Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F002905.702ON1554155472080.0
SAKL0E14916g5.702ON177910755623e-57
NCAS0G002305.702ON17355125589e-57
Ecym_40185.702ON17696175581e-56
ZYRO0G06600g5.702ON18204285509e-56
AFR286W5.702ON17584365177e-52
TDEL0B021905.702ON18104995071e-50
Kwal_55.196975.702ON17604175061e-50
NCAS0A032005.702ON17884294943e-49
KLTH0E01056g5.702ON17716014863e-48
Skud_9.195.702ON16807964702e-46
YIL149C (MLP2)5.702ON16794974684e-46
CAGL0G02497g5.702ON17805084514e-44
KLLA0A00594g5.702ON17484304489e-44
Skud_11.3345.702ON18854964499e-44
Suva_11.3315.702ON18984864391e-42
Smik_9.205.702ON16828854282e-41
Smik_11.3585.702ON18785224202e-40
KAFR0D022205.702ON16744474094e-39
YKR095W (MLP1)5.702ON18755444051e-38
Kpol_1043.705.702ON13214373862e-36
KNAG0L021405.702ON16083693405e-31
TBLA0E017305.702ON18206293352e-30
Suva_9.395.702ON16823462932e-25
KAFR0H002105.702ON14543022823e-24
NDAI0E050405.702ON19734342547e-21
KNAG0C065905.702ON16514702403e-19
TPHA0D046105.702ON11831641784e-12
Kpol_2001.755.702ON10061281114e-04
TPHA0E002305.702ON12841661040.002
KLLA0D06787g8.631ON43676820.71
Suva_12.2254.364ON708115810.95
KLTH0B01232g5.123ON86673801.4
KAFR0E014705.296ON872124801.5
NDAI0G002201.493ON65464773.1
Kpol_1018.216.291ON417173763.5
TBLA0I029004.238ON1794144764.6
KAFR0G025006.65ON28942744.9
SAKL0F14894g7.488ON129758746.7
Ecym_34343.393ON48655737.8
Skud_13.3938.744ON694160739.2
CAGL0D03124g5.208ON72582739.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F00290
         (1554 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...  2781   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   221   3e-57
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   219   9e-57
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   219   1e-56
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   216   9e-56
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   203   7e-52
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   199   1e-50
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   199   1e-50
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   194   3e-49
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   191   3e-48
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   185   2e-46
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   184   4e-46
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   178   4e-44
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   177   9e-44
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   177   9e-44
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   173   1e-42
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   169   2e-41
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   166   2e-40
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   162   4e-39
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   160   1e-38
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   153   2e-36
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   135   5e-31
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   133   2e-30
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   117   2e-25
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   113   3e-24
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   102   7e-21
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...    97   3e-19
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    73   4e-12
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    47   4e-04
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    45   0.002
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    36   0.71 
Suva_12.225 Chr12 complement(353202..355328) [2127 bp, 708 aa] {...    36   0.95 
KLTH0B01232g Chr2 complement(108265..110865) [2601 bp, 866 aa] {...    35   1.4  
KAFR0E01470 Chr5 complement(293344..295962) [2619 bp, 872 aa] {O...    35   1.5  
NDAI0G00220 Chr7 (29472..31436) [1965 bp, 654 aa] {ON} Anc_1.493...    34   3.1  
Kpol_1018.21 s1018 (56444..57697) [1254 bp, 417 aa] {ON} (56444....    34   3.5  
TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {...    34   4.6  
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...    33   4.9  
SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa...    33   6.7  
Ecym_3434 Chr3 (816557..818017) [1461 bp, 486 aa] {ON} similar t...    33   7.8  
Skud_13.393 Chr13 complement(692641..694725) [2085 bp, 694 aa] {...    33   9.2  
CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {...    33   9.8  

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score = 2781 bits (7208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1430/1554 (92%), Positives = 1430/1554 (92%)

Query: 1    MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDI 60
            MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDI
Sbjct: 1    MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDI 60

Query: 61   KHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLI 120
            KHVYEGKINTISQKYF             SGYLVAREKLVSEKQKEFDSNDALNSEITLI
Sbjct: 61   KHVYEGKINTISQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLI 120

Query: 121  KYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQEL 180
            KYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQEL
Sbjct: 121  KYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQEL 180

Query: 181  WLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILS 240
            WLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILS
Sbjct: 181  WLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILS 240

Query: 241  LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS 300
            LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS
Sbjct: 241  LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS 300

Query: 301  YKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKF 360
            YKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKF
Sbjct: 301  YKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKF 360

Query: 361  GNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRIT 420
            GNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRIT
Sbjct: 361  GNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRIT 420

Query: 421  SSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTE 480
            SSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTE
Sbjct: 421  SSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTE 480

Query: 481  KEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXE 540
            KEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNM                E
Sbjct: 481  KEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQE 540

Query: 541  QEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXX 600
            QEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLV         
Sbjct: 541  QEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVTNSTIQSNT 600

Query: 601  XXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALN 660
                      CELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALN
Sbjct: 601  SNNSISSLQQCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALN 660

Query: 661  FDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQ 720
            FDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQ
Sbjct: 661  FDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQ 720

Query: 721  KISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEK 780
            KISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEK
Sbjct: 721  KISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEK 780

Query: 781  EPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHL 840
            EPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHL
Sbjct: 781  EPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHL 840

Query: 841  KLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTE 900
            KLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQG               TE
Sbjct: 841  KLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGKEKELNELKSKLVEKTE 900

Query: 901  KLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIES 960
            KLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIES
Sbjct: 901  KLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIES 960

Query: 961  NYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXX 1020
            NYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKM   
Sbjct: 961  NYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMLAL 1020

Query: 1021 XXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLI 1080
                     RRARYRNKNPREKFPSFVKIDQQS        VMENTTKLLALEESNAKLI
Sbjct: 1021 NLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEEDKEEVMENTTKLLALEESNAKLI 1080

Query: 1081 KEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQ 1140
            KEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQ
Sbjct: 1081 KEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQ 1140

Query: 1141 TILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQ 1200
            TILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQ
Sbjct: 1141 TILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQ 1200

Query: 1201 INLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELE 1260
            INLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELE
Sbjct: 1201 INLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELE 1260

Query: 1261 KKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXX 1320
            KKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQM      
Sbjct: 1261 KKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKT 1320

Query: 1321 XXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLP 1380
                   TILAQRKNNILANGQESANI            ALILKRITEAEENLKKRMRLP
Sbjct: 1321 KLEKEKETILAQRKNNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLP 1380

Query: 1381 SEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIK 1440
            SEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIK
Sbjct: 1381 SEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIK 1440

Query: 1441 KKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVXXXXXXXXXXXXXXXXG 1500
            KKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQV                G
Sbjct: 1441 KKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKINLSNINSSSPPLG 1500

Query: 1501 EKVLQLNYGANVVAETDNDDNPFTLQSGKDETLLTKRSADNEIIQDIIKRPKEE 1554
            EKVLQLNYGANVVAETDNDDNPFTLQSGKDETLLTKRSADNEIIQDIIKRPKEE
Sbjct: 1501 EKVLQLNYGANVVAETDNDDNPFTLQSGKDETLLTKRSADNEIIQDIIKRPKEE 1554

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  221 bits (562), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 293/1075 (27%), Positives = 518/1075 (48%), Gaps = 126/1075 (11%)

Query: 6    RNEPT-PSIIDKI-----SSFFDLPGNTWESMDEHALEKIYTKA---YDLMKENSFVSAA 56
            +N PT PS+I +I     SSF +L  +   ++D   + ++  KA     L  +N   S  
Sbjct: 4    QNSPTTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVT 63

Query: 57   IDDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSE 116
            +D++K   E +      +                 +   + KL+ EK       + L S+
Sbjct: 64   LDELKSSSERRSEAFKLQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQ 123

Query: 117  ITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSM 176
            +T +K   E  +     +     +    LE S+ E +  L     L++Q+   E ++ + 
Sbjct: 124  LTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTF 183

Query: 177  TQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDAS----RLQDQLQ 232
                     E ++L   M LL+ NN +LE         K+L S +E+      R+  +LQ
Sbjct: 184  KSNDLRGKAEMQRLTQEMNLLKSNNQWLE---------KELASKSEEFGSYRQRVNSELQ 234

Query: 233  IVSSEILSLKSEI-------ATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEIT 285
               SE+ S++SE+        TLK     LS  LQ K+  +K L D+ +  KQEF +E+T
Sbjct: 235  TALSELNSIRSELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMT 294

Query: 286  LKQRVNELLHNEIASYKKQIERLTSK------NLETPEKKIIQELVDLKEKLVNSEKECN 339
            LKQR+ +LL  +I S+K ++E   +K      +++   +KII+EL++ K+KL  SE +  
Sbjct: 295  LKQRLIDLLEKQIESFKTELESARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAV 354

Query: 340  ELKSTVDKYINIDEKKLISKFGNPKKL---------------IEILRRQLVKEKRHKDTL 384
            +L+ TVD+ ++ D ++     GN  K+               I +L+++L++E+R K+ L
Sbjct: 355  KLEETVDELLSTDGER---GAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQL 411

Query: 385  QRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKI 444
            Q QVE+F++ELE K+P+++SFKER   LE+EL  +   LE T+K+++ K+ ELT+++ KI
Sbjct: 412  QYQVEAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKI 471

Query: 445  SNNEQFNDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTD 500
            ++ E     L+RQRSDLAHQVQ+LL+ +    D+  P T +E   +KKI+++  +  + D
Sbjct: 472  ADYETQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQD 531

Query: 501  SHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAK 560
            + +IIS+RL+ F+++ ELQ+KNM                E+E +   +  ++  + E AK
Sbjct: 532  AQRIISERLVRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKE-AK 590

Query: 561  STSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKER--- 617
               + L+++ K+LES++ II++ERD++K+L                      L +E+   
Sbjct: 591  EAILTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKE 650

Query: 618  LTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDK 677
            L N LSS+ ++  K ++ L  +I +L ++Q  + + +EK          ++ +L E   K
Sbjct: 651  LENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKER--------SSRILAEDRSK 702

Query: 678  LENKIKTLEQDLAENELFEKNLITGGVNNLEQSK-----IIELSVAEQKISFLDKEISN- 731
            L +   TLE    EN+   K   +   N L+Q       I  L   + ++S L  +++N 
Sbjct: 703  LIS--NTLEMTKMENDELRKRFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNS 760

Query: 732  ------LKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERE-LPKNTQIKNEEKEPAK 784
                  L+S  +NL+ +  +++  +N +   + QL+T  +ERE L + TQ KN + +  K
Sbjct: 761  QSERDLLRSIQENLKKENESLSEERNNMRILITQLQTLQTERESLLEETQ-KNFQGKTNK 819

Query: 785  QQTY---TFERKKLESVNDSDISYLYYENLEE--LQNQFRTLRRELKEVQEDLDMKTESH 839
             +T    T E+   +S   SD  Y+  ++ +E   Q +F  L  EL   +E L  K    
Sbjct: 820  LETELSDTLEKLDAKSKEISD--YISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDI 877

Query: 840  LKLENKYTKVKNDLKQATYKLASV----YT------------TLEQKNSFLANSVSQLQG 883
              LE K   + N L+++  ++ +     Y+             LE+    LA++ SQ++ 
Sbjct: 878  QHLELKVESLNNKLEESEARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQ 937

Query: 884  XXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSR 943
                            + L+ ++ E +EKI       +T+ +E   FKD     K+ +S 
Sbjct: 938  YKSMADSSEESATAIKDALEQSKAEYTEKI-------ETLTKERDMFKDQVPILKDQISN 990

Query: 944  LRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKI 998
            L   +N  + Q       + ++I      LE+ + K +  D    E    Y+ KI
Sbjct: 991  LNNELNHQKSQ-------FESQISDYTRNLEDLKAKQSELDNMKAE----YEQKI 1034

 Score =  167 bits (422), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 153/455 (33%), Positives = 243/455 (53%), Gaps = 51/455 (11%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            +M    +L  L ESN  L  E +   + +  L ++L  +  K++PLE ++  L+  V EK
Sbjct: 1223 IMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREK 1282

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181
            +  +++  EE ERWK RSQ IL + + ++ E H K  +K+  L++++++   EN +L  R
Sbjct: 1283 DLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTR 1342

Query: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE-------------IEKN 1228
            F RLK+QAHEKL+AAKT Q  LT+Q+N+L  TK  LE  L  +             IEKN
Sbjct: 1343 FKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKN 1402

Query: 1229 NQSGNGAADESEE-----IIRLRAELEKSNNFSNELEKKV-EDAKKFKNEIESLKSEL-- 1280
              S      E  E     ++    +LE+  + S  LEK++ E  +   N+I+ L+ +L  
Sbjct: 1403 KSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLEEDLEK 1462

Query: 1281 ----------QSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTIL 1330
                      QS +  EN+   SKI+++LK  F+ EK ++I                +IL
Sbjct: 1463 AKTESPNDGSQSSELVENT---SKIVENLKIEFEEEKAKMISDKESELREQFEEEKASIL 1519

Query: 1331 AQRKNNI---LANGQ--ESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKI 1385
              ++  +   LA  +     NI                +RI E+ E LKKR+RLP+EEKI
Sbjct: 1520 EAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKI 1579

Query: 1386 NAVIEKRRKVLEQEFETKLRELG---------LNADGNGVVTDTRAQIE---KELREKFN 1433
            N ++EK+R  LE EFE  +++            N++   V+   +  +E   +E+++KF+
Sbjct: 1580 NKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVLEKHKQDLENLKQEMQKKFD 1639

Query: 1434 LELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ 1468
             ++A+IKK+AFEEGKQQ+ MKST LE+K++KLE+Q
Sbjct: 1640 EDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQ 1674

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  219 bits (558), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 194/512 (37%), Positives = 276/512 (53%), Gaps = 72/512 (14%)

Query: 1071 ALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQE 1130
             L+E+N +L +++    K N  + ++L  ++ ++ PL+ ++  LK  + EK+Q L +  E
Sbjct: 1171 TLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSE 1230

Query: 1131 ELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAH 1190
            E ERWKLRS+ IL + + V+ E H K +E++ TL+ QL+T   +N  L DRF+RLKKQAH
Sbjct: 1231 ENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTKDNEDLNDRFNRLKKQAH 1290

Query: 1191 EKLDAAKTMQINLTTQINELNETKVNLEKSLQQE---IEKNNQSGNGAADESEEIIRLRA 1247
            EKLDAAK    +LT +I +L + K  LE  L +E   I++         D  + I  L  
Sbjct: 1291 EKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVITALEK 1350

Query: 1248 ELEKSNNFSNELEKKVEDA--------KKFKNEIESLKSELQSVK-------AYENSTVN 1292
            EL  S   S ++E+ +++         KK   E+ SLKS+L+++K         + S +N
Sbjct: 1351 ELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQNGVISVADGSAIN 1410

Query: 1293 SKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNIL----ANGQESANIX 1348
            S+ I  LKESF+ EK ELI  +              +L +++          G E  +I 
Sbjct: 1411 SETIAHLKESFEVEKTELITTLKEEFKKQLEEEKKKLLEEKEKEYYDSKPTGGSEPIDIE 1470

