRTNTSENTNNNNIHEKEHKHKHE 1080

Query: 1081 XXXXXXXXXGDYPVSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVN 1140
                     GDYPVSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVN
Sbjct: 1081 HTHNHSHNHGDYPVSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVN 1140

Query: 1141 QEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMI 1200
            QEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMI
Sbjct: 1141 QEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMI 1200

Query: 1201 RKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWKSPTE 1259
            RKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWKSPTE
Sbjct: 1201 RKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWKSPTE 1259

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
           YIL147C (REAL)
          Length = 1221

 Score = 1087 bits (2812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/1003 (60%), Positives = 716/1003 (71%), Gaps = 58/1003 (5%)

Query: 1   MKIPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAA 60
            ++P +    PPFRIGIRAQLTALVSIVA VSL ILA+TTGVYFT+NYKNLRSDRLYIAA
Sbjct: 3   FRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAA 62

Query: 61  QLKSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNL 120
           QLKSSQ+DQTLNYLYYQ YY++SRD LQ +LT+YVAGNKS +NW DS S++QKFLSSSNL
Sbjct: 63  QLKSSQVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNL 122

Query: 121 FSVAKVYDASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNS 180
           F VA+VYD+SF            D IP+ +L  L PLST+IPL SSLETTGILTDP++N+
Sbjct: 123 FYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNN 182

Query: 181 STYLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYN 240
           + YLMSMSLPIFANPS+IL +SRVYGY+T+VMSAEGL++VFNDTTALEKSNVAI+SA YN
Sbjct: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYN 242

Query: 241 NVSALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIG 300
                + Y FVF P G    I    + + N +F+SS  R GKGGSLK T  F +KN+A+G
Sbjct: 243 AQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALG 302

Query: 301 YSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIV 360
           YSPC+F  VNWVAVVSQ ESVFLSP+TKL KIIAGTV+AIGVFV ++T PL HWAVKPIV
Sbjct: 303 YSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIV 362

Query: 361 RLQKATELISEGRGLKSTNPDSRSVSRNNSLK--------LPSR----NTSHYRNRSSAS 408
           RLQKATELI+EGRGL+ + P  R+VSR +S +         PS     NT    + +SA+
Sbjct: 363 RLQKATELITEGRGLRPSTP--RTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSAN 420

Query: 409 SVQQYTGEKQIYPTHSYQHNTIRNMSPQRLSPSPLGLXXXXXXXXXXXXXXXXXXXXXXX 468
                     +  +      +  N+  ++LSPS                           
Sbjct: 421 GHGSSGHGSGVALSTESSMKSAINLGHEKLSPS--------------------------- 453

Query: 469 XXXXXXXLHGNNFQSDSVSNLSPRQGTPELRRSSSVGVFSDHTEFSTKSGHLTTSANLIE 528
                   + N+ +     +L+     P   R++     S  +   T S +LT      E
Sbjct: 454 EEENKIPNNHNDVKISMDGSLNHDLLAPNSLRNNDTDRSSSRSHILTTSANLT------E 507

Query: 529 ARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAK 588
           AR+PDY+RLFSDELSDLT+TFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAE ANEAK
Sbjct: 508 ARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAK 567

Query: 589 TVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSGXXXXXXXXXXXXFSK 648
           TVFIANISHELRTPLNGILGMTAISMEETD++KIR++LKLIFRSG            FSK
Sbjct: 568 TVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGELLLHILTELLTFSK 627

Query: 649 NVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQ 708
           NVL+RT LE+RDFCITDVALQIKSIFGKVAKDQRV+LSI+L PN IRTMVL+GDSNRIIQ
Sbjct: 628 NVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQ 687

Query: 709 IVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELLGCSNPIEKT 768
           IVMNLVSNALKFTPVDG V+V++KL+GEYD+  S K  FKEV+VK+GTE+      I+K 
Sbjct: 688 IVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITDVVESIDKR 747

Query: 769 XXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDEKSADDLDDEKIATKDAENENTDDTENL 828
                                      TS  D  +   + +E      A NEN     N 
Sbjct: 748 DLPTSLGRRKYVNLESTTASI------TSCRDNSA---IQEEITKRNTAANENIYKKAN- 797

Query: 829 DEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIEDPKTWVIQIS 888
           D +  S  D  S+VST+TSSYDDAIFNSQF K+    D DE+ + G  IE+PKTWVI I 
Sbjct: 798 DREKSSNDDVSSIVSTTTSSYDDAIFNSQFNKALD-SDSDESGNVGRPIENPKTWVISIE 856

Query: 889 VEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGV 948
           VEDTGPGI+ +LQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKL+S+VGV
Sbjct: 857 VEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGV 916

Query: 949 GSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKL 991
           GS FTFT+PL QT+EI+F ++E PFEDEFNPES+KNR+VKF +
Sbjct: 917 GSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSV 959

 Score =  263 bits (673), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 141/162 (87%), Gaps = 3/162 (1%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            V++DRPFLQSTGTATSSRNVP +   +KD     +IKILV EDNHVNQEVI+RMLNLEG+
Sbjct: 1057 VNIDRPFLQSTGTATSSRNVPTVQGGDKD---GTSIKILVVEDNHVNQEVIRRMLNLEGI 1113

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
            + I+LACDGQEAFDKVK L+ + ++YN+IFMDVQMPKVDGLLSTKMIR+DL Y  PIVAL
Sbjct: 1114 DNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVAL 1173

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWK 1255
            TAFADDSNIKECLESGMNGFLSKPIKRPKL TI+ E+C  ++
Sbjct: 1174 TAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAYQ 1215

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1187

 Score = 1077 bits (2784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/989 (58%), Positives = 686/989 (69%), Gaps = 63/989 (6%)

Query: 10  KPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQIDQ 69
           KPP+RI IR QL A+VS+VA +SL+ILA+TTGVYFT++YKNLR++RLYIAAQLKSSQIDQ
Sbjct: 24  KPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83

Query: 70  TLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYDA 129
           TL YLYYQ Y++S+RDTLQ +L N+VAGNKS+ NW  + S+L+KFLSSS+ FS  KVYD 
Sbjct: 84  TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143

Query: 130 SFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMSL 189
           +F            +QI   +L KL PLSTNIPLSSSLETTGILTDPVLN ++YLMSMSL
Sbjct: 144 NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203

Query: 190 PIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAYR 249
           P+FANPS+IL+ SRVYGY+T++M+A+GL +VFNDTTA+EKSNVAIVSAVYNN S L AY 
Sbjct: 204 PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYH 263

Query: 250 FVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSFV 309
               P G  + + +  ++L N SFL+ AL++GKGGS+K T F Y+K VA+GYSPC+F   
Sbjct: 264 LALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELA 323

Query: 310 NWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATELI 369
           NWV+VVSQAESVF  PSTKL KIIAG VV I VFV ++T PLA++AVKPIVRL+KATE+I
Sbjct: 324 NWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEII 383

Query: 370 SEGRGLKSTNPDSRSVSRNNSLKLPSRNTSHYRNRSSASSVQQYTGEKQIYPTHSYQHNT 429
           +EGRGL+ T P S SVS         R +S  R +S  +S+           ++S   N+
Sbjct: 384 TEGRGLRPTTPGSGSVS---------RTSSMRREKSPRTSIVSSRKSTATGNSNSLNENS 434

Query: 430 IRNMSPQRLSPSPLGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHGNNFQSDSVSNL 489
                   LS  P+                                L   N    + S L
Sbjct: 435 ------ASLSSHPM-------------------------------VLTSENVLVTNHSGL 457

Query: 490 S--PRQGTPELRRSSSVGVFSDHT-----EFSTKSGHLTTSANLIEARVPDYRRLFSDEL 542
           S  P     EL   +S    +  T       S +S HL T  NL EARVP  R+LF DEL
Sbjct: 458 SRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDEL 517

Query: 543 SDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTP 602
           SDLT+TFNTMTDALD+HY LLEDRVRARTKQLEAAKI+AE ANEAKTVFIANISHELRTP
Sbjct: 518 SDLTETFNTMTDALDEHYTLLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTP 577

Query: 603 LNGILGMTAISMEETDISKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFC 662
           LNGILGMTAISMEE DI+KIRSSLKLIFRSG            FSKNVL+RT LEKR+FC
Sbjct: 578 LNGILGMTAISMEEEDITKIRSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRNFC 637

Query: 663 ITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTP 722
           ITDVALQ+KSIFGKVAKDQ V+LSI L+PN +RTMVLYGDSNRIIQ+VMNLVSNALKFTP
Sbjct: 638 ITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTP 697

Query: 723 VDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELLGCSNPIEKTXXXXXXXXXXXXXX 782
           VDGKV VK+KL+GEYDE  S  + F++VYVK GTE    S P E                
Sbjct: 698 VDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEF--TSIPAELAALSKRESTAGSHFS 755

Query: 783 XXXXXXXXXXXXETSFEDEKSADDLDDEKIATKDAENENTDDTENLDEQTDSVCDNISLV 842
                            D   A+    +  +   +E    + ++      +   DNIS+ 
Sbjct: 756 GSSSHIKEKL-------DGIPANVFASDSDSDDPSEGTTINTSQQRTSSNEDYVDNISIA 808

Query: 843 STSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQE 902
           STSTSSYDDAIFNSQFKK+P LY+D++ N  G  +   KTWV +I V DTGPGID +LQE
Sbjct: 809 STSTSSYDDAIFNSQFKKTPDLYEDEDGN-LGEELSQQKTWVFRIEVIDTGPGIDSSLQE 867

Query: 903 SVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTR 962
           SVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MM+GTM L+S VG GS F FTVPL QTR
Sbjct: 868 SVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTR 927

Query: 963 EINFDDMEHPFEDEFNPESRKNRKVKFKL 991
            I  D+ EHP+EDEFNP+S+ NRKVKF +
Sbjct: 928 VIKLDESEHPYEDEFNPKSKMNRKVKFNV 956

 Score =  247 bits (631), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 114/159 (71%), Positives = 135/159 (84%), Gaps = 6/159 (3%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            ++LDRPFLQSTGTA SS NVP ++   K       + +LVAEDNHVNQEVIKRML+LEGV
Sbjct: 1014 LNLDRPFLQSTGTAISSANVPTVATLGK------TLNVLVAEDNHVNQEVIKRMLSLEGV 1067

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
              IDLACDGQ+AFD VK+L E+ + Y++IFMDVQMPKVDGL +TKMIR DL Y+HPIVAL
Sbjct: 1068 KNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVAL 1127

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCP 1252
            TAFADDSNIKECL++GM+GFLSKPIKRP+L+TI+ EYCP
Sbjct: 1128 TAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEYCP 1166

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score = 1053 bits (2724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/760 (69%), Positives = 608/760 (80%), Gaps = 56/760 (7%)

Query: 7   FVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQ 66
           +VLKPPFR+GIR QLT LVS+VA  SL+ILAITTGVYFT+NYKNLRSDRLYIAAQLKSSQ
Sbjct: 9   YVLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQ 68

Query: 67  IDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKV 126
           IDQ LNYLYYQ Y++SSRDTLQ  LTNYVAGNK+ ENWADS  ++QKFL+S+NLFS A++
Sbjct: 69  IDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQL 128

Query: 127 YDASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMS 186
           YD+SF            D IP+S+L KL PL+TN PLSSSLET GILTDPVLN STY+MS
Sbjct: 129 YDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMS 188

Query: 187 MSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALT 246
           MSLPIFANPS+IL +S+VYGY+T+VMSAEGL+TVFNDTTALE+SNVAIVS VYNN S L 
Sbjct: 189 MSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLN 248

Query: 247 AYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTF 306
           AY FVFAP GAPSY+INST+R+ N SFL++ALREGKGGS+K TKFFY+KN+A+GYSPCTF
Sbjct: 249 AYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTF 308

Query: 307 SFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKAT 366
           SFVNW+A+VSQ ESVFLSPSTKLAKII+GTVVAIGVFVF++TFPLAHWAVKPIVRLQKAT
Sbjct: 309 SFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKAT 368

Query: 367 ELISEGRGLKSTNPDSRSVSRNNSLKLPSRNTSHYRNR---SSASSVQQYTGEKQIYPTH 423
           EL+SEGRGLKST P S++VSR++S+K       HY      S+ASSV  ++G+     T 
Sbjct: 369 ELMSEGRGLKSTTPGSKNVSRSSSIK-------HYVRSNIPSTASSVHNFSGDN--LSTT 419

Query: 424 SYQHNTIRNMSPQRLS----PSPLGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHGN 479
           +  H   R ++P  +     PSP                                    +
Sbjct: 420 TNGHLNQRGLTPTPMPTTDLPSP----------------------------------SDS 445

Query: 480 NFQSDSVSNLSPRQGTPELRRSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFS 539
           NF ++ +SN +  Q      R++S+  F+DHT+ S +S  LTTSANLIEARVPDYRRLFS
Sbjct: 446 NFATEMISNANTSQ------RANSISRFTDHTDLSNRSKKLTTSANLIEARVPDYRRLFS 499

Query: 540 DELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHEL 599
           DELSDLTDTFN MTDALDQHYALLEDRVRARTKQLEAAKIEAE ANEAKT+FIANISHEL
Sbjct: 500 DELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANEAKTIFIANISHEL 559

Query: 600 RTPLNGILGMTAISMEETDISKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKR 659
           RTPLNGILGMTAISMEETDI+KIRSSLKLIFRSG            FSKNVLKRTTLEKR
Sbjct: 560 RTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKR 619

Query: 660 DFCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALK 719
           DFCITDVALQIKSIFGKVAKDQRV+LSI L PN IRTM+L+GDSNRIIQIVMNLVSNALK
Sbjct: 620 DFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRIIQIVMNLVSNALK 679

Query: 720 FTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELL 759
           FTPVDGKVNV++KL+GEYDE LS ++NFK+V VK GTE +
Sbjct: 680 FTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFI 719

 Score =  258 bits (660), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 127/185 (68%), Positives = 151/185 (81%), Gaps = 1/185 (0%)

Query: 840  SLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKT 899
            S+VSTSTSSYDDA+FN+QFKK+P LY+D++ N  G+ + +PKTWVI I V+DTGPGID +
Sbjct: 795  SIVSTSTSSYDDAVFNNQFKKTPELYEDEDGN-LGIELTNPKTWVIAIEVQDTGPGIDPS 853

Query: 900  LQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLK 959
            LQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQLANMM+GTM+LKSEVGVGSTFTFTVPL 
Sbjct: 854  LQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLM 913

Query: 960  QTREINFDDMEHPFEDEFNPESRKNRKVKFKLXXXXXXXXXXXXTVTFGTVTDLNHVPEN 1019
            QTRE+  ++ +HPFEDEFNP SRKNR+VKFKL            T TF T   L++V E 
Sbjct: 914  QTRELELNEDDHPFEDEFNPASRKNRRVKFKLAKSLRSRKSRSSTTTFSTTNSLHNVQEE 973

Query: 1020 EEEIK 1024
            +EE K
Sbjct: 974  KEEDK 978

 Score =  254 bits (649), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 116/162 (71%), Positives = 138/162 (85%), Gaps = 6/162 (3%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            V++DRPFLQSTGTATS+R +  +       D  +  KILVAEDNHVNQEVIKRMLNLEGV
Sbjct: 1016 VNMDRPFLQSTGTATSTRTIQTVP------DAGKKFKILVAEDNHVNQEVIKRMLNLEGV 1069

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
              I+LA DGQ+AF++VK + EQ + +++IFMDVQMPKVDGLLSTKMIR DLHY +PIVAL
Sbjct: 1070 ENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVAL 1129

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWK 1255
            TAFADDSNIKECLE+GMNGFLSKPIKRPK++TI++EYCP W+
Sbjct: 1130 TAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQ 1171

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
           similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1155

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/1007 (52%), Positives = 653/1007 (64%), Gaps = 97/1007 (9%)

Query: 11  PPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQIDQT 70
           PPF +G+R QL  LV  +  +SL I+ +TTGVYFT NYK++R++RL +AAQLKSSQ+DQ 
Sbjct: 20  PPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSSQVDQN 79

Query: 71  LNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYDAS 130
           LNYLYYQ Y++S+RDTLQ AL N+ AGN S +NW  +   L+KFL SS LFS A+VYD S
Sbjct: 80  LNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVYDTS 139

Query: 131 FXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMSLP 190
           F            D IP+++LA+L PLS   PLSSSL TTGI+TDPV N + YL+SMSLP
Sbjct: 140 FNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSMSLP 199

