Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F002905.702ON1554155469510.0
NCAS0G002305.702ON1735165114111e-166
SAKL0E14916g5.702ON1779168812781e-147
ZYRO0G06600g5.702ON1820167312571e-144
NCAS0A032005.702ON1788163811441e-129
KLTH0E01056g5.702ON1771168111121e-125
TBLA0E017305.702ON1820174111031e-124
Suva_9.395.702ON1682167010991e-123
KLLA0A00594g5.702ON1748170410781e-120
YIL149C (MLP2)5.702ON1679153910461e-117
Skud_9.195.702ON168015529941e-110
AFR286W5.702ON175815759941e-110
Ecym_40185.702ON176917879891e-109
Kwal_55.196975.702ON176016968677e-94
KNAG0L021405.702ON160815128594e-93
CAGL0G02497g5.702ON178016578501e-91
KAFR0D022205.702ON167415348419e-91
TDEL0B021905.702ON181015338349e-90
YKR095W (MLP1)5.702ON187515538108e-87
Suva_11.3315.702ON189815567822e-83
Skud_11.3345.702ON188515357813e-83
Smik_9.205.702ON168215987741e-82
Smik_11.3585.702ON187815577529e-80
NDAI0E050405.702ON197314527252e-76
KAFR0H002105.702ON145413176052e-62
KNAG0C065905.702ON165115085784e-59
Kpol_1043.705.702ON13214375193e-52
Kpol_483.114.238ON254614974444e-43
KAFR0G032004.238ON186912754345e-42
TPHA0D046105.702ON118311993951e-37
TPHA0B008304.238ON253614383934e-37
CAGL0D00924g4.238ON198013003827e-36
ZYRO0B12144g4.238ON200512933657e-34
NDAI0D044204.238ON191413743452e-31
TPHA0E002305.702ON128411813423e-31
KNAG0D043404.238ON222013453424e-31
YDL058W (USO1)4.238ON179011323352e-30
NCAS0A024504.238ON192811953325e-30
Smik_4.1764.238ON179511343164e-28
Kpol_2001.755.702ON10069173144e-28
Suva_4.1914.238ON178211563121e-27
KLTH0D14102g4.238ON171211803102e-27
TBLA0I029004.238ON17949863041e-26
Skud_4.1964.238ON17928652985e-26
KLLA0E05281g4.238ON17559022861e-24
Smik_8.905.267ON192712402798e-24
Kpol_1051.255.267ON196812732734e-23
SAKL0H03300g4.238ON17079932691e-22
NDAI0D018305.267ON189012052636e-22
KAFR0E017505.267ON189111922628e-22
TDEL0E013304.238ON16579682611e-21
Kwal_23.55345.267ON190711042564e-21
TBLA0A036205.414ON9708932537e-21
SAKL0G11110g5.267ON18719622512e-20
TBLA0A104705.267ON199910202493e-20
SAKL0H24200g4.46ON9639042464e-20
Suva_2.5285.414ON9447402448e-20
CAGL0J00693g5.267ON188412972441e-19
ACR068W5.267ON180511202431e-19
YHR023W (MYO1)5.267ON192811722431e-19
Kpol_1055.275.296ON8298082412e-19
ZYRO0C11066g5.267ON191811472422e-19
KNAG0F027205.267ON187211492412e-19
CAGL0J07788g1.110ON130510062394e-19
TPHA0E023205.267ON19159832377e-19
Skud_8.785.267ON192711152377e-19
Kwal_26.93864.238ON12159862351e-18
Ecym_11081.110ON129810772341e-18
KAFR0E040105.414ON9057622331e-18
Ecym_55145.414ON8547712312e-18
Ecym_53454.238ON13667162296e-18
KLLA0E11595g5.267ON184811962296e-18
TBLA0B099704.46ON10658452286e-18
Smik_14.851.110ON131210662287e-18
TPHA0K019904.46ON9107332278e-18
Skud_4.6255.414ON9476772261e-17
Suva_15.2095.267ON192912012271e-17
TPHA0H016805.414ON9897982251e-17
Smik_15.3828.604ON8297182242e-17
Smik_4.6225.414ON9445782242e-17
TBLA0E040608.604ON8046642196e-17
KLTH0G07128g5.267ON186212712199e-17
NCAS0A067605.267ON187611472199e-17
Kpol_1026.314.46ON100510742189e-17
Kwal_14.23264.46ON9238262171e-16
YDR356W (SPC110)5.414ON9448792152e-16
TPHA0O019302.16ON10817422152e-16
KLLA0E21517g5.414ON8587522142e-16
YLR309C (IMH1)4.46ON9118292133e-16
KLTH0H09438g4.46ON9277252133e-16
KLLA0C02915g1.110ON12969632125e-16
CAGL0L12188g8.259ON13987822091e-15
Suva_14.921.110ON131211042082e-15
YNL250W (RAD50)1.110ON13129392072e-15
KAFR0F030204.46ON8246752062e-15
Ecym_82315.267ON185412652063e-15
YOR195W (SLK19)8.604ON8216222044e-15
TDEL0C059101.110ON13059082045e-15
Suva_10.4054.46ON9167022027e-15
TBLA0A102505.296ON9508142019e-15
CAGL0I10901g8.604ON8163871991e-14
CAGL0E03454g4.46ON8677131991e-14
CAGL0A02596g5.414ON8726861982e-14
NDAI0B055205.414ON10097761982e-14
TDEL0H026107.186ON11709511982e-14
NDAI0D029304.46ON9608261964e-14
NCAS0F032205.414ON9627401964e-14
KLLA0C17204g4.46ON7686111945e-14
ZYRO0B00484g4.46ON9197771946e-14
CAGL0H01144g5.296ON8207621937e-14
Kpol_1031.155.414ON9297271921e-13
KAFR0D037601.110ON13017691921e-13
TPHA0B042101.110ON13037851921e-13
NDAI0H019507.21ON8567131911e-13
TDEL0E035905.267ON188211301912e-13
NDAI0F040001.110ON130510581902e-13
Kpol_1033.336.188ON5786031882e-13
Kpol_529.202.16ON9579461892e-13
NDAI0K011008.704ON8886641874e-13
TBLA0A057201.110ON13077261875e-13
AFR637W1.110ON129610701866e-13
TBLA0C027401.295ON11199451858e-13
TPHA0J007208.259ON139311031858e-13
SAKL0H17094g8.259ON14227861858e-13
Skud_15.3628.604ON8295881849e-13
TDEL0E055304.46ON9066411849e-13
Smik_12.3934.46ON9106861849e-13
Skud_12.3934.46ON9137391849e-13
AER045C4.238ON12926751822e-12
Ecym_64762.16ON8507391812e-12
KNAG0I029604.46ON9648831812e-12
KNAG0C050605.414ON10407321812e-12
Kpol_2000.341.110ON13059991803e-12
TBLA0A105804.364ON8138121793e-12
KAFR0G020908.604ON7324851784e-12
SAKL0E14212g2.16ON9206181785e-12
SAKL0G02024g5.414ON8497081776e-12
Skud_14.881.110ON13168491777e-12
ADL037W4.46ON8877271768e-12