Query: 1349 XXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELG 1408
                        +I++RI +AEENLKKR+RLPSEEKIN VIEKRRK LE+E+E KL+  G
Sbjct: 1471 KMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIEKRRKELEEEYEKKLKRQG 1530

Query: 1409 LNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ 1468
            L  +   +  + R ++E+ELR KF+ ELAE+KKKAF EGKQQS MK+TLLERKLSKLESQ
Sbjct: 1531 LTTE-TAIEEELRKEVERELRVKFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQ 1589

Query: 1469 -----------------------TLSPTKNN----------DSNETQVXXXXXXXXXXXX 1495
                                   TL P+K N          DS E QV            
Sbjct: 1590 ASPSRTPDLESSQKENTEGATKTTLGPSKINLLPFSMSNTDDSIEKQV------------ 1637

Query: 1496 XXXXGEKVLQLNYGANVVAETDNDDNPFTLQS 1527
                GEKVLQ+N  +  +  +    NPFTL +
Sbjct: 1638 --PQGEKVLQINRRS--LEPSFGSSNPFTLPT 1665

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
           similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  219 bits (558), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 196/617 (31%), Positives = 326/617 (52%), Gaps = 57/617 (9%)

Query: 16  KISSFFDLPGNTWESMDEHALEKIYTKAYDLMK---ENSFVSAAIDDIKHVYEGKINTIS 72
           K+++F ++     + +DE  +   + KA +  K   +N  +S +ID +K  +E KINT  
Sbjct: 17  KVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFK 76

Query: 73  QKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHT 132
           ++                     + KL++EK +       L+ E+  ++  +E  ++   
Sbjct: 77  EQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQ-------LSMEVLKLRSQVEEAKQGME 129

Query: 133 TLEARERKTENVLEQSKLELQDS-------LTENSALKEQIGVFEGKLDSMTQELWLANT 185
            + + ++    +LE+   +L  S       L  N  L++     E  +     +     +
Sbjct: 130 IIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKS 189

Query: 186 ENKKLQTGMKLLRENNLYLEIKCKETD-KNKKLYSSAEDASRLQDQLQIVSSEILSLKSE 244
           E ++L   + L++ N  +L    KE + KN++L S  E   +   +LQ    ++ SLKS+
Sbjct: 190 EIQRLHQELNLVKSNADWL---SKELESKNEQLNSFRE---KTNSELQNGYEQVNSLKSQ 243

Query: 245 I-------ATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNE 297
           +       +TLK     LS  LQ KL   K L D LN+ K+EF +E++LKQR+ +LL ++
Sbjct: 244 LEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQ 303

Query: 298 IASYKKQIE----RLTSKNLETPEK-KIIQELVDLKEKLVNSEKECNELKSTVDKYI--- 349
           ++S K  +E          + TPEK +++ EL+D K+ L  ++ E  +L++TV++ +   
Sbjct: 304 VSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVN 363

Query: 350 ----------NIDEKKLISKFGNPKKL---IEILRRQLVKEKRHKDTLQRQVESFLVELE 396
                     N+ +  L SK     KL   I IL++QLV+E+R K+ LQ QVESF+VELE
Sbjct: 364 GKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELE 423

Query: 397 QKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLR 456
            K+P+++SFKER   LEREL  +T  LE TAK+RD K  EL   + KI+N E     L+ 
Sbjct: 424 HKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIV 483

Query: 457 QRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHF 512
           QRSDLAHQVQYLL+ +    D   P TE+E   VK+I+S+E+    +D+  IIS+RL+ F
Sbjct: 484 QRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQF 543

Query: 513 QNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKT 572
           ++V ELQ KN                 E++ +  L+  +  + V+ AK   + L++H++ 
Sbjct: 544 KSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVE-TQTVKEAKEAILSLQEHVQR 602

Query: 573 LESKINIISQERDSYKL 589
           LE ++ I+S+ERD++KL
Sbjct: 603 LEDQLKIVSKERDAFKL 619

 Score =  160 bits (404), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 161/554 (29%), Positives = 277/554 (50%), Gaps = 64/554 (11%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            +ME   +L  L ESN  L  E +   + ++   +++A +Q +L+PLE ++  L + ++E+
Sbjct: 1219 IMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQLQPLESQLKSLTITISER 1278

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181
            +Q +++ +EE  RWK RSQ IL + + ++   H K  +++  L+ +LE    EN +  +R
Sbjct: 1279 DQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTELKNELEKKSLENLESQER 1338

Query: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEK----------NNQS 1231
            F +L+KQA+E+LD  K  +  + ++   ++  K  LE  L Q ++K          +   
Sbjct: 1339 FRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKVSELESKLSSSANE 1398

Query: 1232 GNGAADE-SEEIIRLRAELEKSNNFSNELEKKVEDAKK-FKNEIESLKSELQSVKA-YEN 1288
             NG AD   EE+  LRA   ++N    +++ +   ++K  KN+I+ L  +++++++  E+
Sbjct: 1399 KNGEADSLKEELEELRANFIEANEAVADIKAEAASSEKDLKNQIQELTEKIKTLESEIEH 1458

Query: 1289 STVNSK----------IIKDLKESFKREKDELIEQ------MXXXXXXXXXXXXXTILAQ 1332
            S + +K          I++++K+ F+ EK  LI++      M                  
Sbjct: 1459 SELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKDEELRMKLEEIQKQYEEERERELS 1518

Query: 1333 RKNNILANGQESANIXXXXXXXXXXXXAL---ILKRITEAEENLKKRMRLPSEEKINAVI 1389
                 L     +A +                  L+RI EAEE LKKR+RLPSEE+IN VI
Sbjct: 1519 ELKASLVESTPNAPLIDEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVI 1578

Query: 1390 EKRRKVLEQEFETKLRELGL---NADGNGVVTDTRAQIEKE-------LREKFNLELAEI 1439
            E+R++ L+QEFE ++R   L     +    V DT A++ KE       L  KF+ +LA +
Sbjct: 1579 ERRQRALDQEFELRVRARALELFKENPESFVGDT-AKLIKEHQEEMDKLEAKFDEQLALV 1637

Query: 1440 KKKAFEEGKQQSMMKSTLLERKLSKLESQT-------LSPTK---NNDSNETQVXXXXXX 1489
            +KKAFEEGKQQ +MK  LLE K++KLE Q          P+K   +N++N +        
Sbjct: 1638 RKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSKIPIDNNNNSSPQGAQPIA 1697

Query: 1490 XXXXXXXXXXGEKVLQLNYGA---------NVVAETDNDDNPFTLQSGKDETLLTKRSAD 1540
                      G+ +   ++G+           +A T  D +  TL +G   T   KR ++
Sbjct: 1698 IKPSPFQVAFGKAMENTSFGSFKGSLLDSKQFIANT-ADTSTSTL-TGNVGTNTNKRQSE 1755

Query: 1541 NEIIQDIIKRPKEE 1554
            +E+ Q   KRPK++
Sbjct: 1756 DELAQSPEKRPKDD 1769

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  216 bits (550), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 166/428 (38%), Positives = 238/428 (55%), Gaps = 28/428 (6%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            ++E   +L  L ESN  L    E   K N  L  +L  ++ ++ PLE E+N L   V EK
Sbjct: 1228 IIEQLNQLNLLRESNITLRNAAEEENKKNRELQEELNQLRERILPLESELNTLHTSVLEK 1287

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181
            +Q LN+ +EE  RWK RSQ IL +   ++ E H +  EK+  LE +L+    EN +L DR
Sbjct: 1288 DQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDR 1347

Query: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE---IEKNNQSGNGAADE 1238
            F+RLKKQAHEKL+++K  Q  L+ Q+NEL E K  LE   + E   + +  +  N   ++
Sbjct: 1348 FNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHGND 1407

Query: 1239 SEEIIRLRAELEKSNNFSNELEKKV--------EDAKKFKNEIESLKSELQSVKAYENST 1290
            +E +  ++ EL  +   S ELE+ +        E  KK  +EI+SLK EL S+K    +T
Sbjct: 1408 TETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAAT 1467

Query: 1291 VNSKIIKDLK---ESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANG----QE 1343
               +I +DL    ES +R  +E                    L + K+ +  NG    Q+
Sbjct: 1468 AKGEISEDLSNVVESMRRSFEE-----EKINFLKEKTEELKKLEEEKHTLQVNGNEPQQQ 1522

Query: 1344 SANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEF--- 1400
              N               ILKRI EAEENLKKR+RLP+EE+I  V+EK++  LE+ +   
Sbjct: 1523 PVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKK 1582

Query: 1401 ETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLER 1460
              + +    ++DGN   +D + Q+EK+L+EKF  E+  +KKKAFEEGKQQ+ MKSTLLER
Sbjct: 1583 LEESKSSLESSDGNN--SDLKKQLEKDLQEKFEAEVQAVKKKAFEEGKQQAAMKSTLLER 1640

Query: 1461 KLSKLESQ 1468
            K+SKLESQ
Sbjct: 1641 KISKLESQ 1648

 Score =  202 bits (515), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 193/634 (30%), Positives = 332/634 (52%), Gaps = 64/634 (10%)

Query: 2   STDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYD---LMKENSFVSAAID 58
           S D+ N+ +   + K+S+F+ +P +    +D   L  +  K  D   L  +N  ++  ID
Sbjct: 14  SGDNHNDVS---LGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTID 70

Query: 59  DIKHVY----EGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALN 114
           +IK V     EG  N I                      + R +   E  +       + 
Sbjct: 71  EIKTVSSKREEGLKNEI-----------ENLMKDNDSIRLERSQAQEESTQSSRDKQKIQ 119

Query: 115 SEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQD-------SLTENSALKEQIG 167
           +E+  ++  L  + ++  TL+  +R+   VLE+   EL+        SL ++  L++Q+ 
Sbjct: 120 NEVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVL 179

Query: 168 VFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRL 227
             E  + ++  +     +E + +   + +L++N+ +LE +   T K ++L S+     + 
Sbjct: 180 ELETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEEEV--TSKTEQLISTRR---KN 234

Query: 228 QDQLQIVSSEILSLKSEI-------ATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEF 280
            D+L  ++SE LS K+E+         +   NE L+  LQ KL  +KDL D+L   KQEF
Sbjct: 235 DDELDRLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEF 294

Query: 281 AKEITLKQRVNELLHNEIASY---------KKQIERLTSKNLETPEKKIIQELVDLKEKL 331
           A E+++KQ++ +LL N++ S          K  +E L S    T  +K+IQEL+ LKE  
Sbjct: 295 AHEMSMKQKLIDLLENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITLKENF 354

Query: 332 VNSEKECNELKSTVDKYINIDEKK--------LISKFGNPKKL--IEILRRQLVKEKRHK 381
             SE+E   L++ V + I  D+ +         IS       L  + IL+++L+KE+  K
Sbjct: 355 EESERERLRLEALVQELIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQK 414

Query: 382 DTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQ 441
           + LQRQVESF+VELE K+P+I+SFKER S LE+EL  +   L+ T+ E++ ++RE   L 
Sbjct: 415 ERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALS 474

Query: 442 KKISNNEQFNDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTEN 497
           KK+ ++E     L RQR+DLAHQVQ+LL+ I    D+    + +E + +K+IV+N++  +
Sbjct: 475 KKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNS 534

Query: 498 DTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVE 557
           ++DS ++IS+RL+ F N+  LQ+KNM                E++  K ++  +N+ I E
Sbjct: 535 ESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKE 594

Query: 558 SAKSTSVDLEKHIKTLESKINIISQERDSYKLLV 591
            AK   V L+ +   LESK+ I+++E D++K + 
Sbjct: 595 -AKEAIVSLQDYNANLESKVEILTKECDAFKAIC 627

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
           YIL149C (MLP2)
          Length = 1758

 Score =  203 bits (517), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 153/436 (35%), Positives = 245/436 (56%), Gaps = 32/436 (7%)

Query: 185 TENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAE----DASRLQDQLQIVSSEILS 240
            E ++LQ  + L+R N  +   +  E  KN++L S  E    +    Q +L IV +E+  
Sbjct: 186 AEIQRLQQELALVRSNAEWTTGQLNE--KNQQLNSYREKTNGEIQSTQVELNIVKNELEV 243

Query: 241 LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS 300
             + +A L+  N  LS  LQ  L   K L D+L+S KQEFA+E+ LKQR+ ELL+ ++A+
Sbjct: 244 EHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVAT 303

Query: 301 YKKQIERL--TSKNL---ETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKK 355
            K+ +E+    +KN    ++  ++++ +L D K+KL  S+   + L+ T+ + +  D  +
Sbjct: 304 MKQDLEKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQ 363

Query: 356 LISK-------FGNPKKLIEI---------LRRQLVKEKRHKDTLQRQVESFLVELEQKL 399
              +        G+P     I         LR+QLV+E+RHK+ LQ QVESF+VELE K+
Sbjct: 364 SGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKI 423

Query: 400 PMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRS 459
           P+++SFK+R   LE++L  +T  LE TA+ERD K  ++   + K+ + E     L++QRS
Sbjct: 424 PVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRS 483

Query: 460 DLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNV 515
           DLA QVQ LL+ I    D+  P T +E   VKK+ S  ++   +D+  IIS RL+ F++V
Sbjct: 484 DLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSV 543

Query: 516 KELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLES 575
            ELQQKN                 E + Q  ++  + N + E AK   + L++H++ LE 
Sbjct: 544 VELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNE-AKEAILSLQEHVQMLED 602

Query: 576 KINIISQERDSYKLLV 591
           ++  ++ ERDS+KLLV
Sbjct: 603 QLETVTTERDSFKLLV 618

 Score =  163 bits (412), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 147/474 (31%), Positives = 236/474 (49%), Gaps = 75/474 (15%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            + E   +L  L E N  L  E E  ++ NE L +++  +Q K++P+E++I  L   + EK
Sbjct: 1217 LFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATLTEK 1276

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181
            EQ L + +EE +RWK RSQ IL + + ++ E + K   +I+ L+ +LE    E+    +R
Sbjct: 1277 EQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAELERKSAESIDSQER 1336

Query: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEE 1241
            F +L+KQA+E+LD  K  +  + +++      K  LE  L +  EK              
Sbjct: 1337 FRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAREK-------------- 1382

Query: 1242 IIRLRAEL------EKSNNFSNELEK---KVEDA---------------KKFKNEIESLK 1277
            I  L  +L      E  N  S+ELE+   K++DA               + FK +++ L 
Sbjct: 1383 ITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLDELN 1442

Query: 1278 SELQSVKAYENSTVNS-------------KIIKDLKESFKREKDELIEQMXXXXXXXXXX 1324
             +L++++  +NS  +S              +++D K+  + E+  LIE            
Sbjct: 1443 KQLETIQ--KNSAPSSGHSDPSSYHEQPTAVLEDFKKQVEEERRTLIESHQQELTARLEA 1500

Query: 1325 XXXTILAQRKNNI---------LANGQESANIXXXXXXXXXXXXALILKRITEAEENLKK 1375
                 LA+++  +         ++    S N+               L+RI EAEE LKK
Sbjct: 1501 SRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKK 1560

Query: 1376 RMRLPSEEKINAVIEKRRKVLEQEFETKLRELGL----------NADGNGVVTDTR---A 1422
            R+RLPSEE+IN VIE+++K LEQEF TK+    L           +D   ++ D +    
Sbjct: 1561 RIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQKEIV 1620