Query: 191 IFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAYRF 250
           +  NPS+IL  + + GY+TV+ SAE L+ V NDT AL+KS+V+I+SAV+++ S+LT Y F
Sbjct: 200 VSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTGYHF 259

Query: 251 VFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSFVN 310
           VF P G  S+    T+ + NG+F++ A   GK GS+  T     +N+A+GYSP TF  VN
Sbjct: 260 VFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFKLVN 319

Query: 311 WVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATELIS 370
           WVAVV+Q E VFLSP+ +L KIIAGTV AI VF+ ++TFP+AHWAV+PIVRLQKATE+I+
Sbjct: 320 WVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEIIT 379

Query: 371 EGRGLK----STNPDSRSVSRNNSLKLPSRNTSHYRNRSSASSVQQY--------TGEKQ 418
            GR LK    + N DS +              +H R RS+++  Q           G   
Sbjct: 380 SGRDLKHYSNTGNSDSNTA------------ITHSRTRSTSNQNQVMKLFNKSVTKGTPS 427

Query: 419 IYPTHSYQHNTIRNMSPQRLSPSPLGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHG 478
            Y  H+Y      N+ P   + SP                                 +  
Sbjct: 428 NYLNHNY------NVFPPSRTDSP--------------------------------SVSA 449

Query: 479 NNFQSDSVSNLSPRQGTPELRRSSSVGVFSDHTEFSTKSGHLTT-----SANLIEARVPD 533
            N Q+       PR G  +L RS++ G     T FS  S   T+     S NL+EA VP 
Sbjct: 450 RNSQT------IPR-GPGDLTRSATTG----STPFSNDSSSYTSERYIKSTNLVEAYVPV 498

Query: 534 YRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIA 593
           YRR F DELS+LTDTFNTMTD LD+HYALLE+RVRARTKQLEAAKI+AE ANEAKTVFIA
Sbjct: 499 YRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANEAKTVFIA 558

Query: 594 NISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKR 653
           NISHELRTPLNGILGMTAI+M ETD+ K+++SLKLIFRSG            FSKNVLKR
Sbjct: 559 NISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTELLTFSKNVLKR 618

Query: 654 TTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNL 713
           T LE+RDF + D+ALQIKSIFGK+AKDQ VKLSI LTPN IRT+VL+GDSNRIIQIVMNL
Sbjct: 619 TKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQIVMNL 678

Query: 714 VSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTEL-------LGCSNPIE 766
           VSNALKFTPVDGKV+V++KL+GEYD   S   +++EV+V  G+E        L  + P+ 
Sbjct: 679 VSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFNLTSTTPMR 738

Query: 767 KTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDEKS--ADDLDDEKIATKDAENENTDD 824
                                           E E S   +D D+  I  +    EN D+
Sbjct: 739 LPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLESKHEENEDE 798

Query: 825 TENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIEDPKTWV 884
            E +            L ++++SSYDDAIF+SQFKK     D D   +    ++ PKTWV
Sbjct: 799 KEKMS----------ILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWV 848

Query: 885 IQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKS 944
           I + VEDTG GID +LQESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MM GTMKL S
Sbjct: 849 ISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDS 908

Query: 945 EVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKL 991
           +VGVGS F FTVPL+QT+EI FD  E  FEDEFN  SRKNRKVKFK+
Sbjct: 909 KVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKI 955

 Score =  218 bits (554), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 129/159 (81%), Gaps = 8/159 (5%)

Query: 1094 VSLDRPFLQSTGTATSSRNVP-VLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEG 1152
            V +DRPFLQSTGTATS+R++  V SE  +        ++LVAEDN+VNQEVIKRML LEG
Sbjct: 995  VRVDRPFLQSTGTATSTRSISSVASEVTRH-------RVLVAEDNNVNQEVIKRMLQLEG 1047

Query: 1153 VNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVA 1212
            +  +D+ACDGQEA++KV+ + +  +SY++IFMDVQMP+VDGLL+TKMIR DL Y  PIVA
Sbjct: 1048 LTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVA 1107

Query: 1213 LTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYC 1251
            LTA+ADDSNIK CLESGM+GFL KPIKRP L+ II +YC
Sbjct: 1108 LTAYADDSNIKVCLESGMDGFLPKPIKRPLLKKIIAQYC 1146

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/747 (56%), Positives = 523/747 (70%), Gaps = 56/747 (7%)

Query: 9   LKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQID 68
           LKPPF I IR QLTALV +VA +SL+ILA+ TGVYFT+++K++R++RLY+A+QLK+SQID
Sbjct: 17  LKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKASQID 76

Query: 69  QTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYD 128
           Q L YLYYQCYY+S+RD LQ ALT Y+AGN + ENWAD+ + L KFL SSNLFS+A+VYD
Sbjct: 77  QNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYD 136

Query: 129 ASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMS 188
           +SF            + +P+S+L +L PLSTN+ L SSLE  G+LTDPVLN + YLMSMS
Sbjct: 137 SSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMS 196

Query: 189 LPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAY 248
           LPIFANPS+IL+ S+VYGY+TVV+SAEGL+TVFNDTTALE S+V +VS VY+N   L  Y
Sbjct: 197 LPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDN-RELAGY 255

Query: 249 RFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSF 308
             VF P G PS II+  Y + N SFL  A ++ KGGS+KST F YSK VAIGYSPC+   
Sbjct: 256 HLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDL 315

Query: 309 VNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATEL 368
           V WVA+++Q ES FL PST+LA+II GT VAI V    +TFPL+HWAV+PIVRLQKATE+
Sbjct: 316 VQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATEI 375

Query: 369 ISEGRGLKSTNPDSRSVSRNNSLKLPSRNTSHYRNRSSASSVQQYTGEKQIYPTHSYQHN 428
           I+ GRGL+S N               S   SH R    +S+ + ++    ++P    +  
Sbjct: 376 ITAGRGLRSDN--------------GSTLYSHKR----SSTAESFSS--ALHPASIRRSG 415

Query: 429 TIRNMSPQRLSPSPLGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHGNNF---QSDS 485
           ++   S  +  P                                   L+ N+F   Q D 
Sbjct: 416 SVARSSKHKYIPE-----------------------------SAKGTLNKNDFEEIQPDG 446

Query: 486 VSNLSPRQGTPELRRSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDL 545
           + N +      ++   +   +FS+    S +S    TS NLIEARVP Y RLFSDELS+L
Sbjct: 447 IEN-NEDAALQKVHSPTPGSLFSEQR--SARSERYITSTNLIEARVPTYNRLFSDELSEL 503

Query: 546 TDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNG 605
           T+TFNTMTD LD+HYALLEDRVRART+QLEAAKIEAE ANEAKTVFIANISHELRTPLNG
Sbjct: 504 TETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNG 563

Query: 606 ILGMTAISMEETDISKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITD 665
           ILGMTAI+M E D+ K++SSLKLIFRSG            FSKNVLKRT LE+RDF + +
Sbjct: 564 ILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHE 623

Query: 666 VALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDG 725
           +ALQ++SIFGK+AKDQ V L+I++ PN +RTMVL+GDSNRI+QIVMNLVSNALKFTPVDG
Sbjct: 624 IALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDG 683

Query: 726 KVNVKVKLIGEYDEALSAKNNFKEVYV 752
           +VNVK  L+GEYDE+ ++   F    V
Sbjct: 684 RVNVKFTLLGEYDESKASNGCFDRAAV 710

 Score =  231 bits (590), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 132/161 (81%), Gaps = 7/161 (4%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            V +DRPFLQSTGTA S+R+V   S +NK        K+LVAEDN+VNQEVIKRMLNLEG+
Sbjct: 1009 VRVDRPFLQSTGTALSTRSVTTTSVANK-------CKVLVAEDNNVNQEVIKRMLNLEGL 1061

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
            + +DLACDGQ+AFDKVK  +E    Y++IFMDVQMP+VDGL +T+MIR +L Y HPIVAL
Sbjct: 1062 DDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVAL 1121

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGW 1254
            TA+ADD NIKEC+++GMNGFL+KPI+RPK++ I+ EYCP +
Sbjct: 1122 TAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTY 1162

 Score =  210 bits (534), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 130/174 (74%), Gaps = 11/174 (6%)

Query: 818 ENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLI 877
           E +  D  EN +E      D  S+ S + SSYDDAIF+S+ +K     +  EN D G  +
Sbjct: 812 ETQREDSNENQNE------DARSIESENASSYDDAIFHSRLRKG----NSGENED-GRPL 860

Query: 878 EDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMH 937
           E P+   I + V+DTGPGI+  LQESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MM+
Sbjct: 861 EHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMN 920

Query: 938 GTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKL 991
           G+M L S+VGVGS FTFTVPL QT+E+ F++ E+PFEDEFNP+S+KNRKVKFK+
Sbjct: 921 GSMSLDSKVGVGSKFTFTVPLTQTKELCFEEDENPFEDEFNPDSKKNRKVKFKV 974

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/507 (64%), Positives = 375/507 (73%), Gaps = 24/507 (4%)

Query: 503  SVGVFSDHTE-FSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYA 561
            S+   SD  E  S  S H TT+ NLI+ARVP YR LF DELSDLT+TFNTMTDALDQHYA
Sbjct: 457  SLSNVSDRLERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYA 516

Query: 562  LLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISK 621
            LLE+RVRARTKQLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAISMEETDI K
Sbjct: 517  LLEERVRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDK 576

Query: 622  IRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQ 681
            IR+SLKLIFRSG            FSKNVLKRT LEKR+FCITDVALQIKSIFGKVAKDQ
Sbjct: 577  IRNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQ 636

Query: 682  RVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEAL 741
             V+LSI L+PN IR+MVLYGDSNRIIQIVMNLVSNALKFTPVDGKV+V++K++G YDEAL
Sbjct: 637  HVRLSIILSPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEAL 696

Query: 742  SAKNNFKEVYVKQGTELLGCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDE 801
            S K N  +VYVK GTE+   +  +                             +T+ ++ 
Sbjct: 697  SEKYNHNKVYVKPGTEITDSTPSLN---------------VKSEGQGKDKFTSDTASKNN 741

Query: 802  KSADDLDDEKIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKS 861
             S+D   D    T     E+  D +N+ E      DN S++S++TSSYDDAIFNSQFKK+
Sbjct: 742  TSSDTAYDATPTTDRVAQES--DEDNMYE------DNESMISSTTSSYDDAIFNSQFKKT 793

Query: 862  PGLYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGG 921
              LYD+D+ ++ GV +E PKTWVI   VED+GPGIDK LQESVF+PFVQGDQTLSRQYGG
Sbjct: 794  TNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGG 853

Query: 922  TGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPES 981
            TGLGLSICRQLA MM G M L+S+VGVGS FTFT+PL QTREINF ++E PFEDEFN +S
Sbjct: 854  TGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKS 913

Query: 982  RKNRKVKFKLXXXXXXXXXXXXTVTFG 1008
            +KNRKVKF++             VT G
Sbjct: 914  KKNRKVKFRMARSLNSRKSRSSIVTAG 940

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/385 (71%), Positives = 320/385 (83%), Gaps = 2/385 (0%)

Query: 7   FVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQ 66
           F  KPP+R+GIRAQLT LVSIVA +SL+ILA+TTGVYFT+NYKNLRSDRLYIAAQLKSSQ
Sbjct: 8   FTPKPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQ 67

Query: 67  IDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKV 126
           IDQ LNYLYYQCY+V+SRDTLQ  L NYVAGNKS+ NW DS S+L+KFL SSNLFSVA+V
Sbjct: 68  IDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARV 127

Query: 127 YDASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMS 186
           YD+SF            D IP+ +L +LLPLSTN+PL SSLET GI+T+PV N S+YLMS
Sbjct: 128 YDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMS 187

Query: 187 MSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALT 246
           MSLPIFANPS+IL +SRVYGY+TVVMSAEGL +VFNDTTALE+S VAIVSAVY N + L 
Sbjct: 188 MSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLD 247

Query: 247 AYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTF 306
           AYRFVF P G+ S I+N T+ L N +FLSSALR+GKGG+LKST+ FY   +A+GYSP T 
Sbjct: 248 AYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTS 307

Query: 307 SFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKAT 366
           +  NWVA+V+QAESVF+SP+TKLAKIIAGTVV IGVF  ++TFPLAHWAVKPIVRLQKAT
Sbjct: 308 NLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKAT 367

Query: 367 ELISEGRGLKSTNPDSRSVSRNNSL 391
           ELI+E RGL+ T P S   SR NS+
Sbjct: 368 ELITESRGLRPTTPTSG--SRANSI 390

 Score =  248 bits (633), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 122/177 (68%), Positives = 138/177 (77%), Gaps = 19/177 (10%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLS--ESNKDEDPAQNI-----------------KILVA 1134
            +SLDRPFLQSTGTATS+R++P LS  +  K  DP  N+                 KILVA
Sbjct: 1011 MSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVA 1070

Query: 1135 EDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGL 1194
            EDNHVNQEVIKRML LEGV  IDLACDGQ+AFDKVK L ++   YN+IFMDVQMPKVDGL
Sbjct: 1071 EDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGL 1130

Query: 1195 LSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYC 1251
             STKMIR DLH D PIVALTAFADDSNIKECL++GM+GFLSKPIKR KL+TI+KE+C
Sbjct: 1131 TSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFC 1187

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
           SLN1Histidine kinase osmosensor that regulates a MAP
           kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1220

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/478 (69%), Positives = 370/478 (77%), Gaps = 11/478 (2%)

Query: 514 STKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQ 573
           S +S  LTTSANL EAR+PDYRRLFSDELSDLT+TFNTMTDALDQHYALLE+RVRARTKQ
Sbjct: 493 SNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQ 552

Query: 574 LEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSG 633
           LEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAISMEETD++KIR+SLKLIFRSG
Sbjct: 553 LEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSG 612

Query: 634 XXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNT 693
                       FSKNVL+RT LEKRDFCITDVALQIKSIFGKVAKDQRV+LSI+L PN 
Sbjct: 613 ELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNL 672

Query: 694 IRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVK 753
           IRTMVL+GDSNRIIQIVMNLVSNALKFTPVDG V+V++KL+GEYD+ LS K  +KEVY+K
Sbjct: 673 IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIK 732

Query: 754 QGTELLGCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDEKSADDLDDEKIA 813
           +GTE+         T                           TS    +    + +E   
Sbjct: 733 KGTEV---------TENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITK 783

Query: 814 TKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDA 873
                NE+     N D +  S  D  S+VST+TSSYD+AIFNSQF K+PG  DD+E  + 
Sbjct: 784 RNTVANESIYKKVN-DREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPG-SDDEEGGNL 841

Query: 874 GVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLA 933
           G  IE+PKTWVI I VEDTGPGID +LQESVF PFVQGDQTLSRQYGGTGLGLSICRQLA
Sbjct: 842 GRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLA 901

Query: 934 NMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKL 991
           NMMHGTMKL+S+VGVGS FTFT+PL QT+EI+F DME PFEDEFNPESRKNR+VKF +
Sbjct: 902 NMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSV 959

 Score =  533 bits (1373), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 266/390 (68%), Positives = 316/390 (81%), Gaps = 2/390 (0%)

Query: 3   IPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQL 62
           +P K  L PPFRIGIR QLTALVSIVA  SL+ILA+TTGVYFT+NYKNLRSDRLYIAAQL
Sbjct: 5   LPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQL 64

Query: 63  KSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFS 122
           KSSQIDQTLNYLYYQ YY++SRD LQ +LT+YVAGNKS +NW DS S++QKFLSSSNLF 
Sbjct: 65  KSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFY 124

Query: 123 VAKVYDASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSST 182
           VAKVYD+SF            D IP+ +L  L PLST+ PL SSLET GILTDPVLNS+ 
Sbjct: 125 VAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTD 184

Query: 183 YLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNV 242
           YLMSMSLPIFANPS+IL +SRVYGY+T++MSAEGL++VFNDTTALE S +AI+SAVYN+ 
Sbjct: 185 YLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQ 244

Query: 243 SALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYS 302
              + Y FVF P G+ S +    + + N +F+SSA R GKGGSLK T    ++N A+GYS
Sbjct: 245 GKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYS 304

Query: 303 PCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRL 362
           PC+F+ VNWVA+VSQ ESVFLSP+TKLAKII GTV+AIGVFV ++T PLAHWAV+PIVRL
Sbjct: 305 PCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRL 364