NCAS0A059604.46ON9208021768e-12
NDAI0C058808.604ON8467941741e-11
KNAG0A033608.604ON7566551732e-11
ZYRO0F15378g2.16ON9286441732e-11
Kpol_1018.236.289ON6513041722e-11
YJR134C (SGM1)4.364ON7076151713e-11
KLTH0D09504g8.604ON7186101713e-11
NCAS0B018008.604ON7916181713e-11
KAFR0G029307.186ON117010711713e-11
Ecym_31735.296ON8397721704e-11
TPHA0D017505.296ON8816951704e-11
Kpol_1059.308.636ON4572671675e-11
Suva_8.2518.604ON8296761695e-11
KLLA0C10879g5.296ON7557821686e-11
ZYRO0B12804g4.268ON6705281678e-11
KLTH0F16500g5.414ON8386251679e-11
CAGL0D05258g7.186ON11709531671e-10
KAFR0G019208.636ON4734171641e-10
KAFR0E014705.296ON8726801652e-10
KAFR0C021506.188ON6895951642e-10
TBLA0B052006.184ON8125461633e-10
NDAI0C039805.296ON9066401633e-10
ZYRO0F03828g8.68ON12177971633e-10
SAKL0H08426g8.604ON8166551623e-10
ZYRO0F10538g8.331ON25256161633e-10
Kpol_325.16.333ON8762431623e-10
TBLA0A044107.21ON7324721614e-10
YDR285W (ZIP1)5.296ON8756161615e-10
YGL086W (MAD1)6.188ON7496181606e-10
KNAG0B052301.295ON12258951599e-10
SAKL0G18414g4.364ON6796741589e-10
KLLA0E19141g6.188ON6483591571e-09
CAGL0L02695g8.636ON4593401551e-09
Suva_6.1047.186ON11707581572e-09
Kwal_33.135261.110ON12987961572e-09
Smik_7.1976.188ON7176201562e-09
Kpol_479.38.604ON7955291562e-09
NCAS0F025005.296ON8317041562e-09
KLLA0A00286g1.295ON122410621562e-09
TBLA0I016605.696ON7223931552e-09
TPHA0F032208.636ON4782441533e-09
SAKL0B02288g8.68ON12287491553e-09
NCAS0A075007.21ON8435181543e-09
Smik_1.167.21ON6277071533e-09
NCAS0A093301.295ON12279541543e-09
Suva_12.2254.364ON7084591534e-09
CAGL0F02079g8.68ON12238401534e-09
NCAS0B066302.215ON1611631415e-09
TDEL0A054908.604ON7815621525e-09
TPHA0A011508.604ON8186021525e-09
SAKL0H07524g8.636ON4522591506e-09
KLTH0F03058g1.110ON12987741526e-09
TBLA0E044108.259ON14223361526e-09
KLLA0B10956g3.479ON6902991516e-09
Ecym_71018.604ON7174291516e-09
NDAI0D043004.268ON7436411516e-09
ABL193C2.16ON8624081517e-09
KNAG0F006501.110ON13069951518e-09
TDEL0E033205.296ON8557141509e-09
SAKL0F14894g7.488ON12972491501e-08
ZYRO0F16038g1.110ON13047831501e-08
TPHA0L002404.364ON7327671491e-08
TBLA0G001802.16ON10166351491e-08
NDAI0I012206.188ON7006141472e-08
NCAS0B013108.636ON4873541462e-08
TDEL0E021005.414ON7616751472e-08
Kwal_23.50438.68ON12253831472e-08
NCAS0A007701.110ON130410421472e-08
TBLA0B051606.188ON6525701462e-08
TBLA0H012408.331ON17955251472e-08
KAFR0C019603.492ON5636101453e-08
Kwal_23.44242.16ON9486641463e-08
KLTH0H04774g6.188ON6584111453e-08
KLTH0D14784g4.268ON6635891453e-08
KAFR0G003201.162ON6902571453e-08
TBLA0G017306.289ON7494531453e-08
NDAI0G028203.149ON4512871434e-08
TBLA0G035308.68ON12329171454e-08
ZYRO0G21318g1.294ON14543851454e-08
Ecym_43907.186ON11708461445e-08
Skud_6.648.68ON12307921445e-08
Suva_6.528.68ON12647841425e-08
ZYRO0C01716g8.259ON14137671445e-08
Smik_12.1458.259ON14189181445e-08
ZYRO0B08536g4.364ON6902791435e-08
Suva_16.4693.479ON7312661436e-08
Smik_4.5345.296ON8766291436e-08
Suva_2.4515.296ON8777411436e-08
Skud_4.5485.296ON8776191436e-08
KNAG0D006706.289ON5372521426e-08
TBLA0D046107.186ON117410221437e-08
NDAI0G033208.68ON123110111437e-08
TDEL0C035107.488ON13023131437e-08
YLR086W (SMC4)8.259ON14187831437e-08
Skud_10.3574.364ON7054171427e-08
AER241W5.414ON8527581428e-08
Skud_12.4684.237ON11207411429e-08
KAFR0B027108.259ON141611281429e-08
CAGL0H03179g6.188ON6575221419e-08
Skud_4.152.16ON7904081411e-07
KLLA0F00770g8.604ON6283771401e-07
Skud_1.137.21ON6362941401e-07
Kwal_56.238258.259ON13967451411e-07
NDAI0B019708.259ON14153221411e-07
SAKL0A05170g6.188ON6505151401e-07
KLLA0D06875g8.636ON4623371391e-07
TDEL0A058208.636ON4763151391e-07
Ecym_83744.46ON9147791401e-07
SAKL0D06116g1.295ON122910511402e-07
Kpol_1002.646.188ON6577191392e-07
NCAS0J022004.364ON7075651392e-07
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NDAI0F00290
         (4665 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...  2682   0.0  
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   548   e-166
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   496   e-147
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   488   e-144
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   445   e-129
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   432   e-125
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   429   e-124
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   427   e-123
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   419   e-120
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   407   e-117
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   387   e-110
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   387   e-110
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   385   e-109
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   338   7e-94
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   335   4e-93