Query: 1423 QIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNN 1476
            Q++K+L +KF  +L ++KKKAFEEG+QQ +MK  LLE K+SKLESQ  +P   N
Sbjct: 1621 QLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAKAPLGTN 1674

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  199 bits (507), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 166/499 (33%), Positives = 256/499 (51%), Gaps = 48/499 (9%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            +ME   ++  L ESN  L   V    + N  L S+L  +Q K+ PL  E++E +  + EK
Sbjct: 1215 IMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIEEK 1274

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181
            +Q + +  +E +RWK RS  IL++ + ++ E + K  E+I  L+++LE    EN  L DR
Sbjct: 1275 DQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLNDR 1334

Query: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE-----------IEKNNQ 1230
            F RLKKQAHEKL+A+K  Q NL+ ++NEL  TK  +E+ L++             E++++
Sbjct: 1335 FTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERDSE 1394

Query: 1231 SGNGAADESEEIIRLRAELEKSNNFSNELEKKVED--------AKKFKNEIESLKSELQS 1282
            S N           LR EL+ +     E+E K+ +          +   EI SLK +++ 
Sbjct: 1395 SANNED--------LRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQVRI 1446

Query: 1283 VKAYEN-STVN-----SKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNN 1336
             K  EN ST+      S +++ +K++F+ EK + I++               + ++  N 
Sbjct: 1447 FKEKENDSTLEGSQGLSNVVESMKKAFEEEKIKFIQEKTEEYNKKFEEEKAKLSSE--NG 1504

Query: 1337 ILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVL 1396
              A    + ++            A+  +RI EAEENLKKR+R+P+EE+I  V++KR+  L
Sbjct: 1505 SPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKTEL 1564

Query: 1397 EQEFETKLRELGLNADGNGV--VTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMK 1454
            E+EF+ +L+E  L  +G       + + Q+E E   K+   LA  KKKAFEEGKQQ+ MK
Sbjct: 1565 EEEFQRRLKENNLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMK 1624

Query: 1455 STLLERKLSKLESQTLSPTKNNDSNETQVXXX---------XXXXXXXXXXXXXGEKVLQ 1505
            STLLERK+SKLESQ  S   NN + E                            GEKVL+
Sbjct: 1625 STLLERKISKLESQLNSS--NNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLK 1682

Query: 1506 LNYGANVVAETDNDDNPFT 1524
            L+       +  +  NPFT
Sbjct: 1683 LSDKPAFSFQPSSKSNPFT 1701

 Score =  196 bits (499), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 157/470 (33%), Positives = 273/470 (58%), Gaps = 28/470 (5%)

Query: 145 LEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYL 204
           LE SK+E Q+ + +N  L++Q+   + ++ ++        +E + ++  + +L ++N +L
Sbjct: 153 LEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWL 212

Query: 205 EIKCKETDKNKKLYS-SAEDASRLQDQLQIVSSEILSLKSEIATLKYM---NESLSTDLQ 260
           E +   T K ++L     E+ + LQ  LQ V+      + E ++ +++   N+ +S DLQ
Sbjct: 213 EKEV--TSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQ 270

Query: 261 RKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLT--------SKN 312
            KL+ IK L D LN+ KQEF++E++LKQ++ +L   ++ S+K+++ RLT        + N
Sbjct: 271 NKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEEL-RLTEEKHNSTEADN 329

Query: 313 LE-TPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGN---PKKL-- 366
           L+ T + + + +L  ++++L  S  E   L++ V++ +   E+  +    N   PK    
Sbjct: 330 LQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYGD 389

Query: 367 IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEET 426
           I +L++QL+KE+  K+ LQRQ+ESF+VELE K+P+I+S KER+ +LE+EL  I   LE T
Sbjct: 390 IGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHT 449

Query: 427 AKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLL----LCIDNKSPFTEKE 482
           + E++ K REL +   KI   E     L+RQRSDLA QVQ+LL    L  D++ P T  E
Sbjct: 450 SHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADE 509

Query: 483 ATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQE 542
              +KKI+ NEN  N++DS  II++RL+ F+++  LQ++N                 E+E
Sbjct: 510 VAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNT--ELLKTARTLADRLEEEE 567

Query: 543 QQKTLRITD-NNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLV 591
           +   +RI     K ++ AK   + L++    +ESK++ I +ERD+YK ++
Sbjct: 568 KNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAIL 617

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
           YKR095W (MLP1) - colied-coil protein (putative), similar
           to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  199 bits (506), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 143/417 (34%), Positives = 235/417 (56%), Gaps = 17/417 (4%)

Query: 189 KLQTGMKLLRENNLYLEIKCKETDKNKKLY---SSAEDASRLQDQLQIVSSEILSLKSEI 245
           +L   + LL  NN +LE +  + +     Y   + +E AS +  +L+    ++ +    I
Sbjct: 196 QLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELAS-VSQRLETCEGDLQAATKTI 254

Query: 246 ATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQI 305
            TL+  N    ++L+ +   +K L D L S+KQEF +E++LKQR+ ELL  ++++ K ++
Sbjct: 255 KTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSEL 314

Query: 306 ERLTSKNLET------PEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISK 359
           E   S    T       + +I  ELV   ++L  SE +  +L+ TV++ ++ DEK +   
Sbjct: 315 EFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKTISGS 374

Query: 360 FGNPKKL--IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELL 417
              P     I IL++Q++ E+R K+ LQ QVE+F+VELE K+PM+ SFK+RN  LE+EL 
Sbjct: 375 QSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKELA 434

Query: 418 RITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI----D 473
                L+  +K++D    +L   + +I + E     L +QRSDLA QVQYLL+ +    D
Sbjct: 435 ETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRGD 494

Query: 474 NKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXX 533
           +  P + +E   VKK+V+ ENT+ D D+  IIS+RL+ F+N+ ELQ KN           
Sbjct: 495 SHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRNLA 554

Query: 534 XXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLL 590
                 E++ +      +N+ I E AK   V L+ HI+ LE++I++I++ERD+YK +
Sbjct: 555 NQLETEERKVKSKTEAIENDTITE-AKEAIVTLQDHIQELETRIDVITRERDAYKAI 610

 Score =  129 bits (325), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 140/476 (29%), Positives = 233/476 (48%), Gaps = 77/476 (16%)

Query: 1045 SFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKL 1104
            S V  D +S        ++E   ++  L ESN  L  E++  ++ N+ L   + ++Q  L
Sbjct: 1193 SQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEAL 1252

Query: 1105 EPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTL 1164
            +PLE +I  L+  V  K++ +++  EE+ RWK RSQ IL + + V+ E H K  E++   
Sbjct: 1253 KPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQA 1312

Query: 1165 EEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE 1224
              +      + ++L DRF RLKKQA E+LD A+T Q  L  ++ E  E++  LE +L +E
Sbjct: 1313 RAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKE 1372

Query: 1225 IEKNN--QSGNGAADESEEIIRLRAELEKSNNFSNELE---KKVEDAKKFKNEI------ 1273
             EK    Q    A +E+        E+E S+   ++L+   +K+EDA+   NE+      
Sbjct: 1373 REKTRSLQESIKATEEN--------EIENSSATRDQLQDALQKLEDAQARINEMSTAPSQ 1424

Query: 1274 --ESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDE--LIEQMXXXXXXXXX--XXXX 1327
              ++L+ EL+  + +         +K L+E   + ++E  ++E+                
Sbjct: 1425 EEQTLREELERTRQH---------VKQLEEHLAKTQNEVRVLEEAKNQVSGTEAEIARVK 1475

Query: 1328 TILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAE-------ENLKK----- 1375
            T L    N +LA  ++ A I            A + K +  +E       ENLKK     
Sbjct: 1476 TELIDHSNKLLA--EKEAEIKEKYEKQRLEDKAELEKSLASSESLKSSDIENLKKEWEEE 1533

Query: 1376 ------------------RMRLPSEEKINAVIEKRRKVLEQEFETKLR--------ELGL 1409
                              R+RLP+EEKIN +IE R++ L++EFE KL+        E  L
Sbjct: 1534 YEQRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPL 1593

Query: 1410 NADGNGVVTDTRAQIEK---ELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKL 1462
             A    V+   + ++EK   +++ + + E+A+ KKKAF+EGKQQ+ MKS  LE+K+
Sbjct: 1594 PATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLEKKI 1649

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  194 bits (494), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 153/429 (35%), Positives = 236/429 (55%), Gaps = 22/429 (5%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            +M    +L  L ESN  L  E  +  +  + L   L  ++ K+ PLE E N LK  + E 
Sbjct: 1192 IMNQLNQLNLLRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKEN 1251

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181
            EQ LN  +EE  RWK RSQ IL + K ++   H K   +I TL++ L   + EN +L DR
Sbjct: 1252 EQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDR 1311

Query: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE---IEKNNQSGNGAADE 1238
            F+R+KKQAHE+L+++K  Q  L  QI +L +   +++  L+ E   I+   +       +
Sbjct: 1312 FNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQ 1371

Query: 1239 SEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNE--------IESLKSELQSVKAYEN-- 1288
            SE++  LR++LE++   S E E K   + K  +E        I+SL +EL  +K  +N  
Sbjct: 1372 SEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNE 1431

Query: 1289 STVN-----SKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQE 1343
            +TV      S +++++K+SF+ EK + ++                I AQ  +    N   
Sbjct: 1432 ATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTP 1491

Query: 1344 SANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETK 1403
              +I             ++LKRI +AEENLK+R+RLP+EEKIN+VI+K++  LE+E++ K
Sbjct: 1492 LQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEK 1551

Query: 1404 L----RELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLE 1459
            +    +EL  + +    + D +  I+KEL    + EL   K KAFEEGKQQ+MMK+T LE
Sbjct: 1552 VNQRAKELLSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLE 1611

Query: 1460 RKLSKLESQ 1468
            +K+SKLESQ
Sbjct: 1612 KKISKLESQ 1620

 Score =  148 bits (373), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 126/398 (31%), Positives = 220/398 (55%), Gaps = 31/398 (7%)

Query: 212 DKNKKLYSSAEDASRLQDQLQIVSSEILSL-------KSEIATLKYMNESLSTDLQRKLF 264
           +K+KK+   +E  S  Q ++Q +  +I +L       KSE   LK  N  +S++L  K  
Sbjct: 212 NKDKKM---SEYYSNCQAEIQTLRKKISTLENNCSIIKSENDALKKENRIVSSNLHEKSS 268

Query: 265 RIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQ-- 322
           ++++L +  N+ K+E  KE++LKQ + ++L  ++   +    R+   N + P   I+Q  
Sbjct: 269 KVQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQDDYTRIL--NTKQP---IVQND 323

Query: 323 -----ELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKL-IEILRRQLVK 376
                E+ +LK+KL+ +E + N+    +++  NI  +   S   N ++  ++ ++++L++
Sbjct: 324 EERNLEVEELKQKLIETETQLNK---ELEERRNITMQTESSTLSNQQQEDLDTIKKELIQ 380

Query: 377 EKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRE 436
           E+  K+ LQ QVE F+VELE+K+P I+SFK+R   LE+EL   T  LE   +E++    E
Sbjct: 381 ERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNE 440

Query: 437 LTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSN 492
           L  L++   + +     L +QR+DLAHQ+QY+L+      D+  P + +E   ++ I+ N
Sbjct: 441 LDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDN 500

Query: 493 ENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDN 552
           E+ E  +DS ++IS+RL+ FQN+ ELQQKN+                E+ QQ T ++ + 
Sbjct: 501 ESNEESSDSQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQ 560

Query: 553 NKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLL 590
             I E AK   + L+ +   LE KI  ++ E D YK L
Sbjct: 561 QAIDE-AKEAIISLQSYNTKLEDKIKTLNDELDCYKSL 597

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope, connects the nuclear pore complex with
           the nuclear interior; involved in the Tel1p pathway that
           controls telomere length; involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1771

 Score =  191 bits (486), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 175/601 (29%), Positives = 297/601 (49%), Gaps = 38/601 (6%)

Query: 20  FFDLPGNTWESMDEHALEKIYTKAYD---LMKENSFVSAAIDDIKHVYEGKINTISQKYF 76
           F  +  N   ++D   +  I  KA +   L  EN   S  +D+++   E K+     +  
Sbjct: 22  FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 77  XXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEA 136
                        + +   + +L SEKQ+      ALN   TL +   EA+++    LE+
Sbjct: 82  LLLQELESLRGESAQFEKMKLELTSEKQR------ALNDSETL-RVRKEALEQQKQALES 134

Query: 137 RERKTENVLEQS-------KLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKK 189
            +     +L +        K E  D + EN  L++Q    E +      E      E  +
Sbjct: 135 SKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHR 194

Query: 190 LQTGMKLLRENNLYLE--IKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIAT 247
           L   + L R N+ +LE  +  K  + N   +++    + L  +L+ +  E+ +      +
Sbjct: 195 LSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKS 254

Query: 248 LKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIE- 306
           L+  N  ++ DL+ +L  +K L DNLNS KQEF +E++LK+R+ +LL  ++ S K  +E 
Sbjct: 255 LREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLEL 314

Query: 307 RLTS-----KNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFG 361
           R T+      +   P   + +EL    ++L  SE +  +L+ TV   ++ D++  +    
Sbjct: 315 RSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSA 374

Query: 362 N--PKKL------IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLE 413
           +  P  +      I +L+RQ++ EKR K+ LQ QVE+F+VELE K+PM+ SFK+RN  LE
Sbjct: 375 HEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLE 434

Query: 414 RELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI- 472
            +L      LE  +K+++    +L   + +I + E    EL RQRSDLA QVQYLL+   
Sbjct: 435 EQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQAS 494

Query: 473 ---DNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXX 529
              D+K P T +E   V++I+   +   + D+ K+IS+RL+ F+++ ELQ KN       
Sbjct: 495 VRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKN-SDLLRT 553

Query: 530 XXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKL 589
                     E+EQ K    T  N  +  AK   + L++H + LES+I ++++ERD+YK 
Sbjct: 554 IRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKA 613

Query: 590 L 590
           +
Sbjct: 614 I 614

 Score =  165 bits (417), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 148/466 (31%), Positives = 239/466 (51%), Gaps = 65/466 (13%)

Query: 1074 ESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELE 1133
            ESN  L  EV+  T+  + L  Q+ ++Q  L+PLE E+  LK  V  K+  +++  EE  
Sbjct: 1226 ESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLKRSVRAKDSQISLISEETN 1285

Query: 1134 RWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKL 1193
            RWK RSQ IL + + ++ E H K  E++   + +L     +N++L DRF RLKKQA E+L
Sbjct: 1286 RWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELEDRFQRLKKQARERL 1345

Query: 1194 DAAKTMQINLTTQINELNETKVNLE----------KSLQ---QEIEKNNQSGNGAADESE 1240
            DAAK +Q NL+ ++ +  E + N+E          K+LQ   Q +E   ++ +    E E
Sbjct: 1346 DAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRVESEAKADSTTQPELE 1405

Query: 1241 EIIR----------------------LRAELEKSNNFSNELEKKVEDAKKFKNEIESLKS 1278
              ++                      L++ELEK  + + ELE+++++A++   E+ESL+ 
Sbjct: 1406 SALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHAEELERRLDEARR---EVESLEE 1462

Query: 1279 ELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNIL 1338
              Q   A+ +S+   K+ +DL+E      + LI +                 A  +  + 
Sbjct: 1463 VKQG--AFTDSSELEKMKRDLEE----HSNTLIAEKEAEIRSHYEELRLKEKATYEKELE 1516

Query: 1339 ANGQESA-NIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLE 1397
             NG+ +  +I               +KRI E+ E L+KR+RLP+EEKIN ++E R+  LE
Sbjct: 1517 ENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELE 1576

Query: 1398 QEFETKLR--------ELGLNADGNGVVTDTRAQIEK---ELREKFNLELAEIKKKAFEE 1446
            QEFE KL+        E    A    V+   + ++EK   +L  + + E+A+++KKAF+E
Sbjct: 1577 QEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDE 1636

Query: 1447 GKQQSMMKSTLLERKLSKLESQT---------LSPTKNNDSNETQV 1483
            GKQQ+ MKS  LE+K++KLE+Q           +PT  N   E  V
Sbjct: 1637 GKQQASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSPTEKPV 1682

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
           YIL149C (REAL)
          Length = 1680

 Score =  185 bits (470), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 237/796 (29%), Positives = 388/796 (48%), Gaps = 69/796 (8%)

Query: 15  DKISSFFDLPGNTWESMDEHALEKIYTKAYDLM---KENSFVSAAIDDIKHVYEGKINTI 71
           DKIS F  +P  +   +   AL+++Y K  +     KE + ++  +D+IK  Y  +I+ +
Sbjct: 3   DKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKL 62

Query: 72  SQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEI-----TLIKY-DLE 125
           + K                  L  +++L  E+ +     DALN ++     T+ K  D E
Sbjct: 63  T-KLLNESSEEKVINSKVMNRL--QDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEE 119

Query: 126 AMQRDHTTLEARER---KTENVLEQSKLELQDSLTEN----SALKEQIGVFEGKLDSMTQ 178
             + + ++ +   R    T++VL++    LQ  L E        K      + K D+ +Q
Sbjct: 120 GAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQ 179

Query: 179 E--LWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSS 236
           E  LWL N    K  T  +L   N   L     E  K   L +       L+++L    +
Sbjct: 180 EKELWLQN----KKWTEERLSSCNQKAL---VDEVTKTSYLQN-------LEEKLNQTQT 225

Query: 237 EILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHN 296
           E  S+ +    L   N+ LS  ++ KL  IK+L D  N+ K EF+KE+TL++++N+LL +
Sbjct: 226 ENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRS 285

Query: 297 EIASYKK-----QIERLTSKNLETPEK-KIIQELVDLKEKLVNSEKECNELKSTVDKYIN 350
           ++ S+++       E+   K  + PE   + +EL+D K KL  S++EC  LK+ V   I 
Sbjct: 286 QLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIE 345

Query: 351 IDEKKLISKFGNP--KKL---IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSF 405
            +   + +    P   KL   I+ L+RQLVKE+  K  +Q Q++ F++ELE K P + SF
Sbjct: 346 ENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSF 405

Query: 406 KERNSSLERELLRITSSLEET---AKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLA 462
           KER   LE E L+ ++ L ET   AK +D  +++LT+L++KI++ E     L+RQR DLA
Sbjct: 406 KERTELLEHE-LKCSTELLETMSLAKRKD--EKKLTSLEQKINSYEANIHSLVRQRLDLA 462

Query: 463 HQVQYLLLCID----NKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKEL 518
            QV+ LL  I       SP +  E   ++K++ +ENT N+ DS  II+++L+ F+N+ EL
Sbjct: 463 RQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDEL 522

Query: 519 QQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKIN 578
           Q+KNM                E E  KT+   +N  I E AK   +++E     L  ++N
Sbjct: 523 QEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKE-AKEAIIEMESINSKLALRVN 581

Query: 579 IISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELEN 638
           I+++ERDSYKLL                     E +   L ++LSS + +   +++ L  
Sbjct: 582 ILTRERDSYKLLASANDNKTHADTEGITEATY-EKKIRELQSKLSSTRVESSAIIQNLNG 640

Query: 639 KIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKN 698
           ++ T +KSQ   K+ +++    F+  K    L+ E    L+ +I  L+  L +  L    
Sbjct: 641 QLLTYKKSQTDGKIALQE----FENFKV---LVAEKEAMLQERINHLKTQLEKQRLS--- 690

Query: 699 LITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVL 758
                V + + S + +LS +E KI  L  EISNLK +N  L     ++T        + +
Sbjct: 691 -AAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKM 749

Query: 759 QLETSLSERELPKNTQ 774
           QL   LSE E   N Q
Sbjct: 750 QLHVKLSESETSHNEQ 765

 Score =  125 bits (313), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 118/340 (34%), Positives = 177/340 (52%), Gaps = 30/340 (8%)

Query: 1072 LEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEE 1131
            L E+NA L K ++N T+ NE +  +L +MQ ++  L+  + + K +V+     +   + E
Sbjct: 1177 LRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESE 1236

Query: 1132 LERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHE 1191
            +E+ K R Q + QQ K+  +    K    I  LE +L  V+  NA L ++F+RLKKQAHE
Sbjct: 1237 IEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHE 1296

Query: 1192 KLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEK 1251
            KLDA+K  Q  LT ++NEL ETK  LE++L               +E  +++ L  +L++
Sbjct: 1297 KLDASKKQQTALTNELNELKETKDKLEENLH--------------NEESKVVDLELKLKE 1342

Query: 1252 SNNFSNELEKKVEDA--KKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDE 1309
                  E+ K  +    K F  EIESLK ELQ    + N+   S   + +K + + EK++
Sbjct: 1343 HGLQVGEVSKDHDSIAFKPFVEEIESLKKELQ---VFRNANDASDAFEKIKNNMEEEKNK 1399

Query: 1310 LIEQMXXXXXXXXXXXXXTILAQRKNNILANGQE---SANIXXXXXXXXXXXXALILKRI 1366
            +I++                L    N   +N  E   S +I               +KRI
Sbjct: 1400 IIDEKTKDFEKK--------LQDAVNKSKSNESEVENSEHIEALKKEWLKEYEEETVKRI 1451

Query: 1367 TEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE 1406
             EAEENLKKR+RLPSEE+I  +I KR+  LEQEFE KL+E
Sbjct: 1452 KEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKE 1491

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
           MLP2Myosin-like protein associated with the nuclear
           envelope, connects the nuclear pore complex with the
           nuclear interior; involved in the Tel1p pathway that
           controls telomere length
          Length = 1679

 Score =  184 bits (468), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 168/497 (33%), Positives = 265/497 (53%), Gaps = 28/497 (5%)

Query: 252 NESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQ-----IE 306
           N+ LS  ++ K+  +K+L D  +  K EF+KE+TL++ +N+LL +++ S +K      IE
Sbjct: 241 NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE 300

Query: 307 RLTSKNLETPEKK-IIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNP-- 363
           +    +   PE   +I EL+D K +L  S+ EC  L++ V      +E  + +   +P  
Sbjct: 301 KNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTV 360

Query: 364 KKL---IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRIT 420
            KL   I++L+RQL+KE+  K  LQ Q+E F++ELE K P + SFKER  SLE EL R T
Sbjct: 361 GKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRST 420

Query: 421 SSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI----DNKS 476
             LE  +  +  ++RE+T+L++KI+  E     L++QR DLA QV+ LLL      +  S
Sbjct: 421 ELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETAS 480

Query: 477 PFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXX 536
           P ++ E   ++KI+ + N  N+ DS  II++RL+ F NV ELQ+KN+             
Sbjct: 481 PLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKL 540

Query: 537 XXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXX 596
              E +Q KTL+  +N  I E AK   ++LE     +E++INI+ +ERDSYKLL      
Sbjct: 541 ENYEGKQDKTLQKVENQTIKE-AKDAIIELENINAKMETRINILLRERDSYKLLASTEEN 599

Query: 597 XXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEK 656
                          E +   L  ELSS K ++  +++ L  ++   +KSQ   K  +E 
Sbjct: 600 KANTNSVTSMEAAR-EKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLE- 657

Query: 657 HALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELS 716
              +F+  K    L KE    LE  I  L+ +L +    +K+ +   ++  ++    ELS
Sbjct: 658 ---DFENFK---GLAKEKERMLEEAIDHLKAELEK----QKSWVPSYIHVEKERASTELS 707

Query: 717 VAEQKISFLDKEISNLK 733
            +  KI  L+ EIS LK
Sbjct: 708 QSRIKIKSLEYEISKLK 724

 Score =  119 bits (298), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 119/363 (32%), Positives = 187/363 (51%), Gaps = 35/363 (9%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            + +  T++  L+E+NA L K ++N T+ N  +  QL D Q ++  L++++ + K +V+  
Sbjct: 1166 ITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSIN 1225

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEK----IKTLEEQLETVRTENAQ 1177
               + + + E+E+ K R Q + QQ K    +A  K +EK    I  L+ +L +    NA 
Sbjct: 1226 SNKILVYESEMEQCKQRYQDLSQQQK----DAQKKDIEKLTNEISDLKGKLSSAENANAD 1281

Query: 1178 LTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAAD 1237
            L ++F+RLKKQAHEKLDA+K  Q  LT ++NEL   K  LE+ L  E        N    
Sbjct: 1282 LENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFE--------NAKVI 1333

Query: 1238 ESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIK 1297
            + +   +L+A   +S + S + EK  +  +    EIESLK ELQ  K   +S   S   +
Sbjct: 1334 DLD--TKLKAHELQSEDVSRDHEK--DTYRTLMEEIESLKKELQIFKTANSS---SDAFE 1386

Query: 1298 DLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXX 1357
             LK + ++EKD +I++                 +       +  + S +I          
Sbjct: 1387 KLKVNMEKEKDRIIDERTKEFEKKLQETLNKSTS-------SEAEYSKDIETLKKEWLKE 1439

Query: 1358 XXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELG-----LNAD 1412
                 L+RI EAEENLKKR+RLPSEE+I  +I KR++ LE+EF  KL+E       L+  
Sbjct: 1440 YEDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLTFLDNK 1499

Query: 1413 GNG 1415
            G+G
Sbjct: 1500 GSG 1502

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar
           to uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  178 bits (451), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 165/508 (32%), Positives = 254/508 (50%), Gaps = 100/508 (19%)

Query: 171 GKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKE-------------------- 210
           G  D    EL     E K+LQT +K L +  L LE+KC+E                    
Sbjct: 131 GSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSELERNAQEIL 190

Query: 211 -------------TDKNKK-----------LYSSAEDASRLQDQLQI--VSSEILSLKSE 244
                        T+KN+            ++ +  +  +L+  L+I   S EILS    
Sbjct: 191 LLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSSKEILS---- 246

Query: 245 IATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQ 304
               K ++E+ +  LQ  L   KDL D L   KQEF KE+++K ++ +L  N+I S    
Sbjct: 247 ----KKLDET-TEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKS---- 297

Query: 305 IERLTSKNLETPE----------KKIIQELVDLKEKLVNSEKECNELKSTVDK------- 347
           +E    +  +T E          K + +EL   + KL + E++C  L+S +D        
Sbjct: 298 LESTLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSL 357

Query: 348 --------YINIDEKKLISKFGN----------PKKLIEILRRQLVKEKRHKDTLQRQVE 389
                   Y N        + G+           +  I+IL+RQLV+EKR K+ LQ QVE
Sbjct: 358 QTKGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVE 417

Query: 390 SFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQ 449
           SF++ELE K+P+I+SF+ER S LE+EL      LE   KE ++K  EL +L+KKIS++  
Sbjct: 418 SFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNS 477

Query: 450 FNDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTDSHKII 505
             + LLRQR+DLAHQ+QYLL+ I    DN     E E   +K +VSN+N  +  DS K+I
Sbjct: 478 QLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVI 537

Query: 506 SKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLR--ITDNNKIVESAKSTS 563
           S+ L+ F+++++LQ+KNM                E++++ T    + ++N+I   AK   
Sbjct: 538 SEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAI 597

Query: 564 VDLEKHIKTLESKINIISQERDSYKLLV 591
           + LEK  + LE  + I+++ERD++KLLV
Sbjct: 598 LTLEKVNENLEKNLQIVTKERDAFKLLV 625

 Score =  160 bits (405), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 146/438 (33%), Positives = 230/438 (52%), Gaps = 35/438 (7%)

Query: 1072 LEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEE 1131
            L ESN  L  E++      + ++  L   + +L PL+  +      + EK+  +    +E
Sbjct: 1238 LRESNVTLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDE 1297

Query: 1132 LERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHE 1191
             +RWK R + ++++ + V  + + K  E +   ++ L+    E  +L DRF+RLKKQAHE
Sbjct: 1298 SQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHE 1357

Query: 1192 KLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNN--------------------QS 1231
            KL+ +K +Q +L  QI+ L   K ++ K L  + E+N+                    + 
Sbjct: 1358 KLNTSKELQSSLQEQISNLISEKDDIRKQLDVKTEENSELLSELNNFREKQNDLETLREE 1417

Query: 1232 GNGAADESEEI-IRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSEL--QSVKAYEN 1288
             N    +SEE+ ++L+ E+E S+  S    K++E+ +K    I+ LK++L   S  A E 
Sbjct: 1418 LNKEISKSEELEVKLQNEIESSSLASRNTNKEIEELQKV---IDDLKTQLAANSTDADEQ 1474

Query: 1289 STVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIX 1348
            +  N   ++ +K  F+ +K + I +               I  + + N   + + + ++ 
Sbjct: 1475 TNRN---VEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVE 1531

Query: 1349 XXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKL---- 1404
                        LI KRI EAE+NLKKR+RLPSEEKIN +IEKRR  LE EF+ K+    
Sbjct: 1532 ALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKA 1591

Query: 1405 RELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSK 1464
            R+L +N   N    + +  +EKEL+E+F  EL   +KKAFEEGKQQ+ MK+TLLERK+ K
Sbjct: 1592 RDLLMNDHSNEFNNELKEALEKELKERFEDELQAARKKAFEEGKQQATMKTTLLERKIQK 1651

Query: 1465 LESQTLSPTKNNDSNETQ 1482
            LESQ     K  DS ETQ
Sbjct: 1652 LESQI--QEKEKDSEETQ 1667

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1748

 Score =  177 bits (448), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 148/430 (34%), Positives = 242/430 (56%), Gaps = 33/430 (7%)

Query: 189 KLQTGMKLLRENNLYL--EIKCKETDKNKKLYSSAEDASRLQD-QLQI--VSSEILSLKS 243
           +++  + LLRENN +L  ++  K    N+   S+    S LQD QL++  + SE+   ++
Sbjct: 185 RMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTI---SELQDSQLKVSNMESELEIART 241

Query: 244 EIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKK 303
               LK    SL   L++KL   K++ D  N SKQE  KE++LKQR+ + L   + S KK
Sbjct: 242 SNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKK 301