Query: 363 QKATELISEGRGLKSTNPDSRSVSRNNSLK 392
           QKATELI+EGRGL+ + P  R++SR +S K
Sbjct: 365 QKATELITEGRGLRPSTP--RTISRASSFK 392

 Score =  265 bits (676), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 143/162 (88%), Gaps = 3/162 (1%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            V+LDRPFLQSTGTATSSRN+P + + +K+E    ++KILV EDNHVNQEVIKRMLNLEG+
Sbjct: 1056 VNLDRPFLQSTGTATSSRNIPTVKDDDKNE---TSVKILVVEDNHVNQEVIKRMLNLEGI 1112

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
              I+LACDGQEAFDKVK L+ + ++YN+IFMDVQMPKVDGLLSTKMIR+DL Y  PIVAL
Sbjct: 1113 ENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVAL 1172

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWK 1255
            TAFADDSNIKECLESGMNGFLSKPIKRPKL+TI+ E+C  ++
Sbjct: 1173 TAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQ 1214

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
           YIL147C (REAL)
          Length = 1230

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/478 (69%), Positives = 372/478 (77%), Gaps = 11/478 (2%)

Query: 514 STKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQ 573
           S +S  LTTSANL EAR+PDYRRLFSDELSDLT+TFNTMTDALDQHYALLEDRVRARTKQ
Sbjct: 493 SNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQ 552

Query: 574 LEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSG 633
           LEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAISMEETD++KIR+SLKLIFRSG
Sbjct: 553 LEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSG 612

Query: 634 XXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNT 693
                       FSKNVL+RT LEKRDFCITDVALQIKSIFGKVAKDQRV+LSI+L PN 
Sbjct: 613 ELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNL 672

Query: 694 IRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVK 753
           IRTMVL+GDSNRIIQIVMNLVSNALKFTPVDG V+V++KL+GEYD+ LS K  FKEV+VK
Sbjct: 673 IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKKQFKEVHVK 732

Query: 754 QGTELLGCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDEKSADDLDDEKIA 813
           +GTE+   S    K                            TS    +    + +E   
Sbjct: 733 RGTEITEYSEETNKCDIPISSNHRKHVDLESTT---------TSITSNRDTSIIQEEITK 783

Query: 814 TKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDA 873
              A NEN     N D +  S  D  S+VST+TSSYDDAIFNSQF K+PG  D+DE  + 
Sbjct: 784 RNTAANENIYKRMN-DAEKLSSDDVSSIVSTTTSSYDDAIFNSQFNKAPG-SDEDEGGNL 841

Query: 874 GVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLA 933
           G  IE+PKTWVI I VEDTGPGID +LQESVF PFVQGDQTLSRQYGGTGLGLSICRQLA
Sbjct: 842 GKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLA 901

Query: 934 NMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKL 991
           NMM+GTM+L+S+VGVGS FTFT+PL QT+EI+F +M+ PFEDEFNPESRKNR+VKF +
Sbjct: 902 NMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNV 959

 Score =  545 bits (1404), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 272/392 (69%), Positives = 322/392 (82%), Gaps = 2/392 (0%)

Query: 1   MKIPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAA 60
           +++P K    PPFRIGIRAQLTALVSIVA VSL+ILA+TTGVYFT+NYKNLRSDRLYIAA
Sbjct: 3   LRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAA 62

Query: 61  QLKSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNL 120
           QLKSSQIDQTLNYLYYQ YY++SRD LQ +LT++VAGNKS +NW DS S++QKFLSSSNL
Sbjct: 63  QLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNL 122

Query: 121 FSVAKVYDASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNS 180
           F VAKVYD+SF            D IP+ +L  L PLST+ PL SSLETTGILTDPV+N+
Sbjct: 123 FYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNN 182

Query: 181 STYLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYN 240
           + YLMSMSLPIFANPS+IL +SRVYGY+T++MSAEGL++VFNDTTALEKSNVAI+SA+YN
Sbjct: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYN 242

Query: 241 NVSALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIG 300
           N    + Y F+F P G  S +  S + + N +F+SSA R GKGGSLK T  F  KN+A+G
Sbjct: 243 NQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALG 302

Query: 301 YSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIV 360
           YSPC+F  VNWVAVVSQ ESVFLSP+TKLAKII GTV+AIGVFV ++T PLAHWAV+PIV
Sbjct: 303 YSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362

Query: 361 RLQKATELISEGRGLKSTNPDSRSVSRNNSLK 392
           RLQKATELI+EGRGL+ + P  R+VSR +S K
Sbjct: 363 RLQKATELITEGRGLRPSTP--RTVSRASSFK 392

 Score =  264 bits (675), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 123/162 (75%), Positives = 143/162 (88%), Gaps = 3/162 (1%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            V+LDRPFLQSTGTATSSRNVP + +++K++    +IKILV EDNHVNQEVIKRMLNLEG+
Sbjct: 1057 VNLDRPFLQSTGTATSSRNVPTIQDNDKND---TSIKILVVEDNHVNQEVIKRMLNLEGI 1113

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
              I+LACDGQEAFDKVK L+ +  +YN+IFMDVQMPKVDGLLSTKMIR+DL Y  PIVAL
Sbjct: 1114 ENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVAL 1173

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWK 1255
            TAFADDSNIKECLESGMNGFLSKPIKRPKL+TI+ E+C  ++
Sbjct: 1174 TAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQ 1215

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
           YIL147C (REAL)
          Length = 1219

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/472 (69%), Positives = 367/472 (77%), Gaps = 11/472 (2%)

Query: 520 LTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKI 579
           LTTSANL EAR+PDYRRLFSDELSDLT+TFNTMTDALDQHYALLEDRVRARTKQLEAAKI
Sbjct: 499 LTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKI 558

Query: 580 EAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSGXXXXXX 639
           EAE ANEAKTVFIANISHELRTPLNGILGMTAISMEETD++KIR+SLKLIFRSG      
Sbjct: 559 EAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHI 618

Query: 640 XXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVL 699
                 FSKNVL+RT LEKRDFCITDVALQIKSIFGKVAKDQRV+LSI+L PN IRTMVL
Sbjct: 619 LTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVL 678

Query: 700 YGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELL 759
           +GDSNRIIQIVMNLVSNALKFTPVDG V V++KL+GEYD+ LS K  FKEV+V++GTE++
Sbjct: 679 WGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEII 738

Query: 760 GCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDEKSADDLDDEKIATKDAEN 819
                I K                            ++ ++E +  +          A N
Sbjct: 739 EDIGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQEEITKRNT---------AAN 789

Query: 820 ENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIED 879
           EN    +  D +  S  D  S+VSTSTSSYDDAIFNSQF K+ G  DDDE  D G  IE+
Sbjct: 790 ENIYK-KTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNKALG-SDDDEGGDLGKPIEN 847

Query: 880 PKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGT 939
           PKTW I I VEDTGPGID +LQESVF PFVQGDQTLSRQYGGTGLGLSICRQLANMMHGT
Sbjct: 848 PKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGT 907

Query: 940 MKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKL 991
           MKL+S+VGVGS FTFT+PL QT+EI+F +M  PFEDEFNPESR+NR+VKF +
Sbjct: 908 MKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNV 959

 Score =  545 bits (1404), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 276/392 (70%), Positives = 321/392 (81%), Gaps = 2/392 (0%)

Query: 1   MKIPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAA 60
            ++P + V  PPFRI IRAQLTALVSIVA +SL+ILA+TTGVYFT+NYKNLRSDRLYIAA
Sbjct: 3   FRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAA 62

Query: 61  QLKSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNL 120
           QLKSSQIDQTLNYLYYQ YY++SRD LQ +LT YVAGNKS++NW DS SI+QKFLSSSNL
Sbjct: 63  QLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNL 122

Query: 121 FSVAKVYDASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNS 180
           F VAKVYD+SF            D IP  I  +L PLST++ L SSLETTGILTDP+LNS
Sbjct: 123 FFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNS 182

Query: 181 STYLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYN 240
           + YLMSMSLPIFANPS+IL +SRVYGY+T++MSAEGL++VFNDTTALEKSNVAI+SAVYN
Sbjct: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYN 242

Query: 241 NVSALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIG 300
           N S   AY FVF P G  S I  + + + N +F+SSA + GKGGSLK T  F  KN+A+G
Sbjct: 243 NQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALG 302

Query: 301 YSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIV 360
           YSPC+F  VNWVAVVSQ ESVFLSPSTKLAKII GTV+AIGVFV ++T PLAHWAV+PIV
Sbjct: 303 YSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362

Query: 361 RLQKATELISEGRGLKSTNPDSRSVSRNNSLK 392
           RLQKATELI+EGRGL+ + P  R+VSR +S K
Sbjct: 363 RLQKATELITEGRGLRPSTP--RTVSRTSSFK 392

 Score =  264 bits (674), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 123/162 (75%), Positives = 143/162 (88%), Gaps = 3/162 (1%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            V+LDRPFLQSTGTATS+RN+P +S S+K +    +IKILV EDNHVNQEVIKRMLNLEG+
Sbjct: 1057 VNLDRPFLQSTGTATSNRNIPTVSNSDKSD---SSIKILVVEDNHVNQEVIKRMLNLEGI 1113

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
              I+LACDGQ+AFDKVK L+ + +SYN+IFMDVQMPKVDGLLSTKMIR+DL Y  PIVAL
Sbjct: 1114 ENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVAL 1173

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWK 1255
            TAFADDSNIKECLESGMNGFLSKPIKRPKL+TI+ E+C  ++
Sbjct: 1174 TAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFCAAYQ 1215

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1166

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/484 (66%), Positives = 360/484 (74%), Gaps = 14/484 (2%)

Query: 508 SDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRV 567
           S +   S KS  LTTSANLIEARVP YRR FSDELS+LTDTFNTMTDALDQHYALLEDRV
Sbjct: 448 SGNEALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRV 507

Query: 568 RARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLK 627
           RART+QLEAAKI+AE ANEAKTVFIANISHELRTPLNGILGMTAISMEE DI KI++SLK
Sbjct: 508 RARTRQLEAAKIDAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLK 567

Query: 628 LIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSI 687
           LIFRSG            FSKNVLKRT LEKR+F +TDVALQIKSIFGKVAKDQRV+LSI
Sbjct: 568 LIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSI 627

Query: 688 TLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNF 747
           TL PN IRTMVL+GDSNRIIQIVMNLVSNALKFTPVDGKVNV + L+GEYD   S   N 
Sbjct: 628 TLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENH 687

Query: 748 KEVYVKQGTELLGCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDEKSADDL 807
           K+VYV  GTE  G     EK                            +  E     +D 
Sbjct: 688 KKVYVIPGTEPKGND---EKDKGGIEEKERFSIENTPNDTSSNSSNKHSDTETTPGLNDT 744

Query: 808 DDEKIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDD 867
            DEK A+ D +    +D E+ DE        +S  STSTSSY+D +F+SQFKK+P +  D
Sbjct: 745 -DEKQASDDMDG-GEEDVEDADE--------VSSFSTSTSSYNDTVFHSQFKKTPKVC-D 793

Query: 868 DENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLS 927
           D + + GV ++D K WVI I VEDTGPGID +L ESVF+PFVQGDQ LSRQYGGTGLGLS
Sbjct: 794 DSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLS 853

Query: 928 ICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKV 987
           ICRQLA MM+GTM LKS++GVGS FTFTVPL QTREINFDD+   FEDEFNP+S+KNRKV
Sbjct: 854 ICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKV 913

Query: 988 KFKL 991
           KFK+
Sbjct: 914 KFKI 917

 Score =  545 bits (1404), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 261/399 (65%), Positives = 324/399 (81%), Gaps = 3/399 (0%)

Query: 9   LKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQID 68
            + P R+GIRAQLTALVSIVA VSL+ILA++TGVYFT NYKNLRS+RLY+AAQLKS+QID
Sbjct: 11  FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQID 70

Query: 69  QTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYD 128
           Q LNY+YYQCY++SSRDTLQ AL NYVAGNK+  NW DS +++QKFL+SS LFSVA +YD
Sbjct: 71  QNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYD 130

Query: 129 ASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMS 188
           A+F            + IP+S L +L+PLS N PL SSL++ GILT+PVLN ++YLMSMS
Sbjct: 131 ATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMS 190

Query: 189 LPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAY 248
           LPIFANPS+IL  S VYGY+T+VMSA+ L+ VF+DTTALEKSNVAI+SAVY+    L++Y
Sbjct: 191 LPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSSY 250

Query: 249 RFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSF 308
            FVFAP+G PS I+  T  + NG+FLSSALR+GKGG+L+ TKF Y+K VA+GYSPC+  F
Sbjct: 251 NFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVF 310

Query: 309 VNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATEL 368
           VNW+AVV Q+E+VF+ P+TKL KII+GTVV IGVFV ++TFPLAHWAVKPIVRLQKATEL
Sbjct: 311 VNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATEL 370

Query: 369 ISEGRGLKSTNPDSRS--VSRNNS-LKLPSRNTSHYRNR 404
           I+EGRGL++++P + S  VSR +S    PS   S  R+R
Sbjct: 371 ITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSSIRSR 409

 Score =  239 bits (609), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 135/169 (79%), Gaps = 10/169 (5%)

Query: 1091 DYPVSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNL 1150
            D  V LDRPFLQSTGTA+S+ N+   S  NK         ILVAEDN VNQEVIKRMLNL
Sbjct: 953  DRSVRLDRPFLQSTGTASSNTNLGTTSTINK---------ILVAEDNDVNQEVIKRMLNL 1003

Query: 1151 EGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPI 1210
            EGV+ I+L CDGQEA DKVK L E  + YN+IFMDVQMPK+DGLLSTKMIR+DL+Y HPI
Sbjct: 1004 EGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPI 1063

Query: 1211 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWKSPTE 1259
            VALTAFADDSNI+ECL++GM+GFL+KPIKR +LR II+E+CP  K P E
Sbjct: 1064 VALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPD-KQPQE 1111

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar
           to uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/494 (64%), Positives = 369/494 (74%), Gaps = 23/494 (4%)

Query: 497 ELRRSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDAL 556
           +L+ S +    SD+   S++S  LTTS NL EAR+PDYRRLFSDELSDLT+TFN MTDAL
Sbjct: 439 DLQTSQASNRPSDNDRSSSRSRFLTTSTNLNEARLPDYRRLFSDELSDLTNTFNAMTDAL 498

Query: 557 DQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEE 616
           DQHYALLEDRVRARTKQLEAAKI+AE ANEAKTVFIANISHELRTPLNGILGMTAISMEE
Sbjct: 499 DQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEE 558

Query: 617 TDISKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGK 676
           TDI+KIR+SLKLIFRSG            FSKNVLKRT LEKR+FCITDVALQIKSIFGK
Sbjct: 559 TDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTALEKRNFCITDVALQIKSIFGK 618

Query: 677 VAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGE 736
           VAKDQ V+LSI+LTPN IRTMVL+GDSNRIIQIVMNLVSNALKFTPVDGKVNV++KL+GE
Sbjct: 619 VAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLLGE 678

Query: 737 YDEALSAKNNFKEVYVKQGTELLGCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXET 796
           YDE  +  +NFK+++    ++     +P+  +                          E 
Sbjct: 679 YDEEATKADNFKQIHTIADSD-AHQQHPVSSSPNGVLVKHLSTSSDSNSNLSDSDKYNEK 737

Query: 797 SFEDEKSADDLDDEKIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNS 856
           +++++                     DD  ++   +D   D  SLVS+STSSYD+A+FN+
Sbjct: 738 TYDED---------------------DDEHSITNISDHSDDLSSLVSSSTSSYDNALFNT 776

Query: 857 QFKKSPGLYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLS 916
           QFKK+P LY +D N+  G  + D KTWV  I VEDTGPGID  L ESVF+PFVQGDQTLS
Sbjct: 777 QFKKTPDLY-EDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLS 835

Query: 917 RQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDE 976
           RQYGGTGLGLSICRQLA MMHGTMKL+S+VGVGS FTFTVPLKQTR I FD+ E  FEDE
Sbjct: 836 RQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKFDEEEDLFEDE 895

Query: 977 FNPESRKNRKVKFK 990
           FNPES+KNR+VKFK
Sbjct: 896 FNPESKKNRRVKFK 909

 Score =  558 bits (1439), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 262/368 (71%), Positives = 313/368 (85%)