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   332   1e-91
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   328   9e-91
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   325   9e-90
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   316   8e-87
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   305   2e-83
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   305   3e-83
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   302   1e-82
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   294   9e-80
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   283   2e-76
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   237   2e-62
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   227   4e-59
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   204   3e-52
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...   175   4e-43
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...   171   5e-42
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...   156   1e-37
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....   155   4e-37
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...   151   7e-36
ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] ...   145   7e-34
NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_...   137   2e-31
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   136   3e-31
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...   136   4e-31
YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essen...   133   2e-30
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...   132   5e-30
Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W...   126   4e-28
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...   125   4e-28
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...   124   1e-27
KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa...   124   2e-27
TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {...   121   1e-26
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...   119   5e-26
KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} simil...   114   1e-24
Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W ...   112   8e-24
Kpol_1051.25 s1051 complement(51521..57427) [5907 bp, 1968 aa] {...   109   4e-23
SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} simil...   108   1e-22
NDAI0D01830 Chr4 complement(424039..429711) [5673 bp, 1890 aa] {...   105   6e-22
KAFR0E01750 Chr5 (356404..362079) [5676 bp, 1891 aa] {ON} Anc_5....   105   8e-22
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....   105   1e-21
Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR0...   103   4e-21
TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.4...   102   7e-21
SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa] ...   101   2e-20
TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa]...   100   3e-20
SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa]...    99   4e-20
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    99   8e-20
CAGL0J00693g Chr10 complement(61246..66900) [5655 bp, 1884 aa] {...    99   1e-19
ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic h...    98   1e-19
YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type ...    98   1e-19
Kpol_1055.27 s1055 (70806..73295) [2490 bp, 829 aa] {ON} (70806....    97   2e-19
ZYRO0C11066g Chr3 (851369..857125) [5757 bp, 1918 aa] {ON} simil...    98   2e-19
KNAG0F02720 Chr6 complement(511178..516796) [5619 bp, 1872 aa] {...    97   2e-19
CAGL0J07788g Chr10 complement(759175..763092) [3918 bp, 1305 aa]...    97   4e-19
TPHA0E02320 Chr5 complement(482429..488176) [5748 bp, 1915 aa] {...    96   7e-19
Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W ...    96   7e-19
Kwal_26.9386 s26 complement(1192963..1196610) [3648 bp, 1215 aa]...    95   1e-18
Ecym_1108 Chr1 (226176..230072) [3897 bp, 1298 aa] {ON} similar ...    95   1e-18
KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {O...    94   1e-18
Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar...    94   2e-18
Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON...    93   6e-18
KLLA0E11595g Chr5 complement(1018972..1024518) [5547 bp, 1848 aa...    93   6e-18
TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa]...    92   6e-18
Smik_14.85 Chr14 (154519..158457) [3939 bp, 1312 aa] {ON} YNL250...    92   7e-18
TPHA0K01990 Chr11 complement(419705..422437) [2733 bp, 910 aa] {...    92   8e-18
Skud_4.625 Chr4 (1115049..1117892) [2844 bp, 947 aa] {ON} YDR356...    92   1e-17
Suva_15.209 Chr15 (358888..364677) [5790 bp, 1929 aa] {ON} YHR02...    92   1e-17
TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.4...    91   1e-17
Smik_15.382 Chr15 (662584..665073) [2490 bp, 829 aa] {ON} YOR195...    91   2e-17
Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356...    91   2e-17
TBLA0E04060 Chr5 (1019290..1021704) [2415 bp, 804 aa] {ON} Anc_8...    89   6e-17
KLTH0G07128g Chr7 complement(569563..575151) [5589 bp, 1862 aa] ...    89   9e-17
NCAS0A06760 Chr1 complement(1333937..1339567) [5631 bp, 1876 aa]...    89   9e-17
Kpol_1026.31 s1026 complement(71225..74242) [3018 bp, 1005 aa] {...    89   9e-17
Kwal_14.2326 s14 (707822..710593) [2772 bp, 923 aa] {ON} YLR309C...    88   1e-16
YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110In...    87   2e-16
TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2...    87   2e-16
KLLA0E21517g Chr5 complement(1920040..1922616) [2577 bp, 858 aa]...    87   2e-16
YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON} ...    87   3e-16
KLTH0H09438g Chr8 (811653..814436) [2784 bp, 927 aa] {ON} simila...    87   3e-16
KLLA0C02915g Chr3 (261280..265170) [3891 bp, 1296 aa] {ON} simil...    86   5e-16
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...    85   1e-15
Suva_14.92 Chr14 (170211..174149) [3939 bp, 1312 aa] {ON} YNL250...    85   2e-15
YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}  RAD50Sub...    84   2e-15
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    84   2e-15
Ecym_8231 Chr8 complement(471639..477203) [5565 bp, 1854 aa] {ON...    84   3e-15
YOR195W Chr15 (712866..715331) [2466 bp, 821 aa] {ON}  SLK19Kine...    83   4e-15
TDEL0C05910 Chr3 complement(1063668..1067585) [3918 bp, 1305 aa]...    83   5e-15
Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {...    82   7e-15
TBLA0A10250 Chr1 (2530239..2533091) [2853 bp, 950 aa] {ON} Anc_5...    82   9e-15
CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} simi...    81   1e-14
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    81   1e-14
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    81   2e-14
NDAI0B05520 Chr2 (1351005..1354034) [3030 bp, 1009 aa] {ON} Anc_...    81   2e-14
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    81   2e-14
NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {O...    80   4e-14
NCAS0F03220 Chr6 (653886..656774) [2889 bp, 962 aa] {ON} Anc_5.4...    80   4e-14
KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some...    79   5e-14
ZYRO0B00484g Chr2 complement(28527..31286) [2760 bp, 919 aa] {ON...    79   6e-14
CAGL0H01144g Chr8 complement(103968..105360,105539..106608) [246...    79   7e-14
Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON} (38596....    79   1e-13
KAFR0D03760 Chr4 complement(726654..730559) [3906 bp, 1301 aa] {...    79   1e-13
TPHA0B04210 Chr2 complement(987462..991373) [3912 bp, 1303 aa] {...    79   1e-13
NDAI0H01950 Chr8 complement(474375..476945) [2571 bp, 856 aa] {O...    78   1e-13
TDEL0E03590 Chr5 complement(670913..676561) [5649 bp, 1882 aa] {...    78   2e-13
NDAI0F04000 Chr6 complement(948219..952136) [3918 bp, 1305 aa] {...    78   2e-13
Kpol_1033.33 s1033 (91526..93262) [1737 bp, 578 aa] {ON} (91526....    77   2e-13
Kpol_529.20 s529 (59125..61998) [2874 bp, 957 aa] {ON} (59125..6...    77   2e-13
NDAI0K01100 Chr11 complement(256280..258946) [2667 bp, 888 aa] {...    77   4e-13
TBLA0A05720 Chr1 (1417989..1421912) [3924 bp, 1307 aa] {ON} Anc_...    77   5e-13
AFR637W Chr6 (1599134..1603024) [3891 bp, 1296 aa] {ON} Syntenic...    76   6e-13
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    76   8e-13
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...    76   8e-13
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...    76   8e-13
Skud_15.362 Chr15 (651999..654488) [2490 bp, 829 aa] {ON} YOR195...    75   9e-13
TDEL0E05530 Chr5 (1020490..1023210) [2721 bp, 906 aa] {ON} Anc_4...    75   9e-13
Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {...    75   9e-13
Skud_12.393 Chr12 complement(689954..692695) [2742 bp, 913 aa] {...    75   9e-13
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    75   2e-12
Ecym_6476 Chr6 (921068..923620) [2553 bp, 850 aa] {ON} similar t...    74   2e-12
KNAG0I02960 Chr9 complement(584077..586971) [2895 bp, 964 aa] {O...    74   2e-12
KNAG0C05060 Chr3 complement(972160..975282) [3123 bp, 1040 aa] {...    74   2e-12
Kpol_2000.34 s2000 complement(63284..67201) [3918 bp, 1305 aa] {...    74   3e-12
TBLA0A10580 Chr1 (2617516..2619957) [2442 bp, 813 aa] {ON} Anc_4...    74   3e-12
KAFR0G02090 Chr7 complement(437389..439587) [2199 bp, 732 aa] {O...    73   4e-12
SAKL0E14212g Chr5 (1169895..1172657) [2763 bp, 920 aa] {ON} simi...    73   5e-12
SAKL0G02024g Chr7 (169807..172356) [2550 bp, 849 aa] {ON} weakly...    73   6e-12
Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250...    73   7e-12
ADL037W Chr4 (628992..631655) [2664 bp, 887 aa] {ON} Syntenic ho...    72   8e-12
NCAS0A05960 Chr1 complement(1173851..1176613) [2763 bp, 920 aa] ...    72   8e-12