Query: 304 QIERLTSKNLETP------EKKIIQELVDLKEKLVNSEKECNELKSTVDKY---INIDEK 354
           +++  T  N+++         ++I+EL  +K +L  SE  C +LK T+D+    I +++ 
Sbjct: 302 EMD-ATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDS 360

Query: 355 KLISKFGNPKKLIEI----------LRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDS 404
           ++ +   + +K + +          L++QLV EKR KD L+ QVE+F+VELE K+P+++S
Sbjct: 361 EVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNS 420

Query: 405 FKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQ 464
           FKER+  LEREL  +T  LE T K+RD K  +L  L+  + + E     L +QR DLAHQ
Sbjct: 421 FKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQ 480

Query: 465 VQYLLLCIDNKS----PFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQ 520
           +QYLL+    KS    P + +E   VK + +++     +D+  II+ RL+ F++V ELQQ
Sbjct: 481 IQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQ 540

Query: 521 KNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINII 580
           KN                 E E +  +++ ++  + E AK T + L  H + LE+++ I+
Sbjct: 541 KNSELLSTIRNLADELERREAENKSQIQVLEDETVRE-AKETILTLHDHAQNLENQLVIL 599

Query: 581 SQERDSYKLL 590
           S+ERD+YK L
Sbjct: 600 SKERDAYKAL 609

 Score =  132 bits (331), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 142/489 (29%), Positives = 235/489 (48%), Gaps = 71/489 (14%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            +M+   +L  L ESN  L  E  +  K  + L SQL +   +L PL+  I+ L+  +  K
Sbjct: 1203 IMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIK 1262

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKI-------KTLEEQLETVRTE 1174
            EQ L   +EE ERWK RSQ IL + + ++ E H K  E+I       +T ++ L++V  E
Sbjct: 1263 EQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAE 1322

Query: 1175 NAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVN--------------LEKS 1220
                  +F R++ QA ++L+A+K  + +L+++IN++NE K                LE+ 
Sbjct: 1323 KDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEER 1382

Query: 1221 LQ---QEIEKNNQSGNGAADE-SEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESL 1276
            LQ   QE E   Q+ N    +  E++  ++ ++E ++          E  K     +E L
Sbjct: 1383 LQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTETVEML 1442

Query: 1277 KSELQSVKA-----------YENSTVNS---KIIKDLKESFKREKDELIEQMXXXXXXXX 1322
             S++Q ++A           +    +N     I+ +LK  F+ EK++LI+          
Sbjct: 1443 NSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSKF 1502

Query: 1323 XXXXXTILAQR--------------------KNNILANGQES--ANIXXXXXXXXXXXXA 1360
                 +    R                    K  + +  Q +   +I             
Sbjct: 1503 EAEKESAWNSREEELRKQFEEREKRIREECEKTTVQSPSQPTLDIDIDALKNEWEKEYEK 1562

Query: 1361 LILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELG--LNAD-GNGVV 1417
              L++I  AEE LKKR+RLP+++KI+ ++E R+ VLE+ FE K+ E    L  + GN  +
Sbjct: 1563 QTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAI 1622

Query: 1418 T--DTRAQ---IEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ--TL 1470
            T    RA+   ++  +R++F  +LAEIK+K+FEEGKQQ  +K   LE K+  LE Q  T+
Sbjct: 1623 TLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKSTI 1682

Query: 1471 SPTKNNDSN 1479
             P +N+ SN
Sbjct: 1683 KPVENDTSN 1691

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  177 bits (449), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 167/496 (33%), Positives = 255/496 (51%), Gaps = 91/496 (18%)

Query: 1045 SFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKL 1104
            S V+ D++S        +ME   +L  L ESN  L  E+ENC+K N+ L S+L  ++  +
Sbjct: 1193 SRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEII 1252

Query: 1105 EPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTL 1164
             P+E E++ LK  + EKEQ + + +EE+ RWK RSQ IL++ + +    + K   ++++L
Sbjct: 1253 APIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESL 1312

Query: 1165 EEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQ-- 1222
            + QLE    +  +  +RF+RL++QA EKL  +K  Q  LT Q+NEL + KV LE+SL   
Sbjct: 1313 KAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDA 1372

Query: 1223 ----QEIEKNNQSGNGAADE---SEEIIRLRAELEKSNNFSNELEKKVED--------AK 1267
                QE+E     G   A++   SE I R + + EKS   S ELE+K+E+         +
Sbjct: 1373 NTRIQELE-----GEKVAEDNNRSEMIKRSQEDAEKS---SRELEEKLEENAISYSSTVR 1424

Query: 1268 KFKNEIESLKSE----------LQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXX 1317
            K   EI +LK E          LQ+   + +  + S I++ +K+SF+ +K + IE+    
Sbjct: 1425 KLNEEIATLKEEIEKQGQIQKQLQTAAGHRDEDL-SNIVESMKKSFEEDKIKFIEEKTRE 1483

Query: 1318 XXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRM 1377
                         AQ +     N   S NI              + +R+ EAEE LKKR+
Sbjct: 1484 VNKKIQE------AQER----LNQPSSVNIDEMKKQWEAEHEEEVAERVREAEEALKKRI 1533

Query: 1378 RLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVV-------------------- 1417
            RLP+EEKI+ +IE++++ LE+EF  KL E   +  G+  +                    
Sbjct: 1534 RLPTEEKISKIIERKKEDLEKEFNEKLEEKVKSISGSEQMEAMLQKQLEIRVQEKQKELE 1593

Query: 1418 -------------------------TDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSM 1452
                                      + RA+IE +LRE+ N EL  +KKK+FEEGKQQ+ 
Sbjct: 1594 DEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKKSFEEGKQQAT 1653

Query: 1453 MKSTLLERKLSKLESQ 1468
            MK+TLLERKL+K+ESQ
Sbjct: 1654 MKTTLLERKLAKMESQ 1669

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  173 bits (439), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 159/486 (32%), Positives = 240/486 (49%), Gaps = 88/486 (18%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            VME   +L  L ESN  L  E+++    N+ L S+L  ++  + P+E E+  LK  + EK
Sbjct: 1210 VMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAALKFSIQEK 1269

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181
            EQ + + +EE+ RWK RSQ I+++ + +    + K   +I++L+ QLE    + A   ++
Sbjct: 1270 EQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQQGADSEEK 1329

Query: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEE 1241
            F+RL++QA EKL A+K  Q +   Q+NEL + K+ LEKSL      NN +      E  +
Sbjct: 1330 FNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSL------NNANARIQELEDAK 1383

Query: 1242 IIRLRAEL-------EKSNNFSNELEKKVED--------AKKFKNEIESLKSELQSVKAY 1286
            +   R +L       E +   S ELE K+E+         KK   EI  LK EL+  +  
Sbjct: 1384 VAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVKKLNEEIGILKEELEKQRQI 1443

Query: 1287 ENSTVN---------SKIIKDLKESFKREKDELIE----QMXXXXXXXXXXXXXTILAQR 1333
            +              SK+++ +K SF+ +K + IE    ++                  +
Sbjct: 1444 QQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREVNQKIREFQEAQEAEETGLK 1503

Query: 1334 KNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRR 1393
             +NI        NI              + K+I EAEE LKKR+RLP+EEKI+ +IE+++
Sbjct: 1504 PSNI--------NIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKK 1555

Query: 1394 KVLEQEFETKLRELGLNADGNGVVTDT--------------------------------- 1420
            + LE+EF+ K+ E   +   +G + D                                  
Sbjct: 1556 EDLEKEFDEKVEERLKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPS 1615

Query: 1421 ------------RAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ 1468
                        RA IE +LRE+FN EL  IKKK+FEEGKQQ+MMK+TLLERKL+K+ESQ
Sbjct: 1616 SDIISSDDKDKLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQ 1675

Query: 1469 TLSPTK 1474
             LS TK
Sbjct: 1676 -LSETK 1680

 Score =  161 bits (408), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 180/626 (28%), Positives = 316/626 (50%), Gaps = 60/626 (9%)

Query: 1   MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAY---DLMKENSFVSAAI 57
           M +   +E T   ++ I+SFFD      +S+D   +  +  K     +L  EN  ++  +
Sbjct: 8   MRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTL 67

Query: 58  DDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEI 117
           D++K     KIN++  +               +      E +  EK         L++E+
Sbjct: 68  DELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKT-------HLSNEL 120

Query: 118 TLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQ-------DSLTENSALKEQIGVFE 170
             IK  L  +  +   +++ +++T  +L++   EL+        S +E   L+  I   E
Sbjct: 121 ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180

Query: 171 GKLDSMTQELWLANTENKKLQ-----TGMKLLRENNLYLEIKCKETDKNKKLYSSAEDA- 224
            K     Q+ +++N  N K Q       + LL+ N  +LE +   + KN++  S  +   
Sbjct: 181 TK-----QQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKEL--SSKNQQYLSYRQKTN 233

Query: 225 ---SRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFA 281
              S +++ L  + ++    K+    L+  N  LS DLQ KL +IK L D+ NS K++F+
Sbjct: 234 TIISEIRNDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFS 293

Query: 282 KEITLKQRVNELLHNEIASYKKQIERL-----------TSKNLETPEKKIIQELVDLKEK 330
            EITLKQR+ +LL +++ + K+++               SK L +  +K++++L   K K
Sbjct: 294 AEITLKQRLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHK 353

Query: 331 LVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVES 390
           LV  E EC  L S++ +    ++  L SK         +L++QL+KEKR K+ LQ Q+ES
Sbjct: 354 LVQCENECLRL-SSITEEAGKEDGILTSKSNGD---FILLKKQLIKEKRAKEHLQNQIES 409

Query: 391 FLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQF 450
           F+VELE K+P+I+SFKER  +LE EL      LE T+ E++ K +EL    +K++   ++
Sbjct: 410 FIVELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLA---EY 466

Query: 451 NDE---LLRQRSDLAHQVQYLL----LCIDNKSPFTEKEATLVKKIVSNENTE-NDTDSH 502
            DE   L +QR DL  Q+QYLL    +  D+K P  ++E   ++ I+ N+++   ++DS 
Sbjct: 467 KDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQ 526

Query: 503 KIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKST 562
           KI+++RL+ F+++ +LQ+KN                 E + +  L+  +N  I E AK  
Sbjct: 527 KIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINE-AKEA 585

Query: 563 SVDLEKHIKTLESKINIISQERDSYK 588
            + L+     LESKI+ + +ER+ +K
Sbjct: 586 ILTLQSQKVQLESKIHELEKEREKFK 611

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
           YIL149C (REAL)
          Length = 1682

 Score =  169 bits (428), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 248/885 (28%), Positives = 430/885 (48%), Gaps = 80/885 (9%)

Query: 15  DKISSFFDLPGNTWESMDEHALEKIYTKA--YDLMKEN-SFVSAAIDDIKHVYEGKINTI 71
           DKIS F  +P  + + ++   L K++ K   ++  +E  + ++  +D+IK  Y  +I+ +
Sbjct: 3   DKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRISKL 62

Query: 72  SQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDH 131
           S K                 +L  +++L+ ++++     DALN ++   +   +A++R +
Sbjct: 63  S-KLLNESSEQKNIASKELSHL--QDQLMQDRERCRRKIDALNKQLDSSR---DAIKRLN 116

Query: 132 TTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQ 191
              +A+E   E+++ QSK +  +S+   + L ++  +   KL  M   L +  + +  LQ
Sbjct: 117 DEKDAKE---ESMIRQSKHQNVNSV--QNVLDKENKLLRRKLMEMENILQICKSNSVSLQ 171

Query: 192 TGM-KLLRENNLYLEIKCKETDK-----NKKLYSSAEDASR---LQDQLQIVSSEILSLK 242
                +++E  L L+ K    +K     NK L   +  ASR   L+++L    ++  S  
Sbjct: 172 LKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESAL 231

Query: 243 SEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYK 302
           S    L   N+ LS  ++ K+  IK+L D     K EF+KE+TL++ +N+LL +++AS++
Sbjct: 232 SYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFE 291

Query: 303 K-----QIERLTSKNLETPEKK-IIQELVDLKEKLVNSEKECNELKSTVDKYI-----NI 351
           +     +I +      + P+   +  EL++ K +   S+ EC  L++ +  ++      +
Sbjct: 292 RDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATV 351

Query: 352 DEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSS 411
           D        G     I++LR+QL+KE+  K  LQ Q+E F++ELE K P + SFKER  S
Sbjct: 352 DTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKS 411

Query: 412 LERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLL- 470
           LE EL R T  LE  +  +   +RELT+L++KI++ E     L++QR DLA QV+ LLL 
Sbjct: 412 LEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLN 471

Query: 471 --CIDNKS-PFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXX 527
              I   + P ++ +   ++KI+ + +  N+ D+  IIS+RL+ F N+ ELQ+KN+    
Sbjct: 472 TSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLY 531

Query: 528 XXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSY 587
                       E ++  TL   +   I E AK   ++LE     +ES+INI+ +ERDSY
Sbjct: 532 CIRTLADKLEFHEGKKDTTLAEVEKQTIKE-AKDAIIELENTNMKMESRINILLRERDSY 590

Query: 588 KLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQ 647
           KLL                     +  KE L  ELSS K +   V++ L  ++ T +K  
Sbjct: 591 KLLASSKENNVNVNAKNFTEISHEKKIKE-LEAELSSTKVESSAVIQNLRKELTTYKKLL 649

Query: 648 LTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNL 707
              K+  +    +F+  K    L KE    LE ++  L+ DL + +L   + +    N +
Sbjct: 650 CDKKIASQ----DFENFK---MLAKEKESILETRVNNLKTDLEKQKLSVPSFVQD--NKV 700

Query: 708 EQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNL--LDNKVLQLETSLS 765
             S   EL  +  K   L  EIS+LK +  N    +L  +L+++L     + +QL+  L 
Sbjct: 701 RDS--TELLQSRTKTEILMHEISSLKKETAN--SMVLKESLTRDLERCCKEKIQLQMKLK 756

Query: 766 ERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRREL 825
           E E+  N Q  N + +  K   Y    K+LE            E+LE L+ + ++  +E+
Sbjct: 757 ESEISLNEQKVNFDSKGIK---YDARIKQLE------------ESLERLRIELKSKAQEI 801

Query: 826 KEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQK 870
           K +Q   D    S LK        +N +     KL SV T L +K
Sbjct: 802 KSLQSSKD----SQLKW------AQNTIDDTEEKLKSVLTELSRK 836

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  166 bits (420), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 168/522 (32%), Positives = 261/522 (50%), Gaps = 90/522 (17%)

Query: 1032 ARYRNKNPR---EKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTK 1088
            AR +  N R   EK P+ ++             +ME   +L  L ESN  L  E+EN  +
Sbjct: 1181 ARTKLDNSRLEEEKRPTIIQ---------QHEDIMEKLNQLNLLRESNITLRNELENNNE 1231

Query: 1089 VNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKI 1148
                L S+L  ++  + P+E E+  LK  + EKEQ L + +EE+ RWK RSQ IL++ + 
Sbjct: 1232 EKRVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQ 1291

Query: 1149 VEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQIN 1208
            +    + K   +I +L+ +L+    + A+  +RF+RL++QA E+L  +K     LT Q+N
Sbjct: 1292 MSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVN 1351