Query: 9   LKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQID 68
           LKPPFRIGIRAQLTALVSIVAC+SL+ILA+TTGVYFT+NYKNLRSDRLYIAAQLKSSQ+D
Sbjct: 14  LKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQLD 73

Query: 69  QTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYD 128
           Q LNYLYYQCY+++SRDTLQ AL +YVAGNK+ ENW +S +++QKFLSSSNLF +++VYD
Sbjct: 74  QNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSRVYD 133

Query: 129 ASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMS 188
             F            D++P+SI  +L PLST++PL SSL T G+LTDPVLN + YLMSMS
Sbjct: 134 YDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMS 193

Query: 189 LPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAY 248
           LPIFANPS+I ++ +VYGY+TVVMSAEGLR+VFNDTTALEKSNVAIVSA Y+N + + +Y
Sbjct: 194 LPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSY 253

Query: 249 RFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSF 308
           RFVF P G    I+N T+ L + SFL+ A ++ KGGS+K TKFFY+K+VAIGY PC+F+F
Sbjct: 254 RFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNF 313

Query: 309 VNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATEL 368
           VNWVAVVSQAESVFLSPSTKL KII+GTVV I VFV ++TFPLA WAVKPIVRLQKATEL
Sbjct: 314 VNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATEL 373

Query: 369 ISEGRGLK 376
           I+EGRGL+
Sbjct: 374 IAEGRGLR 381

 Score =  270 bits (691), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 125/161 (77%), Positives = 141/161 (87%), Gaps = 6/161 (3%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            V LDRPFLQSTGTATSSRNVP ++      D     KILVAEDNHVNQEVIKRMLNLEG+
Sbjct: 991  VHLDRPFLQSTGTATSSRNVPTMA------DVTMRFKILVAEDNHVNQEVIKRMLNLEGI 1044

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
            N IDLACDGQ+AFDKV++L EQNDSY++IFMD+QMPKVDGLLSTKMIR+DL+Y   IVAL
Sbjct: 1045 NNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVAL 1104

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGW 1254
            TAFADDSNIKEC+E+GMNGFLSKPIKRPKL+ I++EYCP W
Sbjct: 1105 TAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNW 1145

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
           YIL147C (SLN1) - histidine kinase osmosensor that
           regulates an osmosensing MAP kinase cascade and is
           similar to bacterial two-component regulators [contig
           159] FULL
          Length = 1143

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/478 (60%), Positives = 343/478 (71%), Gaps = 18/478 (3%)

Query: 514 STKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQ 573
           + KS    TS NLIEARVP Y+RLFSDELS+LT+TFNTMTD LD+HYALLEDRVRART+Q
Sbjct: 472 AVKSERYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQ 531

Query: 574 LEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSG 633
           LEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAI+M E D +K++SSLKLIFRSG
Sbjct: 532 LEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSG 591

Query: 634 XXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNT 693
                       FSKNVLKRT LE+RDF I D+ALQ++SIFGK+AKDQ V L+I++ PN 
Sbjct: 592 ELLLHIMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNL 651

Query: 694 IRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVK 753
           +R+MVL+GDSNRI+QIVMNLVSNALKFTPVDGKV+VK +L+GEYDE  S  + +KEV+V 
Sbjct: 652 LRSMVLWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVL 711

Query: 754 QGTELLGCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDEKSADDLDDEKIA 813
             TE    S   +                                     ++ +D E I 
Sbjct: 712 PPTESRTSSTEAKDEKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIE 771

Query: 814 TKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDA 873
           + D ++EN D                S+ S +TSSYDDAIF ++ +K       +E N+ 
Sbjct: 772 SSDEDDENEDTK--------------SIGSGNTSSYDDAIFQTRLRKD----SSNEENEE 813

Query: 874 GVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLA 933
           G  +E PK WVI + V DTGPGID  L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA
Sbjct: 814 GRALESPKKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 873

Query: 934 NMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKL 991
            MMHGTMKL S+VGVGS F+FTVPL QT+E+ F+D+E+PFEDEFNP+S+KNRKVKF++
Sbjct: 874 TMMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRM 931

 Score =  483 bits (1242), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 223/371 (60%), Positives = 295/371 (79%), Gaps = 1/371 (0%)

Query: 9   LKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQID 68
           L+ P  + IR QLTALV +VA +SL+ILA+ TGVYFT+++K+LR++RL++AAQLKSSQID
Sbjct: 17  LRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKSSQID 76

Query: 69  QTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYD 128
           Q LNYLYYQCY++S+RD LQ ALT Y+AGN S ENW+D+++ L KFL SSNLFS+A+VYD
Sbjct: 77  QNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVYD 136

Query: 129 ASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMS 188
           +SF            + IP+++L +L PLST++ L SSLE TG+LTDPVLN S YLMSMS
Sbjct: 137 SSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSMS 196

Query: 189 LPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAY 248
           LPIFANPS+IL+ ++VYGY+TVV+SAEGL++V+NDTTAL+ S+V IVS VY++   L  Y
Sbjct: 197 LPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDD-HELAGY 255

Query: 249 RFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSF 308
             VF P      +IN  Y++ NGSFL  A+++GKGGS+KST+FF +K +A+GYSPC  + 
Sbjct: 256 HLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNSTL 315

Query: 309 VNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATEL 368
             WVA+++Q E++FLSPST+LAKII GT +AI V   ++TFPL+HWAV+PIVRLQKATE+
Sbjct: 316 AQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEI 375

Query: 369 ISEGRGLKSTN 379
           I+ GRGL+S N
Sbjct: 376 ITAGRGLRSDN 386

 Score =  229 bits (584), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 108/159 (67%), Positives = 129/159 (81%), Gaps = 7/159 (4%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            V +DRPFLQSTGTA S+  V   S +++        KILVAEDN+VNQEVIKRMLNLEG+
Sbjct: 976  VRVDRPFLQSTGTALSTTLVTTSSLADRR-------KILVAEDNNVNQEVIKRMLNLEGL 1028

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
              ++LACDGQ+AFDKVK        Y++IFMDVQMP+VDGL +T+MIRK+L Y HPIVAL
Sbjct: 1029 EDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVAL 1088

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCP 1252
            TAFADDSNIKECL++GMNGFLSKPIKRPK++ I+KEYCP
Sbjct: 1089 TAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCP 1127

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1095

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/480 (65%), Positives = 355/480 (73%), Gaps = 31/480 (6%)

Query: 514 STKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQ 573
           S ++    TS+NL+EARVP YR  FSDE S+LTDTFNTMT+ALDQHYALLEDRVRARTKQ
Sbjct: 442 SDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQ 501

Query: 574 LEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSG 633
           LEAAK+EAE ANEAKTVFIANISHELRTPLNGILGMTAISMEE DI KI+SSLKLIFRSG
Sbjct: 502 LEAAKVEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSG 561

Query: 634 XXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNT 693
                       FSKNVL+RT LEKRDF ITDVA+QIKSIFGKVAKDQRVK SITL PN 
Sbjct: 562 ELLLHILTELLTFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQ 621

Query: 694 IRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVK 753
           IR MVLYGDSNRIIQIVMNLVSNALKFTPVDGKV+V+++L+GEYD+  S   +FK VYV 
Sbjct: 622 IRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVI 681

Query: 754 QGTELL--GCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDEKSADDLDDEK 811
            GTE    G   P  K                           +   E EK ++  ++E+
Sbjct: 682 DGTEPREDGLIPPPVK-----------------------QFEKQEDLEKEKISEKHNEEE 718

Query: 812 IATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENN 871
            +T D+E  N DD +  D +     D +SL+S STSSYDD IF++QFKK       DEN 
Sbjct: 719 ASTSDSEKTNLDD-KTPDSKRSDADDQVSLISISTSSYDDTIFHTQFKKHTS-SSGDEN- 775

Query: 872 DAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQ 931
             G L+E PK W I + VEDTGPGID +L ESVF+PFVQGDQ LSRQYGGTGLGLSICRQ
Sbjct: 776 --GHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQ 833

Query: 932 LANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKL 991
           LA MM+GTMKL S++GVGS FTFT+PL QTREI F+D E+ FEDEFNP S+KNRKVKFK+
Sbjct: 834 LATMMNGTMKLDSKLGVGSKFTFTLPLTQTREIEFED-ENAFEDEFNPLSKKNRKVKFKV 892

 Score =  505 bits (1300), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 242/370 (65%), Positives = 303/370 (81%)

Query: 11  PPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQIDQT 70
           PPFRI IR QLTALVS+VA VSL+ILA+TTGVYFT+NYK+LRS+RLY+AAQLKSSQIDQ 
Sbjct: 13  PPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLKSSQIDQN 72

Query: 71  LNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYDAS 130
           LNYLYYQCY++SS+ TLQ +L NYV+GNK++ NW DS+S+LQKFLSSS LFSVA+VYDA 
Sbjct: 73  LNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSVARVYDAD 132

Query: 131 FXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMSLP 190
           F            D + D +LAKL+PLS+N+ L +SLE+ G+LTDPVLN ++YLMSMSLP
Sbjct: 133 FQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSMSLP 192

Query: 191 IFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAYRF 250
           I+ANPS+IL ESRVYGY+T++MSA+ L++V++D TALEKS+V IVSA+Y     L +YRF
Sbjct: 193 IYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGLGSYRF 252

Query: 251 VFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSFVN 310
           VFAP G    I++ T+ + N SFLS+ALR+GK GS + T  FY++  A+GYSPC+F FVN
Sbjct: 253 VFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFKFVN 312

Query: 311 WVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATELIS 370
           WVA++SQ+E+VF+ PST+L KII G VV IG FV I TFPLAHWAV+PIVRLQKATE+I+
Sbjct: 313 WVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVRLQKATEIIT 372

Query: 371 EGRGLKSTNP 380
           EGRGL+S  P
Sbjct: 373 EGRGLRSGTP 382

 Score =  252 bits (643), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 137/158 (86%), Gaps = 6/158 (3%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            VSLDRPFLQSTGTA+SS+NV V+S  NK      + +ILVAEDNHVNQEVIKRML LEG+
Sbjct: 934  VSLDRPFLQSTGTASSSKNVTVVSNVNK------SYRILVAEDNHVNQEVIKRMLTLEGI 987

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
            ++IDLA DGQ+AFDKVK L E+ + Y +IFMDVQMPKVDGLL+TKMIRKDL Y +PIVAL
Sbjct: 988  DRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVAL 1047

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYC 1251
            TAFADDSNI+ CLE+GMNGFLSKPIKRPKL+TII +YC
Sbjct: 1048 TAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1127

 Score =  555 bits (1431), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 303/496 (61%), Positives = 353/496 (71%), Gaps = 36/496 (7%)

Query: 502 SSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYA 561
           SS+G+  D  + S+ S    TSANLIEARVP Y RL  DELS+LTDTFNTMTDALDQHY 
Sbjct: 449 SSMGINPDD-DLSSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYC 507

Query: 562 LLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISK 621
           LLE+RVRARTKQLEAAKI+AE ANEAKTVFIANISHELRTPLNGILGMTAISMEE D+ K
Sbjct: 508 LLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDK 567

Query: 622 IRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQ 681
           IR +LKLIFRSG            FSKNVL+RT LEKRDFCIT+VALQIKSIFGK+AKDQ
Sbjct: 568 IRGNLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQ 627

Query: 682 RVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEAL 741
            VKLSI L PN +R+ VL+GDSNRIIQ+VMNLVSNALKFTPVDG V+V++ L+GEYDE  
Sbjct: 628 HVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEER 687

Query: 742 SAKNNFKEVYVKQGTELLGCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDE 801
           S   ++K+VYVKQGTEL     P+                             E +    
Sbjct: 688 SKAEDYKKVYVKQGTEL-----PLN---------------------ISHLKTEENNDISR 721

Query: 802 KSADDLDDEKIATKDAENENTDDTE----NLDEQTDSV--CDNISLVSTSTSSYDDAIFN 855
           KS  +L++++  T     ++T D+     N D +   V      SLV+TS+ SYDD    
Sbjct: 722 KSETELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYDDTALM 781

Query: 856 SQFKKSPGLYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTL 915
            Q  KS  L DDDEN   GV +++ KTWVI + V+DTG GID  LQESVF+PFVQGDQ L
Sbjct: 782 KQLIKSTDL-DDDENK-LGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQAL 839

Query: 916 SRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFED 975
           SRQYGGTGLGLSIC+QL+ MM+GTM+L+SEVGVGS F FT+PLKQTREI+  D E  F D
Sbjct: 840 SRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDEL-FND 898

Query: 976 EFNPESRKNRKVKFKL 991
           EFN  S+KNRKVKFK 
Sbjct: 899 EFNAVSKKNRKVKFKF 914

 Score =  455 bits (1171), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 232/404 (57%), Positives = 304/404 (75%), Gaps = 7/404 (1%)

Query: 3   IPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQL 62
           IP KF  KPP+RI IRAQLTALVS+VA +SL+ILA+T GVYFTANYKNL++ RLYIAAQL
Sbjct: 4   IPKKF-WKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQL 62

Query: 63  KSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFS 122
           K+SQIDQTLNYLYYQCYY+SS +TLQ +L +Y AGN S+ NW +S+ +L+KFL+SS+LFS
Sbjct: 63  KASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFS 122

Query: 123 VAKVYDASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSST 182
           VA++YD +F            + +P+S++ KL  LS NI L SSLET GI TDPVLN S 
Sbjct: 123 VARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSN 182

Query: 183 YLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNV 242
           +LMSMSLPIFANPS+IL++SR+YGYL+V+MSAEGL++VFNDTTALE S V ++SA Y+  
Sbjct: 183 FLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSIT 242

Query: 243 SALTAYRFVFAPM---GAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAI 299
           + L  + F+FA         Y ++  YR+ N +F+ + L  GKGG++K T  F     A+
Sbjct: 243 TNLEYFNFLFASAYDNADKDYDLH--YRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAV 300

Query: 300 GYSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPI 359
           GYS C+FS VNW+A+V+Q E+ F   +TKL +II+G VVA+ VFV ++TFPL+HWAV+P+
Sbjct: 301 GYSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPL 360

Query: 360 VRLQKATELISEGRGLKSTNPD-SRSVSRNNSLKLPSRNTSHYR 402
           +RLQKATE I+EGRGL+   P    SVSRN+S+K  +   +H R
Sbjct: 361 IRLQKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVR 404

 Score =  219 bits (559), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 131/168 (77%), Gaps = 6/168 (3%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDE------DPAQNIKILVAEDNHVNQEVIKRM 1147
            V L+RPFLQSTGTATS++NVP L+    D+      +    I ILVAEDNHVNQEVIKRM
Sbjct: 960  VRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRM 1019

Query: 1148 LNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYD 1207
            L LEG+N IDLA DGQ+AFDK K LSE N +Y+IIFMDVQMP++DGL +TKMIR++L+Y 
Sbjct: 1020 LKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYT 1079

Query: 1208 HPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWK 1255
             PIVAL+AF  + N+KECL+ GMN FLSKPIKRP L+ I+K+Y   ++
Sbjct: 1080 QPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ 1127

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
           similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  548 bits (1413), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 302/504 (59%), Positives = 356/504 (70%), Gaps = 46/504 (9%)

Query: 492 RQGTPELRRSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNT 551
           R+ + ++ R+  + V S H   S +    TTSAN IE RVP YRRLFSDELS+LTDTFN+
Sbjct: 449 REYSVDIARAIGIEVPSSHP--SERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNS 506

Query: 552 MTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTA 611
           MTD LD+HYALLEDRVRARTKQLEAAKI+AE ANEAKT+FIANISHELRTPLNGILGMTA
Sbjct: 507 MTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTA 566

Query: 612 ISMEETDISKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIK 671
           I+M E D+ K+++SLKLIFRSG            FSKN+LKR  LE+R+F + DVALQ+K
Sbjct: 567 IAMAENDMEKVQNSLKLIFRSGELLLHILTELLTFSKNILKRNKLEQRNFSMVDVALQVK 626

Query: 672 SIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKV 731
           SIFGK+AKDQ VK SI L PN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDGKV++++
Sbjct: 627 SIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRI 686

Query: 732 KLIGEYDEALSAKNNFKEVYVKQGTELLGCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXX 791
           KL+GEYDE  S K N  EV++KQGTE+                                 
Sbjct: 687 KLLGEYDEEESEKCNNAEVFIKQGTEI--------------------------------- 713