NDAI0C05880 Chr3 (1346220..1348760) [2541 bp, 846 aa] {ON} Anc_8...    72   1e-11
KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {O...    71   2e-11
ZYRO0F15378g Chr6 (1257918..1260704) [2787 bp, 928 aa] {ON} weak...    71   2e-11
Kpol_1018.23 s1018 complement(59840..61795) [1956 bp, 651 aa] {O...    71   2e-11
YJR134C Chr10 complement(673729..675852) [2124 bp, 707 aa] {ON} ...    70   3e-11
KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly...    70   3e-11
NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {O...    70   3e-11
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    70   3e-11
Ecym_3173 Chr3 complement(327173..329692) [2520 bp, 839 aa] {ON}...    70   4e-11
TPHA0D01750 Chr4 complement(359929..362574) [2646 bp, 881 aa] {O...    70   4e-11
Kpol_1059.30 s1059 (64396..65769) [1374 bp, 457 aa] {ON} (64396....    69   5e-11
Suva_8.251 Chr8 (451862..454351) [2490 bp, 829 aa] {ON} YOR195W ...    70   5e-11
KLLA0C10879g Chr3 (936212..938479) [2268 bp, 755 aa] {ON} weakly...    69   6e-11
ZYRO0B12804g Chr2 (1035145..1037157) [2013 bp, 670 aa] {ON} simi...    69   8e-11
KLTH0F16500g Chr6 complement(1337865..1340381) [2517 bp, 838 aa]...    69   9e-11
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    69   1e-10
KAFR0G01920 Chr7 (408397..409818) [1422 bp, 473 aa] {ON} Anc_8.6...    68   1e-10
KAFR0E01470 Chr5 complement(293344..295962) [2619 bp, 872 aa] {O...    68   2e-10
KAFR0C02150 Chr3 (428622..430691) [2070 bp, 689 aa] {ON} Anc_6.1...    68   2e-10
TBLA0B05200 Chr2 complement(1221706..1224144) [2439 bp, 812 aa] ...    67   3e-10
NDAI0C03980 Chr3 complement(901982..904702) [2721 bp, 906 aa] {O...    67   3e-10
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...    67   3e-10
SAKL0H08426g Chr8 complement(726923..729373) [2451 bp, 816 aa] {...    67   3e-10
ZYRO0F10538g Chr6 (856604..864181) [7578 bp, 2525 aa] {ON} weakl...    67   3e-10
Kpol_325.1 s325 complement(1290..3920) [2631 bp, 876 aa] {ON} co...    67   3e-10
TBLA0A04410 Chr1 complement(1085213..1087411) [2199 bp, 732 aa] ...    67   4e-10
YDR285W Chr4 (1032436..1035063) [2628 bp, 875 aa] {ON}  ZIP1Tran...    67   5e-10
YGL086W Chr7 (347119..349368) [2250 bp, 749 aa] {ON}  MAD1Coiled...    66   6e-10
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    66   9e-10
SAKL0G18414g Chr7 complement(1588834..1590873) [2040 bp, 679 aa]...    65   9e-10
KLLA0E19141g Chr5 (1703466..1705412) [1947 bp, 648 aa] {ON} simi...    65   1e-09
CAGL0L02695g Chr12 (317998..319377) [1380 bp, 459 aa] {ON} simil...    64   1e-09
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    65   2e-09
Kwal_33.13526 s33 (264384..268280) [3897 bp, 1298 aa] {ON} YNL25...    65   2e-09
Smik_7.197 Chr7 (341623..343776) [2154 bp, 717 aa] {ON} YGL086W ...    65   2e-09
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    65   2e-09
NCAS0F02500 Chr6 complement(491248..492601,492690..493831) [2496...    65   2e-09
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    65   2e-09
TBLA0I01660 Chr9 complement(367039..369207) [2169 bp, 722 aa] {O...    64   2e-09
TPHA0F03220 Chr6 complement(702115..703551) [1437 bp, 478 aa] {O...    64   3e-09
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...    64   3e-09
NCAS0A07500 Chr1 complement(1490789..1493320) [2532 bp, 843 aa] ...    64   3e-09
Smik_1.16 Chr1 complement(37947..39830) [1884 bp, 627 aa] {ON} Y...    64   3e-09
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    64   3e-09
Suva_12.225 Chr12 complement(353202..355328) [2127 bp, 708 aa] {...    64   4e-09
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...    64   4e-09
NCAS0B06630 Chr2 (1257281..1257766) [486 bp, 161 aa] {ON} Anc_2....    59   5e-09
TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.6...    63   5e-09
TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {O...    63   5e-09
SAKL0H07524g Chr8 (653641..654999) [1359 bp, 452 aa] {ON} simila...    62   6e-09
KLTH0F03058g Chr6 (264710..268606) [3897 bp, 1298 aa] {ON} simil...    63   6e-09
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...    63   6e-09
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...    63   6e-09
Ecym_7101 Chr7 (194579..196732) [2154 bp, 717 aa] {ON} similar t...    63   6e-09
NDAI0D04300 Chr4 complement(1008897..1011128) [2232 bp, 743 aa] ...    63   6e-09
ABL193C Chr2 complement(44011..46599) [2589 bp, 862 aa] {ON} Syn...    63   7e-09
KNAG0F00650 Chr6 (110451..114371) [3921 bp, 1306 aa] {ON} Anc_1....    63   8e-09
TDEL0E03320 Chr5 (628671..631238) [2568 bp, 855 aa] {ON} Anc_5.2...    62   9e-09
SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa...    62   1e-08
ZYRO0F16038g Chr6 complement(1315669..1319583) [3915 bp, 1304 aa...    62   1e-08
TPHA0L00240 Chr12 (28408..30606) [2199 bp, 732 aa] {ON} Anc_4.36...    62   1e-08