Query: 1209 ELNETKVNLEKSLQQEIEKNNQSGNGAADES----EEIIRLRAELEKSNN-FSNELEKKV 1263
            +L   K+ LEKSL     K  +  N  A++     + I RL+ + E S+  F  +LE+K 
Sbjct: 1352 DLKNAKIKLEKSLDDANTKIEELENAKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKA 1411

Query: 1264 ----EDAKKFKNEIESLKSE----------LQSVKAYENSTVNSKIIKDLKESFKREKDE 1309
                   KK   EI +L+ E          LQS  A E + + SKI++ +K++F+ +K  
Sbjct: 1412 TFYDSTIKKLNEEIITLREEIEKQRRIQQQLQSEPANEQNDL-SKIVESMKKTFEEDKIN 1470

Query: 1310 LIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEA 1369
             I +               + AQ + N  +N     NI              ++ RI EA
Sbjct: 1471 FIRE------KTKEVNEKILEAQERLNQPSN----INIDELKIKWKAEHEEEVVNRIREA 1520

Query: 1370 EENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE----------------------- 1406
            EE LKKR+RLP+EEKI+ +IE++R+ LE+EF+ K+ E                       
Sbjct: 1521 EEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRI 1580

Query: 1407 --------------LGLNADGNGVVTD----TRAQIEKELREKFNLELAEIKKKAFEEGK 1448
                          L   +  N +  D     RA+IE ++R++ + EL  IKKK+FEEGK
Sbjct: 1581 QEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGK 1640

Query: 1449 QQSMMKSTLLERKLSKLESQ-------TLSPTKNNDSNETQV 1483
            QQ+MMK+TLLERKL+K+ESQ       T SP+K+ +  + Q+
Sbjct: 1641 QQAMMKTTLLERKLAKMESQLSETKKITESPSKHVNHTQNQL 1682

 Score =  160 bits (406), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 127/354 (35%), Positives = 207/354 (58%), Gaps = 21/354 (5%)

Query: 252 NESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSK 311
           N+ LS  LQ KL  IK L D L+S KQEF+ EI LKQR+ +LL +++ + K++++  +++
Sbjct: 264 NDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELD--STR 321

Query: 312 NLETP---------EKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGN 362
            LET          ++ +++EL   KE+L   + EC  L S + +    DE+   S   +
Sbjct: 322 GLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGE---TDEESGSSTSRS 378

Query: 363 PKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSS 422
               I +L++QL+KEKR K+ LQ Q+ESF++ELE K+P+I+SFKER  +LE EL      
Sbjct: 379 SSDFI-LLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTLENELNNAALL 437

Query: 423 LEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLL----CIDNKSPF 478
           LE T+ E++ K REL+   +K+   E     L++QR DL  QVQYLL+      D+K P 
Sbjct: 438 LEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSKDSKGPL 497

Query: 479 TEKEATLVKKIVSNE-NTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXX 537
            ++E   ++ I+ N+ +T  +TDS KI+++RL+ F+++ ELQ+KN               
Sbjct: 498 RKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLKIVRNLADRLE 557

Query: 538 XXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLV 591
             E E +++L+  ++  I E AK   + L+   + LESK+  + +E ++ K L+
Sbjct: 558 SNENESKQSLQKIESETINE-AKEAILTLKAEKEQLESKVEELEKECENSKALL 610

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1674

 Score =  162 bits (409), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 137/447 (30%), Positives = 247/447 (55%), Gaps = 34/447 (7%)

Query: 160 SALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYS 219
           S + ++I   + +L+    E  ++ +E ++     +L+RE+N +LE    +T   ++L +
Sbjct: 97  SNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKT--TEELMT 154

Query: 220 SAEDASRLQDQLQIVSSEILSLKSEIATLK-------YMNESLSTDLQRKLFRIKDLDDN 272
             +   +++++ Q    EI +L+ E++ LK         N+ LS ++Q KL  IK   D+
Sbjct: 155 QKQSILKMEEKDQ----EIDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDD 210

Query: 273 LNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPE-KKIIQELVDLKEKL 331
            ++ +QEF  EI LK R+N  L  ++   +++       N    E +KI+++L+D +++L
Sbjct: 211 YSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKSIQNEDNTSRAESQKIMEQLIDTRKQL 270

Query: 332 VNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESF 391
            +S  EC  LKS V+++IN          G       +L+++L+K K  KD L+ QVE+F
Sbjct: 271 KDSRNECTRLKSYVNEFIN-------DVNGEYSSSSSLLKKELLKVKEQKDYLETQVENF 323

Query: 392 LVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFN 451
           + ELE K+P+IDS +++N  LE+EL  +TS ++  + ER+  ++E  + ++K  +N+   
Sbjct: 324 ITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQSFKRKSEHNDGMI 383

Query: 452 DELLRQRSDLAHQVQYLLLCIDNKSP----FTEKEATLVKKIVSNENTENDTDSHKIISK 507
             L  QRSDLAHQ+Q+LLL +  ++      ++ E   ++++  N+    + DS  IIS+
Sbjct: 384 QTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARNNDSQSIISE 443

Query: 508 RLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKI----VESAKSTS 563
           RLL F ++ ELQ++NM                  E+Q+ LR  D++ I    +E AK   
Sbjct: 444 RLLKFADITELQKQNMDILATVRHLAGQL-----EEQEKLRQADHHTIERKTLEEAKKAL 498

Query: 564 VDLEKHIKTLESKINIISQERDSYKLL 590
           +DL+++  +LE K+    +ERD YKLL
Sbjct: 499 LDLQEYTNSLERKLETFRKERDVYKLL 525

 Score =  147 bits (372), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 149/478 (31%), Positives = 245/478 (51%), Gaps = 33/478 (6%)

Query: 1072 LEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEE 1131
            L E+N  L+ EV      N  L+ +L+ ++    PL+ + N  +    EK+Q +++ ++E
Sbjct: 1092 LRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDE 1151

Query: 1132 LERWKLRSQTIL-QQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAH 1190
            +ERWK R Q ++ +Q   +  EA+ K+  +I +L+  +E    E  +L+++F  LKKQAH
Sbjct: 1152 IERWKKRWQQMVHRQDDTLGLEANFKN--EIDSLKGLIEERTKEKEKLSEKFQLLKKQAH 1209

Query: 1191 EKLDAAKTMQINLTTQINELNETKVNLEKSLQQ------EIEKNNQSGNGAADESEEIIR 1244
            EKLDA K     L   ++E+  + + LE+ +++      EIE   +      D+ E+++ 
Sbjct: 1210 EKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKENLEKFDKDEKLVS 1269

Query: 1245 LRA--ELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKES 1302
             +   E E   N +  + +K+ +      E+ SL+ E+  ++  ++ T  +++I  +K  
Sbjct: 1270 EKTFKENEAKLNKTITMLQKLNET--LNQEVVSLREEINVLRKKDDET--NQLISTMKLD 1325

Query: 1303 FKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALI 1362
            F+REKD LIE+               +L+++  N+  N    +N+               
Sbjct: 1326 FEREKDRLIEEKVRELNEKFESGRNEVLSKQSENV-TNDNTGSNVDKLKQELRKDWEEQT 1384

Query: 1363 LKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE---LGLNADGNGVVTD 1419
            L+RI EA+ENLK+ +RLPSEEKI  +IEKRR  LE +F+ ++ E   L   AD   +  D
Sbjct: 1385 LQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSPD 1444

Query: 1420 -----TRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTL---- 1470
                  R ++E  + +    +L  I+ KAFEEGK+Q+ MK+TLLERKLSKLESQ      
Sbjct: 1445 ELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVAKDNE 1504

Query: 1471 --SPTKNNDSNETQVXXXXXXXXXXXXXXXXGEKVLQLNYGANVVAETD--NDDNPFT 1524
              S  + + S  T++                 E VL+L   A V +  D  ND NPFT
Sbjct: 1505 SGSKVRKSISGLTKIDVNSPQLYKDNTGTRT-EAVLKLRPTAKVDSGKDVSNDSNPFT 1561

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
           MLP1Myosin-like protein associated with the nuclear
           envelope, connects the nuclear pore complex with the
           nuclear interior; involved with Tel1p in telomere length
           control; involved with Pml1p and Pml39p in nuclear
           retention of unspliced mRNAs
          Length = 1875

 Score =  160 bits (405), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 160/544 (29%), Positives = 282/544 (51%), Gaps = 53/544 (9%)

Query: 14  IDKISSFFDLPGNTWESMDEHALEKIYTKAY---DLMKENSFVSAAIDDIKHVYEGKINT 70
           ++ I+SFF       +S D   ++ +  K     +L  EN  V+ + D++K     KI+ 
Sbjct: 21  LNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDG 80

Query: 71  ISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRD 130
           +  +               +   V  E + +EK K       L+SE+  +K  L+ +  +
Sbjct: 81  LKTEMENVIRENDKIRKERNDTFVKFESVENEKMK-------LSSELEFVKRKLDDLTEE 133

Query: 131 HTTLEARERKTENVLEQS-------KLELQDSLTENSALKEQIGVFEGKLDSMTQELWLA 183
               ++ +++T  +L++        ++E   S +E   L+  I   E K     Q+ ++ 
Sbjct: 134 KKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETK-----QQGYIT 188

Query: 184 NTENKKLQTGMK-----LLRENNLYLEIKCKETDKNKKLYSSAEDASR----LQDQLQIV 234
           N  N + +   K     LL+ NN +LE + +   KN++  S  +   +    ++++L  +
Sbjct: 189 NDLNSRTELERKTQELTLLQSNNDWLEKELR--SKNEQYLSYRQKTDKVILDIRNELNRL 246

Query: 235 SSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELL 294
            ++    ++    LK  N  LS  LQ KL  IK L D+LNS KQEF+ E++LKQR+ +LL
Sbjct: 247 RNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLL 306

Query: 295 HNEIASYKKQIERLTSKNL----------ETPEKK-IIQELVDLKEKLVNSEKECNELKS 343
            +++ + K+++  +   N           +TPE + +++EL   KEKL   EKEC  L S
Sbjct: 307 ESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRLSS 366

Query: 344 TVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMID 403
             D+  + D + L +K  +       L++QL+KE+R K+ LQ Q+E+F+VELE K+P+I+
Sbjct: 367 ITDE-ADEDNENLSAKSSSD---FIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIIN 422

Query: 404 SFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAH 463
           SFKER   LE EL      LE T+ E++ K +EL    +K+   E     L +QR DL  
Sbjct: 423 SFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCR 482

Query: 464 QVQYLLL----CIDNKSPFTEKEATLVKKIVS-NENTENDTDSHKIISKRLLHFQNVKEL 518
           Q+QYLL+      D+K P  ++E   ++ I+  +++T  ++DS K++++RL+ F+N+ +L
Sbjct: 483 QIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQL 542

Query: 519 QQKN 522
           Q+KN
Sbjct: 543 QEKN 546

 Score =  153 bits (387), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 158/481 (32%), Positives = 249/481 (51%), Gaps = 84/481 (17%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            +ME   +L  L ESN  L  E+EN     + L S+L  ++  + P+E E+  LK  + EK
Sbjct: 1209 IMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTALKYSMQEK 1268

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181
            EQ L + +EE+ RWK RSQ IL++ + +    + K   +I+ L+E+LE    + A+  ++
Sbjct: 1269 EQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKERQGAEAEEK 1328

Query: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQ---EIE--KNNQSGNGAA 1236
            F+RL++QA E+L  +K  Q +LT Q+N L + K  LE SL +    IE  +N +   G  
Sbjct: 1329 FNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVAQGN- 1387

Query: 1237 DESEEIIRLRAELEKSNNFSNELEKKVEDA--------KKFKNEIESLKSELQ------- 1281
            ++ E I +L+ + EK+   S EL+ K+E++             EI +LK E++       
Sbjct: 1388 NQLEAIRKLQEDAEKA---SRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQRQIQQ 1444

Query: 1282 ---SVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNIL 1338
               +  A E + + S I++ +K+SF+ +K + I++               + AQ + N  
Sbjct: 1445 QLQATSANEQNDL-SNIVESMKKSFEEDKIKFIKE------KTQEVNEKILEAQERLNQP 1497

Query: 1339 ANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVI--------- 1389
            +N     N+              + ++I EAEE LKKR+RLP+EEKIN +I         
Sbjct: 1498 SN----INMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEK 1553

Query: 1390 -------------------------------EKRRKVLEQEFETKLRELGLNADGNGVVT 1418
                                           ++++K LE E+  KL+E   +   +  ++
Sbjct: 1554 EFEEKVEERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHIS 1613

Query: 1419 DT-----RAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPT 1473
            D      RA+IE  LRE+FN EL  IKKK+F+EGKQQ+MMK+TLLERKL+K+ESQ LS T
Sbjct: 1614 DDERDKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQ-LSET 1672

Query: 1474 K 1474
            K
Sbjct: 1673 K 1673

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  153 bits (386), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 147/437 (33%), Positives = 229/437 (52%), Gaps = 72/437 (16%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            ++E  T+L  L+E N +L +E+    + N  L  QL +   +L+PLE +I+EL + + +K
Sbjct: 826  LIEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDK 885

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181
            +  +N+  E+ E WK R   +    K  + E  +        L++Q+E    EN +L+DR
Sbjct: 886  DNIINVSNEKAENWKTRFNELTLSAKNNDNEDLI-------NLQKQVEEKSKENEELSDR 938

Query: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEE 1241
            F+RLKKQA+E+L A+K  Q NLT Q NEL     +LE++L +++E+  +  N  + + +E
Sbjct: 939  FNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQE 998

Query: 1242 II-------RLRAELEKSNNFSNELEKKVEDAKK----FKNEIES----LKSELQSVKAY 1286
            +        +L   L+KS  F  EL K V +++      KNEIES    LKS+  SV   
Sbjct: 999  LGSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKLKSKESSVGLQ 1058

Query: 1287 ENSTVNSK--IIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQES 1344
            E+   N+K  +I +L+E   + K EL                  +  + +  +L    E 
Sbjct: 1059 ESEIENAKKILIAELEEKLNKTKSEL-----------------DLKHKEELKVLKTEYEG 1101

Query: 1345 ANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKL 1404
                             I KR+ EAEE LK+++RLPSEEKIN +IE +   LE++++ KL
Sbjct: 1102 D----------------IQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKL 1145

Query: 1405 RELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSK 1464
                        V+     IEK ++++F   L   KKKAFEEGKQQ+ MK+  LE K++K
Sbjct: 1146 E----------TVSAESTDIEK-IKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAK 1194

Query: 1465 LESQTLSPTKNNDSNET 1481
            LESQ     +NN+S+ T
Sbjct: 1195 LESQ----LQNNESDVT 1207

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 112/214 (52%), Gaps = 20/214 (9%)

Query: 379 RHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLR---ITSSLEETAKERDIKDR 435
           +  + L+  ++++L ELEQ+LP+I++FK    +L+  L +   I  SL+   KE    + 
Sbjct: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKE----NL 264

Query: 436 ELTNLQKKISNNEQFNDELLR-QRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIV 490
           +L +  KK  N +  + E L  QR+DLAHQ+QYLL+      DN  P ++ E   ++ ++
Sbjct: 265 KLMDSMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLI 324

Query: 491 SNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRIT 550
           + +     +D   +IS RL+ F+++  LQ+KNM                E E + +    
Sbjct: 325 NKDKQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENY 384