Query: 792 XXXETSFEDEKSADDLDDEKIATKDAENENTDDTENLDE---QTDSVCDNISLVSTSTSS 848
                S E +   D + +EK  +     E+TDDT    +   Q     DNIS+VS+ TSS
Sbjct: 714 -----SDETKNVFDTITEEKYVS--CSGESTDDTIETGQEGAQKPDKADNISVVSSGTSS 766

Query: 849 YDDAIFNSQFKKSPGLYDDDENNDAGV-LIEDPKTWVIQISVEDTGPGIDKTLQESVFQP 907
           YDDAIF+S+FKK P + D DE + + +   E  K WVI I VEDTGPGID +LQESVF+P
Sbjct: 767 YDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDPSLQESVFKP 826

Query: 908 FVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFD 967
           FVQGDQTLSRQYGGTGLGLSICRQL+ MM GTMKL SEVGVGS F FTVPL+QT  +   
Sbjct: 827 FVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVEDL 886

Query: 968 DMEHPFEDEFNPESRKNRKVKFKL 991
           D E  FEDEFN +S+ NR+VKFKL
Sbjct: 887 DDEDLFEDEFNAQSKINRRVKFKL 910

 Score =  334 bits (857), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 183/372 (49%), Positives = 254/372 (68%), Gaps = 3/372 (0%)

Query: 6   KFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSS 65
           K + +PP++ G+  QLT LV I+A  SL+ILA+TTGVYFT NYK+LR+DRL +AAQL S+
Sbjct: 20  KHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLTSA 79

Query: 66  QIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAK 125
           QI+QTLN +YYQCY++SSRD++Q AL +Y  GN S+ N  ++  +L KFL SSN      
Sbjct: 80  QINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTH 139

Query: 126 VYDASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLM 185
           +YD++F            + I D +L  LLPLS+N PL SS+   G+L++PV N S++ M
Sbjct: 140 LYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSFFM 199

Query: 186 SMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSAL 245
           SMSLP+ A  S++  +S   GY+T+VMSA+ + +V     AL  S V++++ VY+  + L
Sbjct: 200 SMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNIL 259

Query: 246 TAYRFVFAP--MGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSP 303
            +Y+ +F P  +  P  ++   + + N SFL +A      GS+  T  FY  NVA+GY+ 
Sbjct: 260 NSYQVLFPPSIVQVPR-LLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAA 318

Query: 304 CTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQ 363
           C+F  VNWVAVV+Q E+VFLSPSTKL KII GTV+ I  F+ I+TF +A+WAVKPIVRLQ
Sbjct: 319 CSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQ 378

Query: 364 KATELISEGRGL 375
           KATELI+ GRGL
Sbjct: 379 KATELIAAGRGL 390

 Score =  229 bits (583), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 129/157 (82%), Gaps = 6/157 (3%)

Query: 1096 LDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGVNK 1155
            +DRPFLQSTGTATS+R++P +           N K+LVAEDN+VNQEVIKRML LEG+  
Sbjct: 951  VDRPFLQSTGTATSTRSIPTVGSLE------SNFKVLVAEDNNVNQEVIKRMLQLEGIYD 1004

Query: 1156 IDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALTA 1215
            I+LACDG+EA +KV  L+ Q D YNI+FMDVQMPK+DGL++T+ IRK+L+Y +PIVALTA
Sbjct: 1005 IELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTA 1064

Query: 1216 FADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCP 1252
            FADDSNIK CLESGM+GFLSKPIKR KLR I+ EYCP
Sbjct: 1065 FADDSNIKVCLESGMDGFLSKPIKREKLRKILLEYCP 1101

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
           (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  548 bits (1411), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 297/472 (62%), Positives = 342/472 (72%), Gaps = 23/472 (4%)

Query: 522 TSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEA 581
           T++NL++ARVP Y R   DELS+LTDTFN MT+ALDQHY LLEDRVRARTKQLEAAKIEA
Sbjct: 456 TTSNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEA 515

Query: 582 ERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSGXXXXXXXX 641
           E ANEAKTVFIANISHELRTPLNGILGMTAISMEE D  KI+ +LKLIFRSG        
Sbjct: 516 EAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILT 575

Query: 642 XXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYG 701
               FSKNVLKRT LEKRDFCIT++ALQIKSIFGKVA+DQ VKL I L PN IR+MVL+G
Sbjct: 576 ELLTFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWG 635

Query: 702 DSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELLGC 761
           DSNRIIQIVMNLVSNALKFTP+DGKV+V++KL+GEYDE  S  +++KEVY+K GTEL   
Sbjct: 636 DSNRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTEL--- 692

Query: 762 SNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDEKSADDL--DDEKIATKDAEN 819
             PI                              +        D L  D+EK +  D E+
Sbjct: 693 --PIGNGKKTDMVRKKIQELSEKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNED 750

Query: 820 ENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIED 879
            N D             + +S+ ++ST SYDDA    QFKK+P L  DD+    GV + +
Sbjct: 751 TNND------------IEILSMTTSSTRSYDDAALQRQFKKTPDL--DDKEETLGVELSE 796

Query: 880 PKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGT 939
           PKTWVI + VEDTGPGI+  LQE+VF+PFVQGDQ LSRQYGGTGLGLSICRQLA MMHGT
Sbjct: 797 PKTWVISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGT 856

Query: 940 MKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKL 991
           MKL+S VGVGS F FTVPLKQTREI+FDD    FEDEFN ES+KNR++KFK+
Sbjct: 857 MKLESTVGVGSKFIFTVPLKQTREIHFDD--EKFEDEFNAESKKNRRIKFKI 906

 Score =  490 bits (1261), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 242/384 (63%), Positives = 298/384 (77%), Gaps = 5/384 (1%)

Query: 9   LKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQID 68
            KPP+RI IRAQLTALVS+VA +SL+ILA+TTGVYFT NYK LRS RL IAA+LKSSQID
Sbjct: 9   FKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSSQID 68

Query: 69  QTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYD 128
           QTLNYL+YQC Y++SRDTLQ AL NY AGNK+ ENW +S +++QKFLSSS+LF VA++YD
Sbjct: 69  QTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYD 128

Query: 129 ASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMS 188
            +F            D IP+ +L++L PLSTN  L SSL   GILTDPVLN S YLMSMS
Sbjct: 129 LNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMS 188

Query: 189 LPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAY 248
           LPI  NPS+IL+ SRVYGY+T+VMSA+GL+ V+ + TALE SNV ++SA+YN+   +  +
Sbjct: 189 LPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGF 248

Query: 249 RFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSF 308
            FVF  +    +     Y + NG++LSSAL EGK GS+K TK+ +++ +AIGYSPC+FS 
Sbjct: 249 HFVFE-VENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCSFSL 307

Query: 309 VNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATEL 368
            NWVA+V+Q E+VFLSPSTKL KII+GTVVAI VFV ++TFPL+HWAVKPIVRLQKATEL
Sbjct: 308 SNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATEL 367

Query: 369 ISEGRGLKST----NPDSRSVSRN 388
           IS+GRGLK T    N DS S S N
Sbjct: 368 ISQGRGLKPTSNFSNGDSSSTSDN 391

 Score =  244 bits (624), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 114/157 (72%), Positives = 139/157 (88%), Gaps = 1/157 (0%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            V LDRPFLQSTGTATSS+ +P L  + +D +  ++I+ILVAEDNHVNQEVIKRMLNLE +
Sbjct: 950  VRLDRPFLQSTGTATSSQKIPTLI-NKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKI 1008

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
            + IDLACDGQ+AFDKVK+L++  + Y+IIFMDVQMPKVDGL+STKMIRKDL+Y HPIVAL
Sbjct: 1009 DNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVAL 1068

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
            TAFA+D NIKECL++GM+GFL KPIKRPKL+ I++EY
Sbjct: 1069 TAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  540 bits (1392), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 293/493 (59%), Positives = 347/493 (70%), Gaps = 46/493 (9%)

Query: 502 SSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYA 561
           +S  + SDH + ST      ++ N I+ RVP YRRLF+DELS+LTDTFNTMTD LD+ Y 
Sbjct: 458 TSTNILSDHEKGST------SATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYV 511

Query: 562 LLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISK 621
           +LEDRVRARTKQLEAAKI+AE ANEAKTVFIANI HELRTPLNGILGMTAI+M E D  K
Sbjct: 512 VLEDRVRARTKQLEAAKIQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEK 571

Query: 622 IRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQ 681
           I++SLKLIFRSG            FSKNVLKRT LE+R F I D+ALQ+KSIFGK+AKDQ
Sbjct: 572 IQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQ 631

Query: 682 RVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEAL 741
            VKLSI L PN IRTMVL+GDSNRIIQIVMNLVSNALKFTPVDGKV+V++KL+GEYD A 
Sbjct: 632 HVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSAR 691

Query: 742 SAKNNFKEVYVKQGTELLGCS-NPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFED 800
           S   NF EVY+  GTE+   S N I                             E + E+
Sbjct: 692 SEACNFSEVYILPGTEVTNSSVNNIPTV----------------------VEEEEKACEE 729

Query: 801 EKSADDLDDEKIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKK 860
           E +ADD  + K            D+E +D+      D IS+ S+  +SYDDA+ ++Q KK
Sbjct: 730 EPTADDTPERK----------KKDSETVDD-----ADAISISSSVATSYDDAVLHAQLKK 774

Query: 861 SPGLYD--DDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQ 918
            P   D  D +NN     +E P++WVI I V+DTGPGI+ +L ESVF+PFVQGDQTLSRQ
Sbjct: 775 IPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQ 834

Query: 919 YGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFN 978
           YGGTGLGLSICRQLA MM GTMKL+S+VG GS FTFTVPL+QT  + F+D +  FEDEFN
Sbjct: 835 YGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFN 894

Query: 979 PESRKNRKVKFKL 991
             S+KNRKVKF+L
Sbjct: 895 IFSKKNRKVKFQL 907

 Score =  336 bits (862), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 186/402 (46%), Positives = 250/402 (62%), Gaps = 13/402 (3%)

Query: 8   VLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQI 67
           VLKPPF+ G+R QLT LV I+A  SL+ILA TTGVYFT+NY+ LR+DRL++AA+L SSQ+
Sbjct: 12  VLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHVAARLMSSQV 71

Query: 68  DQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVY 127
           DQ+L  LYYQC  +S++DT+Q AL++Y AGN+S ENW ++  IL  FL  S  F +A +Y
Sbjct: 72  DQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLY 131

Query: 128 DASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSM 187
           D  +              + +  L +L PL  +    +      + T P  N +  LMSM
Sbjct: 132 DEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTLNLMSM 190

Query: 188 SLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTA 247
           +LP+ A  S I+    V G+LT+VMSA+ + T  NDT+ L +S V+I++ + N+   L  
Sbjct: 191 TLPVEA--STIIGRGNVVGFLTIVMSADPI-TAVNDTSVLGESMVSILTGIPNDKGNLVK 247

Query: 248 YRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYS--------KNVAI 299
           YRFVF P      +  + Y + N SFL  A        + ST  FY         K VA+
Sbjct: 248 YRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKVAV 307

Query: 300 GYSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPI 359
           GYS C F  ++WVAVVSQ ESVFLSP+ KL KII GTV+ + VF+ I+TF LA WAVKPI
Sbjct: 308 GYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVKPI 367

Query: 360 VRLQKATELISEGRGLKSTNPDSRSVSRNNSL-KLPSRNTSH 400
           VRLQKATE I+ GRGL++ N   RS S+N S+ +  SR + H
Sbjct: 368 VRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDH 409

 Score =  229 bits (583), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 135/163 (82%), Gaps = 6/163 (3%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            V +DRPFLQSTGTATS+R+VP LS +        +++ILVAEDN+VNQEVIKRML+LEG 
Sbjct: 947  VRVDRPFLQSTGTATSTRSVPTLSSAE------SSLRILVAEDNNVNQEVIKRMLHLEGA 1000

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
            + IDLACDG++A+ KV  L EQ + Y++IFMDVQMP++DGLL+TK++R+ LHY++PIVAL
Sbjct: 1001 HNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVAL 1060

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWKS 1256
            TAFADDSNIKECLESGMN FL+KPIKRP L+ I+ E+    K+
Sbjct: 1061 TAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLEHTSQLKT 1103

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON}
           similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1140

 Score =  541 bits (1394), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 299/488 (61%), Positives = 357/488 (73%), Gaps = 22/488 (4%)

Query: 512 EFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRART 571
           + S KS +   S NLI+ARVP Y RLFSDELS+LTDTFNTMTD LD+HYALLEDRVRART
Sbjct: 463 QHSYKSDNFVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRART 522

Query: 572 KQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFR 631
           KQLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAISM E D+ K+++SLKLIFR
Sbjct: 523 KQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFR 582

Query: 632 SGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTP 691
           SG            FSKNVL+RT LE+R+F I DVALQ+KSIFGK+AKDQ V LSI L+P
Sbjct: 583 SGELLLHILTELLTFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSP 642

Query: 692 NTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVY 751
           N IRTM+L+GDSNRIIQIVMNLVSNALKF+PVDGKV V++KL+GEYD   S  +N+ +V+
Sbjct: 643 NVIRTMILWGDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVF 702

Query: 752 VKQGTELLGCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDEKSADDLDDEK 811
           +K GTE+   S                                  S + +K    L +E 
Sbjct: 703 IKPGTEIPDAS----------ASKSSLSTLEYTKVDAIQRRLASKSSDSQK----LKEEP 748

Query: 812 IATKDAENENTDDTENLDEQTDS-------VCDNISLVSTSTSSYDDAIFNSQFKKSPGL 864
           IA+ D  + +  D    D  TD+       + D++SLVS++ SSYDDAI ++Q +K P  
Sbjct: 749 IASSDVSSSDGKDESEADTDTDTDKRSNSEISDSLSLVSSNNSSYDDAILHAQLRKVPSC 808

Query: 865 YDDDENNDA-GVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTG 923
            + +++ D+ G  +E  KTWVI I VEDTGPGI+  L ESVF+PFVQGDQTLSRQYGGTG
Sbjct: 809 GNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTG 868

Query: 924 LGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRK 983
           LGLSICRQLA MM GTMKL+S+VGVGS FTFTVPL QTRE++FDD+E+PFEDEFN  S+K
Sbjct: 869 LGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSKK 928

Query: 984 NRKVKFKL 991
           NRKVKFK+
Sbjct: 929 NRKVKFKM 936

 Score =  493 bits (1268), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 305/392 (77%), Gaps = 2/392 (0%)

Query: 9   LKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQID 68
           LKPPF++GIR QL ALV +VA +SL+ILA+TTGVYFTANYK+LR+DRL++AAQLKSSQID
Sbjct: 11  LKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSSQID 70

Query: 69  QTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYD 128
           Q LNYLYYQCY++S+RDTLQ +L  Y AGN + ENW+++  +L+KFL SS+LFSVA++YD
Sbjct: 71  QNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYD 130

Query: 129 ASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMS 188
           ++F            + +P+ +L  L PLST+ PL+SSL+T+GILTDPVLN + Y+MSMS
Sbjct: 131 STFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMS 190

Query: 189 LPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAY 248
           LPIFA+PS++L  S + GY+TVVMSAE L+ VFNDTTAL+KS+VAI+SA Y+N S   +Y
Sbjct: 191 LPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSY 250

Query: 249 RFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSF 308
            FVF P G  + II+ ++ + NGSF+ SA  + K GS+K T FFY K+VA+GYSPC F  
Sbjct: 251 HFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFKQ 310

Query: 309 VNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATEL 368
           V WVAV+SQ E+VFLSPST+L  II GT + I VF+ ++TFPLAHWAVKPIVRLQKATE+
Sbjct: 311 VQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEI 370

Query: 369 ISEGRGLKSTNPDSRSVSRNNSL-KLPSRNTS 399
           I+  RGL+S N  S   SR NS  K PS ++S
Sbjct: 371 ITARRGLRSYN-QSAPASRTNSFRKRPSTSSS 401

 Score =  248 bits (632), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 117/161 (72%), Positives = 136/161 (84%), Gaps = 6/161 (3%)

Query: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153
            V +DRPFLQSTGTATS+R++  +      E P    KILVAEDN+VNQEV+KRMLNLEG+
Sbjct: 976  VRVDRPFLQSTGTATSTRSITTVKSL---ERP---FKILVAEDNNVNQEVVKRMLNLEGL 1029

Query: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213
            + IDLACDGQEAFDKVK L E ND Y IIFMDVQMP+VDGLLSTKMIR++L Y HPIVAL
Sbjct: 1030 SDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVAL 1089