TBLA0G00180 Chr7 complement(28577..31627) [3051 bp, 1016 aa] {ON...    62   1e-08
NDAI0I01220 Chr9 complement(293892..295994) [2103 bp, 700 aa] {O...    61   2e-08
NCAS0B01310 Chr2 complement(215645..217108) [1464 bp, 487 aa] {O...    61   2e-08
TDEL0E02100 Chr5 complement(395609..397894) [2286 bp, 761 aa] {O...    61   2e-08
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...    61   2e-08
NCAS0A00770 Chr1 (148296..152210) [3915 bp, 1304 aa] {ON} Anc_1....    61   2e-08
TBLA0B05160 Chr2 complement(1214624..1216582) [1959 bp, 652 aa] ...    61   2e-08
TBLA0H01240 Chr8 complement(272947..278334) [5388 bp, 1795 aa] {...    61   2e-08
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    60   3e-08
Kwal_23.4424 s23 complement(713602..716448) [2847 bp, 948 aa] {O...    61   3e-08
KLTH0H04774g Chr8 complement(426645..428621) [1977 bp, 658 aa] {...    60   3e-08
KLTH0D14784g Chr4 (1213137..1215128) [1992 bp, 663 aa] {ON} simi...    60   3e-08
KAFR0G00320 Chr7 complement(101116..103188) [2073 bp, 690 aa] {O...    60   3e-08
TBLA0G01730 Chr7 complement(451840..454089) [2250 bp, 749 aa] {O...    60   3e-08
NDAI0G02820 Chr7 (655932..657287) [1356 bp, 451 aa] {ON} Anc_3.1...    60   4e-08
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...    60   4e-08
ZYRO0G21318g Chr7 complement(1751145..1755509) [4365 bp, 1454 aa...    60   4e-08
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    60   5e-08
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...    60   5e-08
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...    60   5e-08
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...    60   5e-08
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...    60   5e-08
ZYRO0B08536g Chr2 complement(664054..666126) [2073 bp, 690 aa] {...    60   5e-08
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...    60   6e-08
Smik_4.534 Chr4 (963951..966581) [2631 bp, 876 aa] {ON} YDR285W ...    60   6e-08
Suva_2.451 Chr2 (796994..799627) [2634 bp, 877 aa] {ON} YDR285W ...    60   6e-08
Skud_4.548 Chr4 (974878..977511) [2634 bp, 877 aa] {ON} YDR285W ...    60   6e-08
KNAG0D00670 Chr4 complement(98205..99818) [1614 bp, 537 aa] {ON}...    59   6e-08
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    60   7e-08
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}              60   7e-08
TDEL0C03510 Chr3 (612431..616339) [3909 bp, 1302 aa] {ON} Anc_7....    60   7e-08
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...    60   7e-08
Skud_10.357 Chr10 complement(632324..634441) [2118 bp, 705 aa] {...    59   7e-08
AER241W Chr5 (1082034..1084592) [2559 bp, 852 aa] {ON} Syntenic ...    59   8e-08
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    59   9e-08
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....    59   9e-08
CAGL0H03179g Chr8 (298166..300139) [1974 bp, 657 aa] {ON} simila...    59   9e-08
Skud_4.15 Chr4 complement(23550..25922) [2373 bp, 790 aa] {ON} Y...    59   1e-07
KLLA0F00770g Chr6 (65967..67853) [1887 bp, 628 aa] {ON} some sim...    59   1e-07
Skud_1.13 Chr1 complement(30899..32809) [1911 bp, 636 aa] {ON} Y...    59   1e-07
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...    59   1e-07
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....    59   1e-07
SAKL0A05170g Chr1 complement(466816..468768) [1953 bp, 650 aa] {...    59   1e-07
KLLA0D06875g Chr4 complement(591141..592529) [1389 bp, 462 aa] {...    58   1e-07
TDEL0A05820 Chr1 complement(1024897..1026327) [1431 bp, 476 aa] ...    58   1e-07
Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}...    59   1e-07
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    59   2e-07
Kpol_1002.64 s1002 complement(173760..175733) [1974 bp, 657 aa] ...    58   2e-07
NCAS0J02200 Chr10 complement(425055..427178) [2124 bp, 707 aa] {...    58   2e-07
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...    58   2e-07
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    58   2e-07
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....    58   2e-07
KLTH0D10274g Chr4 complement(849747..851162) [1416 bp, 471 aa] {...    57   2e-07
NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {O...    58   2e-07
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    58   2e-07
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    58   3e-07
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....    58   3e-07
TPHA0B02130 Chr2 complement(489226..491211) [1986 bp, 661 aa] {O...    57   3e-07
ZYRO0G16588g Chr7 complement(1356025..1358808) [2784 bp, 927 aa]...    57   3e-07
TDEL0E00510 Chr5 complement(114384..117194) [2811 bp, 936 aa] {O...    57   3e-07
NCAS0G02830 Chr7 complement(520473..521126) [654 bp, 217 aa] {ON...    55   3e-07
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...    57   3e-07