Query: 551 DNNKIVESAKSTSVDLEKH-------IKTLESKI 577
           DN+ I E AK T + L+++       I TL+SKI
Sbjct: 385 DNDTINE-AKETILSLQEYNNVLKLEIGTLQSKI 417

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  135 bits (340), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 127/369 (34%), Positives = 192/369 (52%), Gaps = 53/369 (14%)

Query: 1120 EKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRT------ 1173
            E +Q +   Q+E E+WKL  Q + +            +  +I+ L++QLET +       
Sbjct: 1118 EWQQKIETYQQESEKWKLMCQQMSE-----------NTATEIQNLQQQLETFKADIQLKT 1166

Query: 1174 -ENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSG 1232
             EN  L DRF RLKKQAHEKL+A+K    +L  +++EL      L++ L      NNQ  
Sbjct: 1167 QENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKL------NNQET 1220

Query: 1233 NGAADESEE--IIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENST 1290
            N    ES    I++L+ E +++ +   EL   V+ ++K    I  +  EL ++K  EN  
Sbjct: 1221 NSVDSESNAALILQLKEENKQAKSLELELRHSVDSSEKL---IADMTKELTTLK--ENPI 1275

Query: 1291 VNSKIIKD-------LKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQE 1343
              S  ++D       LK  F+ EK  LIE+                  + K  ++ N   
Sbjct: 1276 QGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTER--------FEREKKELMNN--- 1324

Query: 1344 SANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETK 1403
            +AN+               L+RI EA+ENLKK +RLP+EEKI  VI KR+  LE++F+TK
Sbjct: 1325 NANLEELRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTK 1384

Query: 1404 LRELGLNADGNGVVTDTRAQIEKELREKFNLELAE----IKKKAFEEGKQQSMMKSTLLE 1459
            + E       + +   T  ++EKE+RE+    L E    +KKKAFEEG+QQ+ MK+TLLE
Sbjct: 1385 VAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLE 1444

Query: 1460 RKLSKLESQ 1468
            RK++KLE++
Sbjct: 1445 RKIAKLEAR 1453

 Score =  117 bits (293), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 93/309 (30%), Positives = 162/309 (52%), Gaps = 23/309 (7%)

Query: 223 DASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQR-------KLFRIKDLDDNLNS 275
           D  R   Q+ ++  ++    SEI  L+  N +L   L+R       K    K L D L+S
Sbjct: 147 DFQRDDRQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSS 206

Query: 276 SKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVD-LKEKLVNS 334
            + +F +E+  + ++N +L       KKQ+  L S+     E     E  D   ++    
Sbjct: 207 QRHDFERELATRDKLNAVL-------KKQVNSLHSELGNGGETPAHAEPNDQFAKQSSQH 259

Query: 335 EKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVE 394
           E+E +  K  V++ + I         G     I  LR+ L+KE++   +L++Q+ESF++E
Sbjct: 260 EEEISNYKEQVEELLGI--------LGQGAPSIAHLRKLLLKERKENVSLKKQMESFVIE 311

Query: 395 LEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDEL 454
           LE +LP +   +++N  ++++L   T+ + E +K +    REL++ ++K+ +  Q   +L
Sbjct: 312 LEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKL 371

Query: 455 LRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQN 514
             QRSDLAHQ+Q+LL    + +     E + +K I+ NEN +   DS +I+S RLL F N
Sbjct: 372 RVQRSDLAHQIQFLLTVNSSDTVLPPSELSFIKTIIENENWDAYKDSQRIVSDRLLRFDN 431

Query: 515 VKELQQKNM 523
           + ELQ++NM
Sbjct: 432 IPELQEQNM 440

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1820

 Score =  133 bits (335), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 168/629 (26%), Positives = 295/629 (46%), Gaps = 98/629 (15%)

Query: 3   TDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLM--------------K 48
           ++S N    +I+ +ISS  D+P           LEK++T  YDL+               
Sbjct: 22  SNSENRHDSTILLQISSILDVP-----------LEKLHTTDYDLILAVKDKLDELRNSKD 70

Query: 49  ENSFVSAAIDDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFD 108
           +++ VS  I++++ + + K+ ++  K               +GY           + +F+
Sbjct: 71  QSNVVSNDINELQTLADNKLTSLGGKLATVETEKKELIDKVNGY-----------ETQFN 119

Query: 109 ----SNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKE 164
                N+ LN +++ +  +LE  + +    E    K   V     L +++S  E   LK+
Sbjct: 120 ELKIKNEGLNLKVSNLNIELENWKNNSNNFETE--KLNYVXXXXXLSIRES--EIQRLKQ 175

Query: 165 QIGVFEGKLDSMTQELWLANTE--NKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAE 222
           ++        S++++ WL   E  NK      KLL E NL           N  +     
Sbjct: 176 EVTFLNENKSSLSEQ-WLKEKEEFNK-----AKLLLEKNL----------NNSTI----- 214

Query: 223 DASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAK 282
                  +L+  ++ + S++++++ L   N  L+   +  ++ IK+L DNL  +K +  K
Sbjct: 215 -------KLEEATTTLKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNK 267

Query: 283 EITLKQRVNELLHNEIASYKKQIER---LTSKNLETPE--------KKIIQELVDLKEKL 331
           EI +K ++ +LL  +++S ++++ +   L SK  + P+        K  IQ+L    E+L
Sbjct: 268 EIAMKSKLIDLLQGQLSSTQEELRQNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEEL 327

Query: 332 VNSEKECNELKSTVDKYINIDEKKLISKFGNPKKL--IEILRRQLVKEKRHKDTLQRQVE 389
            N     N + + +    N            P     I +L++Q+ +EK  K  LQ Q+E
Sbjct: 328 QNENFNLNSMINQMSNEQNNSNNSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIE 387

Query: 390 SFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQ 449
           SF++ELE K+P+I SF+E+N +LE EL  +T  L +T+ E++    +L N   K+   + 
Sbjct: 388 SFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQS 447

Query: 450 FNDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTD--SHK 503
              EL+RQR DLA+QV++LLL +    D+  P T +E   + KI +N    N ++  S  
Sbjct: 448 NIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQH 507

Query: 504 IISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQE-QQKTLRITDNNKIVESAKST 562
           +IS+RL+ F N++ELQ KNM                E     K  +    NK +  AK  
Sbjct: 508 VISERLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSHKEFQ----NKTIADAKEA 563

Query: 563 SVDLEKHIKTLESKINIISQERDSYKLLV 591
            + L+ H   LESK+ ++  ERDS+KLL+
Sbjct: 564 ILTLQYHNDILESKVKVLEAERDSFKLLL 592

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 98/166 (59%)

Query: 1072 LEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEE 1131
             +ESN  L  +V    + N+TL ++L +   KL  L  E+  +K  + +KE  + + +EE
Sbjct: 1196 FKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEE 1255

Query: 1132 LERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHE 1191
              +W+LR++ +  Q   V+ ++  K   ++  L++  ET R +NA+L +RF+ LKKQAHE
Sbjct: 1256 SNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHE 1315

Query: 1192 KLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAAD 1237
            +L+A+K +Q +L  QINEL  +  N+E +L  E +K+    N  +D
Sbjct: 1316 RLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSD 1361

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  117 bits (293), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 107/346 (30%), Positives = 177/346 (51%), Gaps = 26/346 (7%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            +M+   ++  L+E+N  L K ++  T+ NE +  +   +Q ++  L+ ++ + K +V+  
Sbjct: 1168 IMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVN 1227

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181
               + + + E+E+WK R   + QQ K   ++   K   +I  L+ +L   +  NA L D+
Sbjct: 1228 ANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISDLKAKLLNAQNANADLNDK 1287

Query: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEE 1241
            F+RLKKQAHEKLDA+K  Q  LT +++EL + K              N+       E  +
Sbjct: 1288 FNRLKKQAHEKLDASKKQQTALTNEVDELKDMK--------------NELEESLHSEESK 1333

Query: 1242 IIRLRAELEKSNNFSNELEKKVED--AKKFKNEIESLKSELQSVKAYENSTVNSKIIKDL 1299
            ++ L A+L+K    +  + K  E+  +K    EIE LK ELQ  K   +S   S  I+ +
Sbjct: 1334 VLELEAKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQVFKETSDS---SDTIEKM 1390

Query: 1300 KESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXX 1359
            KE  + EK+++IE+                  +     + NG+   N+            
Sbjct: 1391 KEIMEAEKNKIIEEKTTEFERKLEEAT----GKNTGATIENGE---NMEELKKQWLKQYE 1443

Query: 1360 ALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLR 1405
               ++RI EAEENLKKR+RLPSEE+I  +I KR++ LEQEF+ KL+
Sbjct: 1444 EETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLK 1489

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1454

 Score =  113 bits (282), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 164/302 (54%), Gaps = 28/302 (9%)

Query: 246 ATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQI 305
           A L   NE LS DL+ K+  IK L+++L +S  +F  E  L+ ++   L N+I + ++Q+
Sbjct: 191 AELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQL 250

Query: 306 ERLTSKNLETP------EKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKK---- 355
           E L+ +  + P      + ++++++ +L EKL  SE+E   L  +++++ NI E++    
Sbjct: 251 ESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPEEESSSV 310

Query: 356 ----------LISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSF 405
                      +S  G+    + ILR+  +KE++ K  L+ Q+   L ELE+ +P + S+
Sbjct: 311 SSHASGRNNSALSLSGD----VNILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSY 366

Query: 406 KERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQV 465
           KER++ LE+EL      LE   KE   K  EL   + + SN     + L  QR+ LA QV
Sbjct: 367 KERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQV 426

Query: 466 QYLLLCIDN----KSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQK 521
           +YLLL I N     S    K+  L+ + ++    E  +DS KI+ +RL  F+NVKELQ +
Sbjct: 427 KYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNR 486

Query: 522 NM 523
           NM
Sbjct: 487 NM 488

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 80/115 (69%), Gaps = 9/115 (7%)

Query: 1362 ILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE----LGLNADGNGVV 1417
            I K++++AEENLKKR+RLP+EEKIN +IEKR+  LE  FE K++E    L L++D +  +
Sbjct: 1228 IQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDDK-I 1286

Query: 1418 TDTRAQIEKELRE----KFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ 1468
                 +IE+  RE    +F+ +L  ++KKAFEEGKQ  +MKS  LERK+S LE Q
Sbjct: 1287 KKIYKEIEESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1973

 Score =  102 bits (254), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 109/434 (25%), Positives = 220/434 (50%), Gaps = 38/434 (8%)

Query: 230 QLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQR 289
           QL  V +E+  +KS    L+   + LS  L+     +K++  + N+ K    KE+TLKQ+
Sbjct: 242 QLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQ 301

Query: 290 VNELLHNEIASYKKQIE---RLTSKNLETPEKK---IIQELVDLKEKLVNSEKECNELKS 343
           +  +L +++   +++      LT  +  +  +K     +E+ DLK +L + ++   EL+ 
Sbjct: 302 LIVVLQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEF 361

Query: 344 TVDK---YINIDEK----KLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELE 396
            + K   Y  +        L +        I++L+++L  E+  ++  ++ +E F+ +LE
Sbjct: 362 KLRKSEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLE 421

Query: 397 QKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLR 456
            +LP +++++ R ++ E EL   T  LE+  KE+ +   EL   Q +I + EQ    + +
Sbjct: 422 TELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAK 481

Query: 457 QRSDLAHQVQYLL----LCIDNKSPFTEKEATLVKKIVSNENTEND--TDSHKIISKRLL 510
           QRSDLA+Q+Q+ L    +  D+  P T++E   ++ I+  ++  +D  TD+ K+IS+RL 
Sbjct: 482 QRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLT 541

Query: 511 HFQNVKELQQKNMXXXXXXXXXXXXXXXXEQ-EQQKTLRITDNNKIVESAKSTSVDLEKH 569
            F+++ ELQQKNM                ++ +Q +  RI +  + +  AK   + L+ +
Sbjct: 542 KFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEE--ETIAEAKEAILTLQNY 599

Query: 570 IKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQH 629
             +L +KI  +++E ++YK+L                     + +K+R   E+     +H
Sbjct: 600 NSSLTAKIAALTKELETYKVL-----------SNTEDSSTPADFDKQREQREI-----EH 643

Query: 630 VKVLEELENKIKTL 643
            ++++ELE +I ++
Sbjct: 644 TQLVKELETRIASI 657

 Score =  100 bits (248), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 131/241 (54%), Gaps = 32/241 (13%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            VM   T+L  L ESN  L  E       N+ L +++ ++  KL PLE E+  L   + EK
Sbjct: 1224 VMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLETELQTLTNLIEEK 1283

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181
            ++ L+IC EE ERWK RSQ IL + + ++   H    E+   L+ QLE    EN +L +R
Sbjct: 1284 DKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNR 1343

Query: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINEL--------------NETKVNLEKSLQQEIEK 1227
            F++LKKQAHEKL+A+K  Q +LT QIN+L               E K++LEK L  E+  
Sbjct: 1344 FEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRL--EVTM 1401

Query: 1228 NNQSGNGAADESEEIIRLRAELE----KSNNFSNELEKKVEDAKKFKNEIESLKSELQSV 1283
             N         S +I+ ++++LE    KS +F  +    VE +K+ +   E+L SE++ +
Sbjct: 1402 KN---------SHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIE---ENLNSEIKKL 1449

Query: 1284 K 1284
            +
Sbjct: 1450 Q 1450

 Score = 99.4 bits (246), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 55/108 (50%), Positives = 78/108 (72%), Gaps = 4/108 (3%)

Query: 1364 KRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKL----RELGLNADGNGVVTD 1419
            +RI EAEENLK+R+RLP+EEKIN VI+KRR  LE EF+ K+    +EL    + N     
Sbjct: 1555 QRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDR 1614

Query: 1420 TRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLES 1467
             + +I++EL  K+  EL  +KKKAF+EG+QQ +MK++ LE+K++KLES
Sbjct: 1615 MKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLES 1662

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1651

 Score = 97.1 bits (240), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 130/470 (27%), Positives = 229/470 (48%), Gaps = 60/470 (12%)

Query: 144 VLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLY 203
           +L+ S L++   +TE +   E+IG    ++ ++T +      E + LQ  ++LL++ +L 
Sbjct: 59  LLKSSNLDMSRIVTERA---EEIGRLRDEVSTVTGQTSALRAELENLQNDLELLKDKDLA 115

Query: 204 LEIKCKETD--------KNKKLYSSAEDASRLQDQLQ-------------IVSSE--ILS 240
           L+ +   T         +N  L +  E A  L    Q             +VS E  +  
Sbjct: 116 LQSERDSTVALLDGLKLENSALRAEIEQAKELASIRQHDYEADLDSKTGALVSKEEELRL 175

Query: 241 LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS 300
            KSE A+L    E LS +L ++   I+ L D     + E+  EI L++    LL  ++AS
Sbjct: 176 AKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQKHRARLLQEQVAS 235

Query: 301 YKKQIERLTSKNLETPEKKIIQ--ELVDLKEKLVNSEKECNELKSTVDKYI--NIDEKKL 356
            +K+  +L     E PE +I    E V L+++             ++D  +  N +    
Sbjct: 236 LEKEA-KLVGHETE-PEYEIPPPGEEVALQQR---------SHSISMDSLLTGNDETSHS 284