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGW 1254
            TAFADDSNIK CL+SGMNGFLSKPIKRPKL++++ E+CP +
Sbjct: 1090 TAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDF 1130

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
           YIL147C
          Length = 1214

 Score =  522 bits (1345), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 303/488 (62%), Positives = 354/488 (72%), Gaps = 22/488 (4%)

Query: 507 FSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDR 566
           FS H   +T    ++T   ++E +VP YRRLF DELS+LTDTFNTM+DALDQHYALLE+R
Sbjct: 458 FSSHKSSNTPPPPMST---ILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEER 514

Query: 567 VRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSL 626
           VRARTKQLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAISMEE DI  I+SSL
Sbjct: 515 VRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSL 574

Query: 627 KLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLS 686
           KLIFRSG            FSKNVL+RT LE+RDFCITDVALQIKSIFGKVAKDQ VKLS
Sbjct: 575 KLIFRSGELLLHILTELLTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLS 634

Query: 687 ITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNN 746
           I L PN IRT+VL+GDSNRIIQIVMNLVSNALKFTP+DGKV+V++ L+GEYD+  S   +
Sbjct: 635 IYLIPNEIRTLVLWGDSNRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAAD 694

Query: 747 FKEVYVKQGTELLGCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDEKSADD 806
           +KEV+VK GTE      P E                              S ++E+  ++
Sbjct: 695 YKEVFVKTGTE------PEENYSKILQKLNTEKLIATRSAR---------SCDNEERHNE 739

Query: 807 LDDEKIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYD 866
           L  EK       +++++ T ++     +  D +SL+STSTSSYD+ +FN QFKK  GL D
Sbjct: 740 LIGEKNDIISNNHQSSNTTFDISIHNRTRDDTLSLLSTSTSSYDETVFNDQFKKITGLQD 799

Query: 867 DDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGL 926
            DE    GV I++PKTWVI I VEDTGPGI   LQESVF+PFVQGDQ LSRQYGGTGLGL
Sbjct: 800 HDEER-LGVEIKEPKTWVICIEVEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGL 858

Query: 927 SICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINF---DDMEHPFEDEFNPESRK 983
           SICRQLA MM+GTM L+S+VG GS FTFTVPL QTREI     +D+   F+DEFN  S+K
Sbjct: 859 SICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQTREIVIGEDEDINEFFDDEFNIYSKK 918

Query: 984 NRKVKFKL 991
           NRKVKF +
Sbjct: 919 NRKVKFAI 926

 Score =  518 bits (1334), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 250/387 (64%), Positives = 313/387 (80%), Gaps = 3/387 (0%)

Query: 8   VLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQI 67
           +L+PP  IGIR QLTALV  VACVSL+ILA+ TG+YFT NYK++R DRL IAA+LKSSQ+
Sbjct: 10  ILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQV 69

Query: 68  DQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVY 127
           DQTLN+LYYQCY++S RDTLQ A+ NY AGNKS+  W DS  +++KFLSSS++FS++++Y
Sbjct: 70  DQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLY 129

Query: 128 DASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSM 187
           DA+F            + +P+ +LAKLLPLS++ PL +SL ++G+LTDPVLNS+TYLMSM
Sbjct: 130 DANFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTTYLMSM 189

Query: 188 SLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSA-LT 246
           SLPI ANPS+IL +S+VYGY+T++MSAE L +V+NDTTALEKSNVAIVS  Y++ SA LT
Sbjct: 190 SLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLT 249

Query: 247 AYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTF 306
            Y FVF P GA   II+  Y L NGSFL  A+   K GS+  TKFFY+ +VAIGYSPC+F
Sbjct: 250 EYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSF 309

Query: 307 SFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKAT 366
             V+WVA+VSQ ESVFLSPSTKL +IIAGTVVAI VFV  +TFPL+HWAVKPIVRLQKAT
Sbjct: 310 DLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKAT 369

Query: 367 ELISEGRGLKSTNPDSRSVSRNNSLKL 393
           ELI+EGRGL+S++  +R++SRN SLK 
Sbjct: 370 ELIAEGRGLRSSS--NRTLSRNGSLKF 394

 Score =  203 bits (517), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 137/206 (66%), Gaps = 46/206 (22%)

Query: 1095 SLDRPFLQSTGTATSSRNVPVLSE----SNKD-----------------------EDPAQ 1127
            SLDRPFLQSTGTATS+  +PVL +    + KD                       E   Q
Sbjct: 995  SLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQ 1054

Query: 1128 N--------------IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLS 1173
            N              I+ILV EDNHVNQEVIKRML LE ++ IDLACDG+EA+ KVK ++
Sbjct: 1055 NNSSIIIDEEEEDEGIRILVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEIT 1114

Query: 1174 -----EQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLES 1228
                 ++ + Y++IFMDVQMP++DGL STK+IR +L Y  PIVALTAFAD+SNIKECL+ 
Sbjct: 1115 SISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDV 1174

Query: 1229 GMNGFLSKPIKRPKLRTIIKEYCPGW 1254
            GM+GFLSKPIKRPKL+ I+ E+CPG+
Sbjct: 1175 GMDGFLSKPIKRPKLKDILNEFCPGY 1200

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  475 bits (1222), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 261/487 (53%), Positives = 322/487 (66%), Gaps = 54/487 (11%)

Query: 513 FSTKSGHLT-TSANLI------EARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLED 565
           FS++SG L+ TS N I        RVP +    +DEL++L +TFN M D+LD+H  LLE+
Sbjct: 445 FSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEE 504

Query: 566 RVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSS 625
           RV+ARTK+LEAAKI AE  NEAKTVFIANISHELRTPLNGILGMTAI++EE D  K++ S
Sbjct: 505 RVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGS 564

Query: 626 LKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKL 685
           LKLI+RSG            FSKNVL++T LEK  FCI D+ALQIKSIFGK+AKDQ V  
Sbjct: 565 LKLIYRSGELLLHILTELLTFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNF 624

Query: 686 SITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKN 745
           SI ++PN IRTMV +GDSNRIIQ++MNLVSNALKFTP+DG V+V++KL+GEYDE  S+ N
Sbjct: 625 SILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLN 684

Query: 746 NFKEVYVKQGTELLGCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXETSFEDEKSAD 805
           N+ +VY+K+GT   G ++ I                                   E  +D
Sbjct: 685 NYDKVYIKEGTSFTGDNDAIPT---------------------------------EPISD 711

Query: 806 DLDDEKIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSY-DDAIFNSQFK-KSPG 863
                KI+     +   D     DE  D++   I    ++ S Y ++ I  S ++ K+PG
Sbjct: 712 -----KISFAGGSSSIHDYCSKTDEN-DNIKTEIKSDDSTISDYSEENIMGSYYENKNPG 765

Query: 864 LYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTG 923
                     GV I  PK WVI + VEDTGPGI  TLQ+SVF+PFVQGDQTLSRQYGGTG
Sbjct: 766 ------QELLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTG 819

Query: 924 LGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRK 983
           LGLSICRQLA++MHGTM+L S  G+GS FTFTVPL Q R+I F + E  FEDEFN  S+K
Sbjct: 820 LGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKK 879

Query: 984 NRKVKFK 990
           NRKV FK
Sbjct: 880 NRKVNFK 886

 Score =  392 bits (1006), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 212/414 (51%), Positives = 276/414 (66%), Gaps = 9/414 (2%)

Query: 6   KFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSS 65
           +    PP+ + +RAQL  L  IV+ +SL+IL+I+TGVYFT NYK+LR+++L+IAAQLKSS
Sbjct: 7   RLATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKSS 66

Query: 66  QIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAK 125
           Q+DQ+LNYLYYQ  +    D L  AL  Y +GNK+ ENW +S S +  FL+SS++FS A 
Sbjct: 67  QLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRAT 126

Query: 126 VYDASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLM 185
           +YD +F              IPD I+ +L PLS++  L +S+ T G LTDPVLN+S YLM
Sbjct: 127 IYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLM 186

Query: 186 SMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSAL 245
           S+SLPIF NPS+IL++SRVYGY+T++  A  +  VFNDTTALE SNVAI+SA Y N +  
Sbjct: 187 SLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTY 246

Query: 246 T-AYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPC 304
              Y FVF P G+ + +I+  Y L+N SFL  A  E   GS+ ST FFYS  VA+GYS C
Sbjct: 247 ADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTC 306

Query: 305 TFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQK 364
           TFS  NWVAVVSQ ESVF S + KL KII+GTVV I   V  +TF ++++ VKPI++L++
Sbjct: 307 TFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQ 366

Query: 365 ATELISEGRGLKSTNPDSRSVSRNNSLKLPSRNTSHYRNRSSASSVQQYTGEKQ 418
           ATELIS GRGL       R    N S +    NTS  R     S +  YT EK+
Sbjct: 367 ATELISRGRGL-------RPYYENLSDRTSQDNTST-RTTIDLSDLDGYTNEKE 412

 Score =  164 bits (414), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 79/135 (58%), Positives = 101/135 (74%), Gaps = 3/135 (2%)

Query: 1116 LSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQ 1175
            +SE N D+    + K+L+ EDN VNQEVIKR+L LE +  I+ A DGQEA D VK    +
Sbjct: 930  ISEDNIDQ---HDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISE 986

Query: 1176 NDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLS 1235
             D ++IIFMD+QMP VDG  +T++IR +L+Y +PIVALTAFADDSN KEC  SGMN FL+
Sbjct: 987  KDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLA 1046

Query: 1236 KPIKRPKLRTIIKEY 1250
            KPIKR +L+ IIKE+
Sbjct: 1047 KPIKRFELKEIIKEF 1061

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  433 bits (1113), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 211/367 (57%), Positives = 266/367 (72%)

Query: 8   VLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQI 67
           + K P+++ +R QLT LV  VA +SL+ILAI+TGVYFT NY++LR  +LYIAA+LKSSQI
Sbjct: 9   IWKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQI 68

Query: 68  DQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVY 127
           DQT+N LYYQC +++ RD ++ ALT+Y AGN+S ENWA ++ +L  FL SS +F    +Y
Sbjct: 69  DQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLY 128

Query: 128 DASFXXXXXXXXXXXXDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSM 187
           D+ F            D IPD +L+ LLPLS    L S L TTG+LTDPVLN STYLMSM
Sbjct: 129 DSQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSM 188

Query: 188 SLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTA 247
           SLPI ANPSV L++SRV+GYLTVVMSAE +R V NDTTALEKS VA++S+   N ++   
Sbjct: 189 SLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQE 248

Query: 248 YRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFS 307
           Y FVF P GA   I+N+ Y + N +FLS A    +GGS+  +K  YSK VAIGY PC+F 
Sbjct: 249 YHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFG 308

Query: 308 FVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATE 367
             NWV  VSQ E VF+S S KL KIIAGTV+AI VFV ++TFPL+ W+V+PIVRLQKATE
Sbjct: 309 LANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATE 368

Query: 368 LISEGRG 374
           +IS+  G
Sbjct: 369 VISKRDG 375

 Score =  322 bits (826), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 155/241 (64%), Positives = 192/241 (79%)

Query: 514 STKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQ 573
           S+ S  +    NL + +VP  RR   DELS+LT+T+  MTDALD+H  LLE RV+ RTKQ
Sbjct: 439 SSNSSAIVMRKNLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQ 498

Query: 574 LEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSG 633
           LEAAKIEAE ANEAKTVFIAN++HELRTPLNGILGMTAI+MEETD+ +I+SSLKLI+RSG
Sbjct: 499 LEAAKIEAESANEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSG 558

Query: 634 XXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNT 693
                       FSKNVLK+T LEK  FC+ D+ALQI+SIFGK++KDQ VKLSI + PN 
Sbjct: 559 ELLLHILTELLTFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNK 618

Query: 694 IRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVK 753
           +R+MVL+GD NRI+Q++MNLVSNALKFTPVDGK+ V +KL+GEYD+  SA  N+K+VY+K
Sbjct: 619 LRSMVLWGDQNRILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK 678

Query: 754 Q 754
           +
Sbjct: 679 E 679

 Score =  206 bits (523), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 139/200 (69%), Gaps = 12/200 (6%)

Query: 799 EDEKSADDLDDEKIATKDAENENTDDTENL-----DEQTDSVCDNIS---LVSTSTSSYD 850
           +D  +A++  D  +  K+  N N D  + L      + T SV DNIS   + S +  S +
Sbjct: 664 KDRSAAENYKD--VYMKEIRNSNGDKIKPLMTLISSKDTMSVADNISNKSVASDTERSTN 721

Query: 851 DAIFNSQFKKSPGLYDDDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQ 910
           + I++++FK      D D+    GV ++  + WVI + VEDTGPGI+ +LQ+SVF+PFVQ
Sbjct: 722 NTIYSNKFKNGSNFQDTDDA--IGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQ 779

Query: 911 GDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDME 970
           GDQTLSRQYGGTGLGLSICRQLAN+MHGTMKL+SEVGVGS F FTVPL QTREI F+  E
Sbjct: 780 GDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNE 839

Query: 971 HPFEDEFNPESRKNRKVKFK 990
             FEDEFN  S+KNR+VKF+
Sbjct: 840 LVFEDEFNINSKKNREVKFQ 859

 Score =  174 bits (442), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 100/127 (78%)

Query: 1126 AQNIKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMD 1185
             +N K+L+ EDN VNQ V+ RML LEG+    +ACDGQEA +K+K +  + + Y ++ MD
Sbjct: 914  VKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMD 973

Query: 1186 VQMPKVDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRT 1245
            +QMPKVDG+ +TK+IR++L YD PIVALTAFADDSNI+ C +SGM+GFL+KPIKR +L+ 
Sbjct: 974  IQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKG 1033

Query: 1246 IIKEYCP 1252
            I+ E+CP
Sbjct: 1034 ILTEFCP 1040

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  392 bits (1007), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 232/496 (46%), Positives = 300/496 (60%), Gaps = 48/496 (9%)

Query: 498 LRRSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALD 557
           LRR+ SV      +EF              E +VP YR+LF DEL++LTDTFN M++ALD
Sbjct: 465 LRRNVSVSTHVSLSEFD-------------EIQVPVYRKLFDDELTELTDTFNVMSNALD 511

Query: 558 QHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEET 617
           +HYALLE RV  RTKQLEAAK++AE ANEAKTVFIANISHELRTPLNGILGMT+ S+EE 
Sbjct: 512 EHYALLEKRVHQRTKQLEAAKVQAEAANEAKTVFIANISHELRTPLNGILGMTSTSLEEN 571

Query: 618 DISKIRSSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTTLEKRDFCITDVALQIKSIFGKV 677
           DI KI+  LKLIFRSG            FSKNVL +T LE R+F I ++  QIK+IF K+
Sbjct: 572 DIKKIKDGLKLIFRSGELLLNILTELLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKL 631

Query: 678 AKDQRVKLSITLTPNT-IRTMVLYGDSNRIIQIVMNLVSNALKFTP-VDGKVNVKVKLIG 735
            + Q VKL I L P   +++++ YGDSNRI+Q++MNL+SNA+KFTP V+GKV V + L+G
Sbjct: 632 IQLQEVKLFIRLLPKKFLKSLLFYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLG 691

Query: 736 EYDEALSAKNNFKEVYVKQGTELLGCSNPIEKTXXXXXXXXXXXXXXXXXXXXXXXXXXE 795
           EYDE  S   N+ +V +K  T+++  S  + K+                           
Sbjct: 692 EYDEEESKTENYSKVCIKPSTQIVTESGELIKSKIRCKITKSTTNMNTATTNNSARIESN 751

Query: 796 TSFEDEKSADDLDDEKIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSS------- 848
           T            ++ ++     N  T      D + +S   N+S V+ S+ S       
Sbjct: 752 T------------NQYLSPYSHTNTRTHTHPGADSRRNS---NVSTVNNSSISLDSESSK 796

Query: 849 -YDDAIFNSQFKKSPGLYDDDENNDAGVL--IEDPKTWVIQISVEDTGPGIDKTLQESVF 905
            YD+ +FN   K+      D + ND   L  IE  K WVI+  V D GPGID+ L +SVF
Sbjct: 797 MYDNLMFNRLIKRE----GDGDINDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVF 852

Query: 906 QPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQ---TR 962
           +PFVQGDQTLSRQYGGTGLGLSIC+QL  MM GT++L+SE+G GS F +T+PL Q   T+
Sbjct: 853 KPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIYTIPLLQVGGTK 912

Query: 963 EINFDDMEHPFEDEFN 978
           + N DD E    D  N
Sbjct: 913 KDN-DDNEEDHNDNTN 927

 Score =  355 bits (910), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/377 (49%), Positives = 248/377 (65%), Gaps = 4/377 (1%)

Query: 5   DKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKS 64
           +K  +KPP+R  +RAQLT LV IVA +SL  LAI TGVYFT +YK+L  +RLYIA+QLKS
Sbjct: 13  NKQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQLKS 72

Query: 65  SQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVA 124
           SQIDQTLNYLYYQCY+V+SR+T+Q  + +   G  +     +S S+L KF+ +S+LF   
Sbjct: 73  SQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYT 132

Query: 125 KVYDASFXXXXXXXXXXXXDQIPDSILAKLLPLS-TNIPLSSSLETTGILTDPVLNSSTY 183
            +YD +               +  SIL++LLPLS TN  +   +  TGILTDP+LNS+ Y
Sbjct: 133 MIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNSTKY 192

Query: 184 LMSMSLPI---FANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYN 240
           LMSMSLPI   ++  + I  +S +YGYLTVVMSAE L++VFNDT  L  S  A++SA+Y 
Sbjct: 193 LMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYT 252

Query: 241 NVSALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIG 300
           N +    + FVF P      II+    + NG+F   A  + K GS K  K    KN AIG
Sbjct: 253 NDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNYAIG 312

Query: 301 YSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIV 360
           Y+P  F    WVAVV+  +  F S S KL KII GTVV I VFVF+++ PL++WAV+PIV
Sbjct: 313 YAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIV 372

Query: 361 RLQKATELISEGRGLKS 377
           RLQ+A+ELI++ RGL++
Sbjct: 373 RLQRASELITKRRGLRN 389

 Score =  159 bits (402), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 5/159 (3%)

Query: 1095 SLDRPFLQST---GTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLE 1151
            SLD+  LQ T        +  +  +   NK   P++ +K+LVAEDN VNQEVIKRML LE
Sbjct: 980  SLDKSVLQKTRMDAQKVEANEIDDIDHCNKGI-PSK-LKVLVAEDNLVNQEVIKRMLKLE 1037

Query: 1152 GVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIV 1211
             ++ I+LA DG EAF+KVK        Y+IIFMD+QMPK+DGL ST  IR++L Y+  IV
Sbjct: 1038 NISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIV 1097

Query: 1212 ALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
            ALTAFAD+SNIKEC ++GM+GF+ KPIKR  L T+++E+
Sbjct: 1098 ALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 68/122 (55%), Gaps = 11/122 (9%)

Query: 1131 ILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPK 1190
            +L+ ED+ ++ ++  + L   G   + +  DG  A   + TL  +N  Y+++ MD+ MP 
Sbjct: 405  VLLVEDDAISIQLCSKFLRKYGC-TVQVVTDGLSA---ITTL--ENSRYDLVLMDIVMPN 458

Query: 1191 VDGLLSTKMIRKDLHYDH--PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIK 1248
            +DG  +T +IR    +D+  PI+A+T   DD ++   L+ GMN  L+KP  R  L +++ 
Sbjct: 459  LDGATATSIIRS---FDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSMLI 515

Query: 1249 EY 1250
             Y
Sbjct: 516  RY 517

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 85/160 (53%), Gaps = 16/160 (10%)

Query: 1098 RPFLQSTGT-ATSSRNVPVLSESNKDEDPAQNIK----ILVAEDNHVNQEVIKRMLNLEG 1152
            +P +   GT A +S  +   + S ++ +P  +++    +L+ ED+ V  ++  + L   G
Sbjct: 282  QPHVSPLGTVAPTSIPLAQATPSKEEANPPTSLRPGFHVLLVEDDSVCIQLCSKFLRKYG 341

Query: 1153 VNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDH--PI 1210
             + +++  DG  A + V+        Y+++ MD+ MP +DG  +T +IR    +D+  PI
Sbjct: 342  CS-VEVVTDGLSAIETVEKFQ-----YDLVLMDIVMPNLDGATATSVIRS---FDNQTPI 392

Query: 1211 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
            +A+T   +D ++   L+ GMN  L+KP  +  L +++  Y
Sbjct: 393  IAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRY 432

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 67/122 (54%), Gaps = 11/122 (9%)

Query: 1131 ILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPK 1190
            +L+ ED+ V  ++  + L   G + +++  DG  A + V+        Y+++ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEKFQ-----YDLVLMDIVMPN 384

Query: 1191 VDGLLSTKMIRKDLHYDH--PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIK 1248
            +DG  +T +IR    +D+  PI+A+T   +D ++   L+ GMN  L+KP  +  L +++ 
Sbjct: 385  LDGATATSVIRS---FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 441

Query: 1249 EY 1250
             Y
Sbjct: 442  RY 443

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 67/128 (52%), Gaps = 13/128 (10%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L    ++   +A +G+EA +  K     N   ++IFMD+Q+
Sbjct: 475  INVLIVEDNVINQAILGGFLRKHKIS-YKVAKNGKEAVEMWK-----NGGLHLIFMDLQL 528

Query: 1189 PKVDGLLSTKMIRKDLHYDHP------IVALTAFADDSNIKECLESGMNGFLSKPIKRPK 1242
            P + G+ + K IR D   + P      IVALTA     + +  L SG N +L+KP+    
Sbjct: 529  PVLSGIDAAKQIR-DFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHW 587

Query: 1243 LRTIIKEY 1250
            L   I E+
Sbjct: 588  LSKKITEW 595

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 77/156 (49%), Gaps = 15/156 (9%)

Query: 1103 STGTATSSRNVPVLSESNKDEDPAQN--------IKILVAEDNHVNQEVIKRMLNLEGVN 1154
            S  T+T S  +P L + N     AQN          +L+ ED+ V+ ++  + L   G  
Sbjct: 343  SPATSTVSLQLPNLPDQNSLTPNAQNNTVTLRKGFHVLLVEDDAVSIQLCSKFLRKYGC- 401

Query: 1155 KIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALT 1214
             + +  DG  A   + TL +    Y+++ MD+ MP +DG  +T ++R     + PI+A+T
Sbjct: 402  TVQVVSDGLSA---ISTLEKY--RYDLVLMDIVMPNLDGATATSIVRS-FDNETPIIAMT 455

Query: 1215 AFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
                + ++   L+ GMN  L+KP  R  L +I+  Y
Sbjct: 456  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 491

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 66/125 (52%), Gaps = 9/125 (7%)

Query: 1127 QNIKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDV 1186
            +   +L+ ED+ V  ++  + L   G   +++  DG  A   ++        Y+++ MD+
Sbjct: 374  EGFHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLAAISTLEKFR-----YDLVLMDI 427

Query: 1187 QMPKVDGLLSTKMIRK-DLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRT 1245
             MP +DG  +T ++R  D+H   PI+A+T   +D ++   L+ GMN  L+KP  +  L +
Sbjct: 428  VMPNLDGATATSIVRSFDIHT--PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHS 485

Query: 1246 IIKEY 1250
            ++  Y
Sbjct: 486  MLIRY 490

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 67/120 (55%), Gaps = 7/120 (5%)

Query: 1131 ILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPK 1190
            +L+ ED+ V  ++  + L   G + +++  DG  A   + TL +Q   ++++ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSA---ISTLEKQ--RFDLVLMDIVMPN 384

Query: 1191 VDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
            +DG  +T ++R     + PI+A+T   DD ++   L+ GMN  L+KP  +  L +++  Y
Sbjct: 385  LDGATATSIVRS-FDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 66/122 (54%), Gaps = 11/122 (9%)

Query: 1131 ILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPK 1190
            +L+ ED+ ++ ++  + L   G   +++  DG  A   ++        Y+++ MD+ MP 
Sbjct: 355  VLLVEDDAISIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKFR-----YDLVLMDIVMPN 408

Query: 1191 VDGLLSTKMIRKDLHYDH--PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIK 1248
            +DG  +T +IR    +D+  PI+A+T   +D ++   L+ GMN  L+KP  R  L +++ 
Sbjct: 409  LDGATATSIIRS---FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLI 465

Query: 1249 EY 1250
             Y
Sbjct: 466  RY 467

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 74/156 (47%), Gaps = 15/156 (9%)

Query: 1103 STGTATSSRNVPVLSESNKDEDPAQ--------NIKILVAEDNHVNQEVIKRMLNLEGVN 1154
            S  T+T S  +P L + N     AQ           +L+ ED+ V+ ++  + L   G  
Sbjct: 345  SPATSTVSLQLPSLPDENSLTPNAQANTVTLRKGFHVLLVEDDVVSIQLCSKFLRKYGC- 403

Query: 1155 KIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALT 1214
             + +  DG  A   ++        Y+++ MD+ MP +DG  +T ++R     + PI+A+T
Sbjct: 404  TVQVVTDGLSAISTLEKFR-----YDLVLMDIVMPNLDGATATSIVRS-FDNETPIIAMT 457

Query: 1215 AFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
                + ++   L+ GMN  L+KP  R  L +I+  Y
Sbjct: 458  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 64/119 (53%), Gaps = 11/119 (9%)

Query: 1131 ILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPK 1190
            +L+ ED+ V+ ++  + L   G   + +  DG  A   ++        Y+++ MD+ MP 
Sbjct: 407  VLLVEDDSVSIQLCSKFLRKYGC-TVQVVTDGLSAISNLEKFR-----YDLVLMDIVMPN 460

Query: 1191 VDGLLSTKMIRKDLHYDH--PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTII 1247
            +DG  +T ++R    +D+  PI+A+T   +D ++   L+ GMN  L+KP  R  L +I+
Sbjct: 461  LDGATATSIVRS---FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSIL 516

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 65/125 (52%), Gaps = 9/125 (7%)

Query: 1127 QNIKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDV 1186
            +   +L+ ED+ V  ++  + L   G   +++  DG  A   ++        Y+++ MD+
Sbjct: 332  EGFHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKFR-----YDLVLMDI 385

Query: 1187 QMPKVDGLLSTKMIRK-DLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRT 1245
             MP +DG  +T ++R  D H   PI+A+T   +D ++   L+ GMN  L+KP  +  L +
Sbjct: 386  VMPNLDGATATSIVRSFDNHT--PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHS 443

Query: 1246 IIKEY 1250
            ++  Y
Sbjct: 444  MLIRY 448

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 66/122 (54%), Gaps = 11/122 (9%)

Query: 1131 ILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPK 1190
            +L+ ED+ V+  +  + L   G   +++  DG  A   ++        Y+++ MD+ MP 
Sbjct: 383  VLLVEDDAVSIRLCSKFLRKYGCT-VEVVTDGLSAISTLEKFR-----YDLVLMDIVMPN 436

Query: 1191 VDGLLSTKMIRKDLHYDH--PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIK 1248
            +DG  +T +IR   ++D+  PI+A+T   +D ++   L+ GMN  L+KP  +  L +++ 
Sbjct: 437  LDGATATSIIR---NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 493

Query: 1249 EY 1250
             Y
Sbjct: 494  RY 495

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 74/156 (47%), Gaps = 15/156 (9%)

Query: 1103 STGTATSSRNVPVLSESNKDEDPAQN--------IKILVAEDNHVNQEVIKRMLNLEGVN 1154
            S  T+T S  +P L + N     AQ           +L+ ED+ V+ ++  + L   G  
Sbjct: 344  SPTTSTVSLQMPNLPDENSLTPNAQGNAVTLRKGFHVLLVEDDAVSIQLCSKFLRKYGC- 402

Query: 1155 KIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALT 1214
             + +  DG  A   ++        Y+++ MD+ MP +DG  +T ++R     + PI+A+T
Sbjct: 403  TVQVVTDGLSAISTLEKFR-----YDLVLMDIVMPNLDGATATSIVRS-FDNETPIIAMT 456

Query: 1215 AFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
                + ++   L+ GMN  L+KP  R  L +I+  Y
Sbjct: 457  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 492

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 66/122 (54%), Gaps = 11/122 (9%)

Query: 1131 ILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPK 1190
            +L+ ED+ V  ++  + L   G + +++  DG  A   ++        Y+++ MD+ MP 
Sbjct: 309  VLLVEDDSVCIQLCSKFLLKYGCS-VEVVTDGLSAISTLEKFR-----YDLVLMDIVMPN 362

Query: 1191 VDGLLSTKMIRKDLHYDH--PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIK 1248
            +DG  +T ++R    +D+  PI+A+T   +D ++   LE GMN  L+KP  +  L +++ 
Sbjct: 363  LDGATATSIVRS---FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLI 419

Query: 1249 EY 1250
             Y
Sbjct: 420  RY 421

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 58.5 bits (140), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 73/150 (48%), Gaps = 34/150 (22%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L    ++  ++A +G EA +K +         ++I MD+Q+
Sbjct: 549  INVLIVEDNIINQAILVSFLKRHRIS-YEIAKNGAEAVEKWR-----QGGIHLILMDLQL 602

Query: 1189 PKVDGLLSTKMIR-------------------KDLHYD-------HP--IVALTAFADDS 1220
            P + GL +TK IR                   +D   D        P  IVALTAF+  +
Sbjct: 603  PLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSHA 662

Query: 1221 NIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
            + +E L +G N +L+KP+    L + I E+
Sbjct: 663  DRREALVAGCNDYLTKPVNLDWLSSKITEW 692

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 78/183 (42%), Gaps = 38/183 (20%)

Query: 1096 LDRPFLQSTGTATSSRNVPVLSESNKDEDPA-QNIKILVAEDNHVNQEVIKRMLNLEGVN 1154
            L R F    G   SSR  P   E +   D     I +L+ EDN +NQ ++   L    + 
Sbjct: 534  LSRSFAPKNG---SSREKPFPGEWSATSDKVFPKINVLIVEDNVINQTILSSFLRKHKI- 589

Query: 1155 KIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPI---- 1210
               +A +GQEA D  +         ++IFMD+Q+P + G+ + K IR +L  +H I    
Sbjct: 590  FYKVAKNGQEAIDVWR-----EGGIHLIFMDLQLPVLSGIDAAKKIR-ELEREHGIGIQK 643

Query: 1211 -----------------------VALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTII 1247
                                   VA TA    S+ KE L SG N +L+KP+    L   I
Sbjct: 644  SRKTPHIESNKINKDQINAPVIIVAFTASKSQSDKKEALISGCNDYLTKPVNLHWLSNKI 703

Query: 1248 KEY 1250
             E+
Sbjct: 704  NEW 706

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 62/120 (51%), Gaps = 7/120 (5%)

Query: 1131 ILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPK 1190
            +L+ ED+ V+ ++  + L   G   + +  DG  A   ++        Y+++ MD+ MP 
Sbjct: 381  VLLVEDDAVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKFR-----YDLVLMDIVMPN 434

Query: 1191 VDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
            +DG  +T ++R     + PI+A+T    + ++   L+ GMN  L+KP  R  L +I+  Y
Sbjct: 435  LDGATATSIVRS-FDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRY 493

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 78/159 (49%), Gaps = 19/159 (11%)

Query: 1101 LQSTGTATSSRNVPVLSESNKD------------EDPAQNIKILVAEDNHVNQEVIKRML 1148
            LQ     T+  +V  +S+S+ D            E+  +   +L+ ED+ V+ ++  + L
Sbjct: 384  LQEENINTTGHSVSSISKSDVDIKQENSQSPTATEELRKGYHVLLVEDDAVSIQLCSKFL 443

Query: 1149 NLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDH 1208
               G   +++  DG  A   ++        Y+++ MD+ MP +DG  +T +IR +   + 
Sbjct: 444  RKSGCT-VEVVTDGLAAISILEAFR-----YDLVLMDIVMPNLDGATATSIIR-NFDKET 496

Query: 1209 PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTII 1247
            PI+A+T   +D ++   L+ GM   L+KP  R  L +++
Sbjct: 497  PIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSML 535

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 64/120 (53%), Gaps = 7/120 (5%)

Query: 1131 ILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPK 1190
            +L+ ED+ V  ++  + L   G   + +  DG  A   +     +N  ++++ MD+ MP 
Sbjct: 418  VLLVEDDEVCIQLCSKFLRKYGC-TVRVVTDGLTAISVL-----ENHRFDLVLMDIVMPN 471

Query: 1191 VDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
            +DG  +T ++R   +Y  PI+A+T   +D ++   L+ GMN  L+KP  +  L +++  Y
Sbjct: 472  LDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLVRY 530