Query: 357 ISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLEREL 416
           +S+  N    I IL  +L +E   K  L++QV  F+ ELEQ  P+I SFK+++   + ++
Sbjct: 285 MSELNNN---ISILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQI 341

Query: 417 LRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDE---LLRQRSDLAHQVQYLLL--- 470
            ++   LE   K+++   +E+   +K++   EQ + +   L R+R DLA Q+QYLLL   
Sbjct: 342 HKLQLHLEHVTKDKETIFQEVEQYKKQL---EQISGQDKILRRERFDLARQLQYLLLNGF 398

Query: 471 CIDNKSPFTEKEATLVKKIVSNENTEND---TDSHKIISKRLLHFQNVKELQQKNMXXXX 527
             D+  P T  E + +K+I++ +  E +   TDS  IISKR+L F+++ ELQQ+N+    
Sbjct: 399 VKDSDDPLTSSEFSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLS 458

Query: 528 XXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKI 577
                       E    + L   D+ + +  AK T +DL+++  +LE+K+
Sbjct: 459 AVRTLSDRAETLE----RKLESGDSIEAINEAKQTLLDLQQYNSSLEAKV 504

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 89/164 (54%), Gaps = 13/164 (7%)

Query: 367 IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEE- 425
           I+ ++ +L+KEK  K  L+++   FL ++E KLP +     +N+S+E E     + +EE 
Sbjct: 283 IDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYL-----QNNSVENET-NNGNKIEEQ 336

Query: 426 -TAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI-----DNKSPFT 479
               E D    E  +L+ K+++ E     LL+QRSDL HQ+ YLL+       DN    T
Sbjct: 337 KIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILT 396

Query: 480 EKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNM 523
           E E   ++ +V+       T++  IIS+RLL F NV +L  KN+
Sbjct: 397 ENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNI 440

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 56/106 (52%), Gaps = 7/106 (6%)

Query: 1149 VEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQIN 1208
             E  A +K+  +I  L++Q+ET   E  +  DRF RLKKQA +KL+  K  +       N
Sbjct: 741  AESAAMLKNKNEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTE-------N 793

Query: 1209 ELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNN 1254
            +L E   +LEKS  +  ++     +      EEI++++ EL  SNN
Sbjct: 794  KLREDYCDLEKSKNELEQRLLLLESSEKSLQEEIVKMKDELMTSNN 839

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 69/128 (53%), Gaps = 3/128 (2%)

Query: 369 ILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAK 428
           +L++ LV EK     LQ ++ S L+EL  KLP + S KE+N  L+     I SS EE  +
Sbjct: 211 VLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQ 270

Query: 429 ERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPF---TEKEATL 485
           +      ++ ++  KI + EQ   +LL QR++L   +  LL  I+  S +   +E E  L
Sbjct: 271 QFHSNTDKIASMNNKIVDYEQSLKQLLSQRTNLISYILNLLNVINLNSKYLNLSESEGCL 330

Query: 486 VKKIVSNE 493
           ++ + +NE
Sbjct: 331 IQNLFNNE 338

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 90/192 (46%), Gaps = 38/192 (19%)

Query: 1066 TTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHL 1125
            + KL++++ESN  L  E +     N  LSS L  +      +  E+++L  K        
Sbjct: 538  SAKLVSIQESNDLLADENQKIKMENSNLSSLLNKINTDKNSISNELSDLHSK-------- 589

Query: 1126 NICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTE-------NA-- 1176
             I + E E+ KL  Q  L++G+   +E + K  E+IK  + +++    E       NA  
Sbjct: 590  EILELETEKTKLLEQ--LEEGERKLKETNEKHNEQIKWFQNKIDNFNEETTKNQFNNALK 647

Query: 1177 ------------------QLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLE 1218
                              +  D+F RLK+QA+E+L+A+KT Q  L+  +  L + + N +
Sbjct: 648  NDYENLKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFK 707

Query: 1219 KSLQQ-EIEKNN 1229
            + + + E++ NN
Sbjct: 708  EHISKLEVDINN 719

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 89/166 (53%), Gaps = 15/166 (9%)

Query: 369 ILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAK 428
           IL++++ K +  +D LQ ++E  + ELE   P +++  ++ + LE  L    S  + T++
Sbjct: 300 ILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLL----SKEKNTSE 355

Query: 429 ERDIKDRELTNLQKKISNNEQFND---ELLRQ-RSDLAHQVQYLLLC----IDNKSPFTE 480
                 +E+ N +K I +  + +D   E LR+  +DL +Q+Q++L+      D     TE
Sbjct: 356 HFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTE 415

Query: 481 KEATLVKKIV--SNENTEND-TDSHKIISKRLLHFQNVKELQQKNM 523
            E   +K +     E + N+  +S  IIS RL+ F++V  LQQKNM
Sbjct: 416 NEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNM 461

 Score = 37.0 bits (84), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 61/124 (49%), Gaps = 11/124 (8%)

Query: 1088 KVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQH-LNICQEELERWKLRSQTILQQG 1146
            K N  L  +L D +  +E ++ EI +L   + E +++ LNI           S+  L + 
Sbjct: 906  KSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNIT----------SEITLLRN 955

Query: 1147 KIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQ 1206
            +  E E  +K        +E+ E    EN +  DRF+RLKKQA+ +L ++K  Q  L  Q
Sbjct: 956  RCKELENKLKEASLQSDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQ 1015

Query: 1207 INEL 1210
            I+ L
Sbjct: 1016 ISSL 1019

>KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} similar to
            uniprot|P18851 YOR212W Saccharomyces cerevisiae STE4 G
            protein beta subunit
          Length = 436

 Score = 36.2 bits (82), Expect = 0.71,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 1147 KIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQ 1206
            +++  + H  ++    T+E+++ T +TE  QL D+ +R+K +  +      T  +NL+  
Sbjct: 14   ELIVHDYHYPNMNSAGTVEDKIRTAKTECKQLYDQINRIKGKIQD------TQLMNLSHG 67

Query: 1207 INELNETKVNLEKSLQ 1222
            +N L+E  +   ++L+
Sbjct: 68   VNSLHELNLQPVRTLK 83

>Suva_12.225 Chr12 complement(353202..355328) [2127 bp, 708 aa] {ON}
            YJR134C (REAL)
          Length = 708

 Score = 35.8 bits (81), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 60/115 (52%), Gaps = 10/115 (8%)

Query: 1084 ENCTKVNETLSSQLADMQVKLEPLEQEINE----LKLKVAEKEQHLNICQEELERWKLRS 1139
            EN ++V +  SSQ   ++ +LE  +   N     L +K+ + E HL   ++E  R++   
Sbjct: 335  ENGSEVKQHTSSQYNLLKEQLESSKANWNSIEYALNIKIVDLENHLTSTRKEKTRFEEAY 394

Query: 1140 QTILQQGKIV------EEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQ 1188
            QT L   + +      E+E H+ +  ++K LE Q+ET++     + D ++ LKK+
Sbjct: 395  QTALDSSETLSEQLEREKENHLNAASQVKELERQIETLKLSLQSVNDDYNLLKKK 449

>KLTH0B01232g Chr2 complement(108265..110865) [2601 bp, 866 aa] {ON}
           similar to uniprot|P46675 Saccharomyces cerevisiae
           YLR045C STU2 Microtubule-associated protein (MAP) of the
           XMAP215/Dis1 family regulates microtubule dynamics
           during spindle orientation and metaphase chromosome
           alignment interacts with spindle pole body component
           Spc72p
          Length = 866

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 7/73 (9%)

Query: 384 LQRQVESFLVELEQKLPMIDSFKER-------NSSLERELLRITSSLEETAKERDIKDRE 436
           LQRQ + +L E ++ L  I  F+ +       NSSL ++L  + SSL E+  E   K+ +
Sbjct: 656 LQRQKQKWLKERQEFLATITDFQNKASHLSSENSSLRQQLDTVQSSLHESNIELRSKEMQ 715

Query: 437 LTNLQKKISNNEQ 449
           +T LQ +ISN EQ
Sbjct: 716 ITRLQDRISNLEQ 728

>KAFR0E01470 Chr5 complement(293344..295962) [2619 bp, 872 aa] {ON}
            Anc_5.296 YDR285W
          Length = 872

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 67/124 (54%), Gaps = 2/124 (1%)

Query: 1165 EEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE 1224
            EE +E    +N  + + F++ K   +EKL+ +++       +  +LNETK++   + + +
Sbjct: 534  EELIEKFEAQNNTIIE-FEKTKADFNEKLNLSESKLNYFKNECAKLNETKMSDTANFENK 592

Query: 1225 IEKNNQSGNGAADESEEIIRLRAELEKS-NNFSNELEKKVEDAKKFKNEIESLKSELQSV 1283
            I   N+  N    E++ + +   ELE+S NNF  +   K E+ +KF  +++ L  E+  +
Sbjct: 593  IASQNRINNVLMSENDTLKQRITELEESKNNFEKDQNVKFENIQKFHEQLQKLNVEIVQM 652

Query: 1284 KAYE 1287
            KA+E
Sbjct: 653  KAHE 656

>NDAI0G00220 Chr7 (29472..31436) [1965 bp, 654 aa] {ON} Anc_1.493
           YML046W
          Length = 654

 Score = 34.3 bits (77), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 36/64 (56%)

Query: 365 KLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLE 424
           KLI +  + +VK K   DT+++ +E    ++ Q+ P+   + ++ +++E +L  +  S+ 
Sbjct: 52  KLIAMTEQLVVKYKDPNDTIKQSIEIIFYQILQRYPLFFGYWKKFTAIEYQLYGLEKSIA 111

Query: 425 ETAK 428
             AK
Sbjct: 112 TLAK 115

>Kpol_1018.21 s1018 (56444..57697) [1254 bp, 417 aa] {ON}
           (56444..57697) [1254 nt, 418 aa]
          Length = 417

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 84/173 (48%), Gaps = 36/173 (20%)

Query: 150 LELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIK-- 207
           L+L D L +NS +          +DS+ +E+     +NKK QT ++     N Y++ +  
Sbjct: 227 LQLLDKLDKNSKM----------IDSLNREV-----QNKKQQTKLQESNYKNKYMQTRNE 271

Query: 208 -CKETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATL--KYMNESLSTD-----L 259
              E   +KKLY +     +   QL+I+S E L L++ I TL  + +NE+L  D     L
Sbjct: 272 LINELRHSKKLYDNYYKLFQKYQQLKIISKESLELQNRIPTLDDRLVNETLVKDRKINEL 331

Query: 260 QRKLFRIKDLDDNLNSSKQ-----------EFAKEITLKQRVNELLHNEIASY 301
           Q+++  ++  ++NL + ++           E   ++ L+  V+   H+  ++Y
Sbjct: 332 QKRIQSLQIANENLTTQREIDILKYESRIKELEAKLILQNDVHSQFHHSTSTY 384

>TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1794

 Score = 33.9 bits (76), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 74/144 (51%), Gaps = 19/144 (13%)

Query: 728  EISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNE--EKEPAKQ 785
            E+S L S+   L +KI T+   KN+L++++++LE SLS+ E+     +++   EKE  ++
Sbjct: 1023 EVSTLTSQVALLNEKISTLISEKNVLNSQIIELEHSLSKSEILSKEALESSLVEKEANEK 1082

Query: 786  QTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENK 845
            Q          S+N  ++S    +N+E L N    LR EL   QED   K  + + L N 
Sbjct: 1083 QILELTT----SIN--ELSADKKKNIETLDN----LRTELSSCQEDSKTKDSTIINLNNT 1132

Query: 846  YTKVKNDLKQATYKLASVYTTLEQ 869
                   +K A  KLAS  + LE+
Sbjct: 1133 -------IKIAEDKLASSESRLEE 1149

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score = 33.1 bits (74), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 294 LHNEIASYKKQIERLT-SKNLETPEKKIIQELVDLKEKLVNS 334
           ++++++ Y++ + RL  S +   P+KKI QEL+D+  KL NS
Sbjct: 46  IYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNS 87

>SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa]
           {ON} similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1297

 Score = 33.1 bits (74), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%)

Query: 123 DLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQEL 180
           D E +Q++ +  EA     E  L + + ELQDS   NS LKEQIG       S+  EL
Sbjct: 643 DTETLQQELSVAEANYHAVEGKLTELQKELQDSEQSNSQLKEQIGNLNAMAASLQTEL 700

>Ecym_3434 Chr3 (816557..818017) [1461 bp, 486 aa] {ON} similar to
           Ashbya gossypii AAR042W
          Length = 486

 Score = 32.7 bits (73), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%)

Query: 245 IATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIA 299
           I++LK+ NE+L++ L RK  R++DLD  L   K  +    T  + + + L N+ A
Sbjct: 149 ISSLKHENENLNSMLNRKTRRVRDLDTELGQLKVSYEDATTSHKHLKDQLENKFA 203

>Skud_13.393 Chr13 complement(692641..694725) [2085 bp, 694 aa] {ON}
            YMR224C (REAL)
          Length = 694

 Score = 32.7 bits (73), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 66/160 (41%), Gaps = 23/160 (14%)

Query: 1128 CQEELERWKLRSQTILQQGK-----IVEEEAHMKSL--------EKIKTLEEQLETVRTE 1174
            C   L    +++  +LQ G      + E EA  K +        E  K     LETVRT 
Sbjct: 245  CIPNLVHNPMKNFDVLQPGSSVATSLCEAEAQPKYVFVLDIKHGEPPKMTPITLETVRTF 304

Query: 1175 NAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNE-TKVNLEKSLQQEIEKNNQSGN 1233
              +     D    + H+K   +K +   +   INE NE TK  L          ++  G+
Sbjct: 305  KMRSISLQDVPHLRPHDKDATSKYLIEQVEGMINEANEETKRKL---------GDDAEGD 355

Query: 1234 GAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEI 1273
              A+  + +IRLR +     N  + ++ +VE+ ++F N  
Sbjct: 356  MIAELPKPLIRLRVDYSAPFNKQSTIDYQVENPRRFSNRF 395

>CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {ON}
           highly similar to uniprot|P32892 Saccharomyces
           cerevisiae YLL008w DRS1 RNA helicase of the DEAD box
           family
          Length = 725

 Score = 32.7 bits (73), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 12/82 (14%)

Query: 392 LVELEQKLP---MIDSFKERNSSLERELLRITSSLEETAKERD-IKDRELTNLQKKISNN 447
           L+ L  K P   MID  K+  + L +E +RI        ++RD +K   L NL +K+  N
Sbjct: 401 LISLSLKRPVRIMIDPPKQAATKLTQEFVRI--------RKRDHLKPSLLFNLIRKLDPN 452

Query: 448 EQFNDELLRQRSDLAHQVQYLL 469
            Q    +   R D+AH+++ +L
Sbjct: 453 GQKRIVVFVARKDMAHKLRIIL 474

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.125    0.318 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 153,701,548
Number of extensions: 7162012
Number of successful extensions: 65438
Number of sequences better than 10.0: 2842
Number of HSP's gapped: 59020
Number of HSP's successfully gapped: 7420
Length of query: 1554
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1431
Effective length of database: 39,377,481
Effective search space: 56349175311
Effective search space used: 56349175311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)