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 80/169 (47%), Gaps = 28/169 (16%)

Query: 1101 LQSTGTATSSRNVPVLS---ESNKDEDPAQ--------------NIKILVAEDNHVNQEV 1143
            +++T +   S  VP LS    S  D +PA                  +L+ ED+ +  ++
Sbjct: 260  IKNTQSPQMSSAVPTLSVRKPSTMDSNPASTTPNMILDHPILRPGFHVLLVEDDSICIQL 319

Query: 1144 IKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKD 1203
              + L   G   +++  DG  A   ++        Y+++ MD+ MP +DG  +T ++R  
Sbjct: 320  CSKFLMKYGCT-VEVVTDGLSAISTLEKFR-----YDLVLMDIVMPNLDGATATSIVRS- 372

Query: 1204 LHYDH--PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
              +D+  PI+A+T   +D ++   L+ GMN  L+KP  +  L +++  Y
Sbjct: 373  --FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 419

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 67/129 (51%), Gaps = 13/129 (10%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L    ++   +A +G+EA D  K         ++IFMD+Q+
Sbjct: 517  INVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWK-----EGGLHLIFMDLQL 570

Query: 1189 PKVDGLLSTKMIR-----KDLHYDHP--IVALTAFADDSNIKECLESGMNGFLSKPIKRP 1241
            P + G+ + K IR     +    + P  IVALTA     + ++ L SG N +L+KP+   
Sbjct: 571  PVLSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPVNLH 630

Query: 1242 KLRTIIKEY 1250
             L   I E+
Sbjct: 631  WLSKKITEW 639

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 56.6 bits (135), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 73/162 (45%), Gaps = 41/162 (25%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L    ++   LA +GQEA +  K         ++IFMD+Q+
Sbjct: 486  INVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWK-----EGGLHLIFMDLQL 539

Query: 1189 PKVDGLLSTKMIR-----------KDLHYDHP----------------IVALTAFADDSN 1221
            P + G+ + K IR           K L+  +P                IVALTA     +
Sbjct: 540  PVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMD 599

Query: 1222 IKECLESGMNGFLSKPIKRPKLRTIIKEY-C-------PGWK 1255
             ++ L SG N +L+KP+    L   I E+ C        GWK
Sbjct: 600  KRKALVSGCNDYLTKPVNLHWLSKKITEWGCMQALIDFDGWK 641

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 65/122 (53%), Gaps = 11/122 (9%)

Query: 1131 ILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPK 1190
            +L+ ED+ V+ ++  + L   G   + +  DG  A   ++        ++++ MD+ MP 
Sbjct: 384  VLLVEDDDVSIQLCSKFLRKYGCT-VQVVTDGLAAISILEKFR-----FDLVLMDIVMPN 437

Query: 1191 VDGLLSTKMIRKDLHYDH--PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIK 1248
            +DG  +T +IR   ++D+  PI+A+T   +  ++   L+ GMN  L+KP  R  L +I+ 
Sbjct: 438  LDGATATSIIR---NFDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLYSILI 494

Query: 1249 EY 1250
             Y
Sbjct: 495  RY 496

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 81/192 (42%), Gaps = 38/192 (19%)

Query: 1090 GDYPVSLDRPFLQSTGTATSSRNVPVLSESNKDEDPA----------QNIKILVAEDNHV 1139
            G  P S D P    T   T    +P  +   K + P             I +L+ EDN +
Sbjct: 452  GSCPASPDLPNRPETVVPTLPSRLPSTTSLQKGQLPWGLITANHEIFPKITVLIVEDNVI 511

Query: 1140 NQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKM 1199
            NQ +++  L    ++   +A +GQEA D+ K         ++IFMD+Q+P   G+ + K 
Sbjct: 512  NQAILRSFLKKHKIS-YKVAKNGQEAVDRWK-----EGGIDLIFMDLQLPVFSGMDAAKK 565

Query: 1200 IRKDLHYDHP---------------------IVALTAFADDSNIKECLESGMNGFLSKPI 1238
            IR DL   +                      IVA TA    ++ +E L SG N +L+KP+
Sbjct: 566  IR-DLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALLSGCNDYLTKPV 624

Query: 1239 KRPKLRTIIKEY 1250
                L   I E+
Sbjct: 625  NLHWLSKKINEW 636

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 63/121 (52%), Gaps = 9/121 (7%)

Query: 1131 ILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSE-QNDSYNIIFMDVQMP 1189
            +L+ ED+ V+ ++  + L       I   C  Q   D +  +S  +   ++++ MD+ MP
Sbjct: 352  VLLVEDDEVSIQLCSKFL-------IKYGCTVQVVTDGLAAISTLEKYRFDLVLMDIVMP 404

Query: 1190 KVDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKE 1249
             +DG  +T +IR +   + PI+A+T   +  ++   L+ GMN  L+KP  R  L +++  
Sbjct: 405  NLDGATATSIIR-NFDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSMLTR 463

Query: 1250 Y 1250
            Y
Sbjct: 464  Y 464

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 75/164 (45%), Gaps = 45/164 (27%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKID--LACDGQEAFDKVKTLSEQNDSYNIIFMDV 1186
            I +L+ EDN +NQ ++   L     NKI   +A +G+EA DK K       + ++IFMD+
Sbjct: 463  INVLIVEDNVINQAILGSFLR---KNKISYKIAKNGKEAVDKWKE-----GNLHLIFMDL 514

Query: 1187 QMPKVDGLLSTKMIRK-------------------------DLHYDHP--IVALTAFADD 1219
            Q+P + G+ + K IR+                         +   + P  IVALTA    
Sbjct: 515  QLPVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQ 574

Query: 1220 SNIKECLESGMNGFLSKPIKRPKLRTIIKEY-C-------PGWK 1255
             + +E L SG N +L+KP+    L   I E+ C        GWK
Sbjct: 575  EDKREALISGCNDYLTKPVNLLWLSKKITEWGCMQALIDFDGWK 618

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 68/149 (45%), Gaps = 33/149 (22%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L    ++   LA +GQEA +  K         ++IFMD+Q+
Sbjct: 504  INVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWK-----EGGLHLIFMDLQL 557

Query: 1189 PKVDGLLSTKMIR-----------KDLHYDHP----------------IVALTAFADDSN 1221
            P + G+ + K IR           K L+  H                 IVALTA     +
Sbjct: 558  PVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMD 617

Query: 1222 IKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
             ++ L SG N +L+KP+    L   I E+
Sbjct: 618  KRKALLSGCNDYLTKPVNLHWLSKKITEW 646

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 66/122 (54%), Gaps = 11/122 (9%)

Query: 1131 ILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPK 1190
            +L+ ED+ +  ++  + L ++    +++  DG  A   ++        ++++ MD+ MP 
Sbjct: 304  VLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKFR-----FDLVLMDIVMPN 357

Query: 1191 VDGLLSTKMIRKDLHYDH--PIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIK 1248
            +DG  +T ++R    +D+  PI+A+T   +D ++   L+ GMN  L+KP  +  L +++ 
Sbjct: 358  LDGATATSIVRS---FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 414

Query: 1249 EY 1250
             Y
Sbjct: 415  RY 416

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 68/149 (45%), Gaps = 33/149 (22%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L    ++   LA +GQEA +  K         ++IFMD+Q+
Sbjct: 503  INVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWK-----EGGLHLIFMDLQL 556

Query: 1189 PKVDGLLSTKMIR--------------KDLHYDHP-------------IVALTAFADDSN 1221
            P + G+ + K IR               + HY+               IVALTA     +
Sbjct: 557  PVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMD 616

Query: 1222 IKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
             ++ L SG N +L+KP+    L   I E+
Sbjct: 617  KRKALLSGCNDYLTKPVNLHWLSKKITEW 645

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 68/149 (45%), Gaps = 33/149 (22%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L    ++   LA +GQEA +  K         ++IFMD+Q+
Sbjct: 493  INVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWK-----EGGLHLIFMDLQL 546

Query: 1189 PKVDGLLSTKMIR-----------KDLHYDHP----------------IVALTAFADDSN 1221
            P + G+ + K IR           K L+  H                 IVALTA     +
Sbjct: 547  PVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMD 606

Query: 1222 IKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
             ++ L SG N +L+KP+    L   I E+
Sbjct: 607  KRKALLSGCNDYLTKPVNLHWLSKKITEW 635

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 68/150 (45%), Gaps = 34/150 (22%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L    ++  ++A +G EA +K +         ++I MD+Q+
Sbjct: 509  INVLIVEDNIINQAILSSFLRKHKIS-YEIAKNGVEAVEKWR-----KGGIHLILMDLQL 562

Query: 1189 PKVDGLLSTKMIR--------------------------KDLHYDHP--IVALTAFADDS 1220
            P + G+ + K IR                              +  P  IVALTAF+  +
Sbjct: 563  PLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSHA 622

Query: 1221 NIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
            +  E L +G N +L+KP+    L   I E+
Sbjct: 623  DRNEALVAGCNDYLTKPVNLDWLSNKITEW 652

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 66/144 (45%), Gaps = 28/144 (19%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +LV EDN +NQ ++   L    ++   +A +G EA D+ K         ++I MD++M
Sbjct: 406  ISVLVVEDNMINQAILSSFLRKHKIH-YKVAKNGVEAVDRWK-----EGGMHLILMDLEM 459

Query: 1189 PKVDGLLSTKMIRK--------------------DLHYDHP--IVALTAFADDSNIKECL 1226
            P + G+ + K IRK                     L    P  IVALTA    ++  E L
Sbjct: 460  PLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTEAL 519

Query: 1227 ESGMNGFLSKPIKRPKLRTIIKEY 1250
             +G N +L+KP+    L   I E+
Sbjct: 520  LAGCNDYLTKPVNLDWLTRKITEW 543

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 70/151 (46%), Gaps = 34/151 (22%)

Query: 1128 NIKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQ 1187
            NI +L+ EDN +NQ ++   L    ++   +A +G+EA +K K         ++IFMD+Q
Sbjct: 470  NITVLIVEDNVINQTILASFLRKHKIS-YRIAKNGREAVEKWKE-----GGIHLIFMDLQ 523

Query: 1188 MPKVDGLLSTKMIR-----KDLHYDHP-----------------------IVALTAFADD 1219
            +P + G+ + K IR     K +   +P                       +VA TA    
Sbjct: 524  LPVMSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSL 583

Query: 1220 SNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
            ++ +E L SG N +L+KP+    L   I E+
Sbjct: 584  TDKREALVSGCNDYLTKPVNLHWLSKKITEW 614

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 66/145 (45%), Gaps = 29/145 (20%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +LV EDN +NQ ++   L    ++   +A +G EA D+ K         ++I MD++M
Sbjct: 419  ISVLVVEDNMINQTILSSFLRKHKIS-YKVAKNGIEAVDRWK-----EGGMHLILMDLEM 472

Query: 1189 PKVDGLLSTKMIRK-----DLHYDHP------------------IVALTAFADDSNIKEC 1225
            P + G+ + K IR+      +    P                  IVALTA    S+  E 
Sbjct: 473  PLLSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPAKRSTSKAPVIIVALTASNSQSDKTEA 532

Query: 1226 LESGMNGFLSKPIKRPKLRTIIKEY 1250
            L +G N +L+KP+    L   I E+
Sbjct: 533  LLAGCNDYLTKPVNLDWLTRKITEW 557

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 68/154 (44%), Gaps = 40/154 (25%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L    ++   +A +G+EA DK K         ++IFMD+Q+
Sbjct: 511  INVLIVEDNVINQTILASFLRKHKIS-YKVAKNGREAVDKWK-----EGGLHLIFMDLQL 564

Query: 1189 PKVDGLLSTKMIRKDLHYDHP--------------------------------IVALTAF 1216
            P + G+ + K IR+  +  H                                 IVA TA 
Sbjct: 565  PVLSGIDAAKEIRE--YEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTAS 622

Query: 1217 ADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
               ++ +E L SG N +L+KP+    L   I E+
Sbjct: 623  NSLTDKREALISGCNDYLTKPVNLHWLSKKITEW 656

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 6/74 (8%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L   G++   +A DG EA +K K    + DS+ +I MD+Q+
Sbjct: 394  INVLIVEDNAINQAILALFLRKNGIS-YKVAKDGVEAIEKWK----EGDSH-LILMDLQL 447

Query: 1189 PKVDGLLSTKMIRK 1202
            P + GL +TK IR+
Sbjct: 448  PLLSGLEATKKIRE 461

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 65/141 (46%), Gaps = 25/141 (17%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L    ++   +A +G+EA D  K         ++IFMD+Q+
Sbjct: 545  INVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKE-----GGLHLIFMDLQL 598

Query: 1189 PKVDGLLSTKMIR-----------------KDLHYDHP--IVALTAFADDSNIKECLESG 1229
            P + G+ + + IR                 K      P  IVALTA     + +  L SG
Sbjct: 599  PVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISG 658

Query: 1230 MNGFLSKPIKRPKLRTIIKEY 1250
             N +L+KP+    L   I E+
Sbjct: 659  CNDYLTKPVNLHWLSKKITEW 679

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 66/146 (45%), Gaps = 31/146 (21%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L    ++   +A +G+EA D  K         ++IFMD+Q+
Sbjct: 670  INVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKE-----GGLHLIFMDLQL 723

Query: 1189 PKVDGLLSTKMIRKDLHYDHPI------------------------VALTAFADDSNIKE 1224
            P + G+ + + IR D   +  I                        VALTA     + ++
Sbjct: 724  PVLSGIEAARQIR-DFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRK 782

Query: 1225 CLESGMNGFLSKPIKRPKLRTIIKEY 1250
             L SG N +L+KP+    L   I E+
Sbjct: 783  ALLSGCNDYLTKPVNLHWLSKKITEW 808

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 67/157 (42%), Gaps = 46/157 (29%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKI--DLACDGQEAFDKVKTLSEQNDSYNIIFMDV 1186
            I IL+ EDN +NQ ++   L     NKI   +A +G+EA DK K         ++IFMD+
Sbjct: 565  INILIVEDNVINQTILGSFLR---KNKIFYKVAKNGREAVDKWKE-----GGIHLIFMDL 616

Query: 1187 QMPKVDGLLSTKMIRKDLHYDHP---------------------------------IVAL 1213
            Q+P + G  + K IR+   Y+                                   IVA 
Sbjct: 617  QLPVLSGTDAAKEIRQ---YEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAF 673

Query: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEY 1250
            TA    ++ +  L +G N +L+KP+    L   I E+
Sbjct: 674  TASNSLADKRAALIAGCNDYLTKPVNLHWLSKKITEW 710

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 6/73 (8%)

Query: 1129 IKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQM 1188
            I +L+ EDN +NQ ++   L    ++   +A +G+EA DK K         ++I +D+Q+
Sbjct: 462  INVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGREAVDKWK-----QGGIHLILLDLQL 515

Query: 1189 PKVDGLLSTKMIR 1201
            P + G+ +TK IR
Sbjct: 516  PILSGIEATKEIR 528

>Kwal_33.14819 s33 complement(828099..829796) [1698 bp, 565 aa] {ON}
            YER087W - Hypothetical ORF [contig 101] FULL
          Length = 565

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 9/68 (13%)

Query: 1167 DKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDL----HYDHP-----IVALTAFA 1217
            D VKT    N++YN+IF D+++P V     +  I  D+    HY H      ++A  A  
Sbjct: 176  DAVKTFEAMNETYNLIFQDLKVPFVSAWADSGDIGGDMSKEYHYLHETGEDTVLACNACN 235

Query: 1218 DDSNIKEC 1225
              SN+++C
Sbjct: 236  LVSNVEKC 243

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 11/73 (15%)

Query: 1176 NDSYNIIFMD-----VQMPKVDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGM 1230
            N  Y+++ +D     + +P ++ +LS+      + Y  PI+ +T+  +D  +   L+ G+
Sbjct: 533  NKCYDLVIIDAHVKFLNVPILESMLSS------IQYHPPIILMTSSLNDQQLIFYLQHGI 586

Query: 1231 NGFLSKPIKRPKL 1243
            N  L KP    KL
Sbjct: 587  NSILEKPFHSHKL 599

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 115,555,491
Number of extensions: 4726763
Number of successful extensions: 27376
Number of sequences better than 10.0: 181
Number of HSP's gapped: 28024
Number of HSP's successfully gapped: 242
Length of query: 1259
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1138
Effective length of database: 39,606,813
Effective search space: 45072553194
Effective search space used: 45072553194
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)