Suva_2.70 Chr2 complement(125732..129874) [4143 bp, 1380 aa] {ON...    57   3e-07
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...    57   4e-07
Skud_7.196 Chr7 (350356..352593) [2238 bp, 745 aa] {ON} YGL086W ...    57   4e-07
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    57   4e-07
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...    57   4e-07
TBLA0E03640 Chr5 complement(911285..911770) [486 bp, 161 aa] {ON...    53   5e-07
TDEL0G02010 Chr7 complement(396217..398130) [1914 bp, 637 aa] {O...    57   5e-07
Kwal_26.8634 s26 complement(875659..877002) [1344 bp, 447 aa] {O...    56   5e-07
NDAI0E02460 Chr5 (509417..510877) [1461 bp, 486 aa] {ON}               56   5e-07
TDEL0C04720 Chr3 complement(855282..858650) [3369 bp, 1122 aa] {...    57   6e-07
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    57   6e-07
ZYRO0C05676g Chr3 complement(434420..436297) [1878 bp, 625 aa] {...    56   6e-07
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    56   6e-07
KLLA0B04136g Chr2 (373969..375975) [2007 bp, 668 aa] {ON} simila...    56   6e-07
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...    56   6e-07
ZYRO0B06182g Chr2 complement(496610..499180) [2571 bp, 856 aa] {...    56   7e-07
TBLA0B00220 Chr2 complement(37191..38792) [1602 bp, 533 aa] {ON}...    56   7e-07
KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some s...    56   7e-07
Smik_15.402 Chr15 complement(697238..698785) [1548 bp, 515 aa] {...    55   9e-07
CAGL0J07348g Chr10 (711496..713091) [1596 bp, 531 aa] {ON} weakl...    55   9e-07
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    56   1e-06
TBLA0C05670 Chr3 complement(1371536..1373419) [1884 bp, 627 aa] ...    55   1e-06
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    55   1e-06
TDEL0G01570 Chr7 complement(309710..311722) [2013 bp, 670 aa] {O...    55   1e-06
TPHA0H02060 Chr8 (487254..489296) [2043 bp, 680 aa] {ON} Anc_6.2...    55   1e-06
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    55   1e-06
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    55   1e-06
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    55   1e-06
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...    55   1e-06
YKL179C Chr11 complement(110464..112503) [2040 bp, 679 aa] {ON} ...    55   1e-06
ZYRO0F06424g Chr6 complement(532056..533414) [1359 bp, 452 aa] {...    55   1e-06
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...    55   1e-06
AGR229W Chr7 (1177911..1180028) [2118 bp, 705 aa] {ON} Syntenic ...    55   1e-06
TPHA0J02260 Chr10 (502547..504697) [2151 bp, 716 aa] {ON} Anc_6....    55   1e-06
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...    55   1e-06
NCAS0B01760 Chr2 (290690..292162) [1473 bp, 490 aa] {ON} Anc_8.6...    55   2e-06
SAKL0H05852g Chr8 (519004..521613) [2610 bp, 869 aa] {ON} weakly...    55   2e-06
SAKL0E12716g Chr5 (1049450..1052215) [2766 bp, 921 aa] {ON} some...    55   2e-06
YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON} ...    55   2e-06
TBLA0B01810 Chr2 complement(410017..414531) [4515 bp, 1504 aa] {...    55   2e-06
TBLA0B07120 Chr2 (1685216..1689904) [4689 bp, 1562 aa] {ON}            55   2e-06
TBLA0A06330 Chr1 complement(1555490..1557406) [1917 bp, 638 aa] ...    55   2e-06
TBLA0C02850 Chr3 (682683..690260) [7578 bp, 2525 aa] {ON} Anc_1....    55   2e-06
Smik_15.385 Chr15 complement(668338..669750) [1413 bp, 470 aa] {...    54   2e-06
Kpol_534.19 s534 (44769..46265) [1497 bp, 498 aa] {ON} (44769..4...    54   2e-06
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...    55   2e-06
Kwal_23.4139 s23 complement(587353..589359) [2007 bp, 668 aa] {O...    54   2e-06
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...    54   3e-06
AAL109W Chr1 (150547..153291) [2745 bp, 914 aa] {ON} Syntenic ho...    54   3e-06
NDAI0E01450 Chr5 (288999..290555) [1557 bp, 518 aa] {ON} Anc_8.6...    54   3e-06
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    54   3e-06
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    54   3e-06
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    54   3e-06
NCAS0A14940 Chr1 (2941337..2945347) [4011 bp, 1336 aa] {ON} Anc_...    54   3e-06
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...    54   3e-06
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...    54   3e-06
CAGL0F00671g Chr6 complement(73893..78593) [4701 bp, 1566 aa] {O...    54   3e-06
Kwal_27.11183 s27 (675668..677650) [1983 bp, 660 aa] {ON} YGL086...    54   3e-06
KLLA0B02981g Chr2 complement(267798..269789) [1992 bp, 663 aa] {...    54   3e-06
NCAS0D03670 Chr4 (684291..686354) [2064 bp, 687 aa] {ON} Anc_6.1...    54   3e-06
NCAS0B08400 Chr2 (1604783..1606876) [2094 bp, 697 aa] {ON} Anc_1...    54   3e-06
KAFR0B05770 Chr2 (1190270..1197952) [7683 bp, 2560 aa] {ON} Anc_...    54   3e-06
KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.6...    54   3e-06
Smik_4.2 Chr4 complement(4408..6789) [2382 bp, 793 aa] {ON} YDL2...    54   3e-06
Skud_15.383 Chr15 complement(686554..688011) [1458 bp, 485 aa] {...    54   3e-06
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    54   4e-06
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    54   4e-06
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    54   4e-06
CAGL0H00638g Chr8 complement(61015..62769) [1755 bp, 584 aa] {ON...    54   4e-06
KLLA0A06402g Chr1 complement(578090..580057) [1968 bp, 655 aa] {...    54   4e-06
CAGL0M08162g Chr13 complement(811750..813732) [1983 bp, 660 aa] ...    54   4e-06
Kpol_YGOB_1055.70 s1055 complement(184555..186555) [2001 bp, 666...    54   4e-06
Kpol_1055.70 s1055 complement(184555..186561) [2007 bp, 668 aa] ...    54   4e-06
Ecym_2795 Chr2 (1542397..1544826) [2430 bp, 809 aa] {ON} similar...    54   5e-06
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...    54   5e-06
YOR216C Chr15 complement(747525..748979) [1455 bp, 484 aa] {ON} ...    53   5e-06
KLLA0C09691g Chr3 (837629..840094) [2466 bp, 821 aa] {ON} weakly...    54   5e-06
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    54   5e-06
ABR149W Chr2 (679580..683260) [3681 bp, 1226 aa] {ON} Syntenic h...    54   5e-06
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    54   5e-06
NDAI0J00530 Chr10 complement(102751..106920) [4170 bp, 1389 aa] ...    54   5e-06
CAGL0M00462g Chr13 (57126..58961) [1836 bp, 611 aa] {ON} similar...    53   5e-06
Suva_7.183 Chr7 (340138..342027) [1890 bp, 629 aa] {ON} YGL086W ...    53   5e-06
SAKL0G15818g Chr7 (1363027..1364970) [1944 bp, 647 aa] {ON} simi...    53   5e-06
CAGL0D00638g Chr4 complement(80947..83028) [2082 bp, 693 aa] {ON...    53   6e-06
TBLA0J00420 Chr10 (76709..78136) [1428 bp, 475 aa] {ON} Anc_8.63...    53   6e-06
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    53   7e-06
Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON} (76145...    53   7e-06
Smik_2.67 Chr2 complement(121714..125847) [4134 bp, 1377 aa] {ON...    53   7e-06
Skud_2.55 Chr2 complement(111625..115797) [4173 bp, 1390 aa] {ON...    53   7e-06
Skud_11.47 Chr11 complement(97012..99048) [2037 bp, 678 aa] {ON}...    53   7e-06
Suva_4.175 Chr4 complement(313538..315640) [2103 bp, 700 aa] {ON...    53   7e-06
YOR198C Chr15 complement(718653..720065) [1413 bp, 470 aa] {ON} ...    52   8e-06
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    53   9e-06
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    53   9e-06
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    53   9e-06
Kwal_47.16674 s47 complement(57126..59048) [1923 bp, 640 aa] {ON...    52   9e-06
Suva_4.378 Chr4 complement(664404..665681) [1278 bp, 425 aa] {ON...    52   9e-06
KAFR0D02510 Chr4 (499589..500869) [1281 bp, 426 aa] {ON} Anc_3.3...    52   9e-06
TDEL0D00520 Chr4 (94918..96915) [1998 bp, 665 aa] {ON} Anc_4.364...    52   9e-06
NDAI0A00830 Chr1 complement(166377..168431) [2055 bp, 684 aa] {O...    52   1e-05
Smik_10.427 Chr10 complement(662836..664956) [2121 bp, 706 aa] {...    52   1e-05
Suva_8.254 Chr8 complement(457591..459003) [1413 bp, 470 aa] {ON...    52   1e-05
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    52   1e-05
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...    52   1e-05
TBLA0G02500 Chr7 complement(648451..652230) [3780 bp, 1259 aa] {...    52   1e-05
Suva_14.117 Chr14 complement(216958..218703) [1746 bp, 581 aa] {...    52   1e-05
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...    52   1e-05
Smik_15.506 Chr15 (875291..880021) [4731 bp, 1576 aa] {ON} YOR32...    52   1e-05
KAFR0G03310 Chr7 (682336..684366) [2031 bp, 676 aa] {ON} Anc_4.2...    52   1e-05
NCAS0G00280 Chr7 (47258..49393) [2136 bp, 711 aa] {ON} Anc_5.696...    52   1e-05
CAGL0J05434g Chr10 (520083..520682) [600 bp, 199 aa] {ON} highly...    50   1e-05
KLLA0D19580g Chr4 (1650584..1652848) [2265 bp, 754 aa] {ON} weak...    52   1e-05
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...    52   1e-05
KAFR0I00250 Chr9 complement(53495..55828) [2334 bp, 777 aa] {ON}...    52   1e-05
Kpol_1049.5 s1049 (10518..12869) [2352 bp, 783 aa] {ON} (10518.....    52   1e-05
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    52   1e-05
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    52   1e-05
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....    52   2e-05
KAFR0E04340 Chr5 complement(874796..876646) [1851 bp, 616 aa] {O...    52   2e-05
Skud_9.24 Chr9 (55176..57248) [2073 bp, 690 aa] {ON} YIL144W (REAL)    52   2e-05
NCAS0C01880 Chr3 complement(346987..349383) [2397 bp, 798 aa] {O...    52   2e-05
KNAG0F03390 Chr6 complement(635419..638046) [2628 bp, 875 aa] {O...    52   2e-05
KAFR0G02060 Chr7 (433290..434786) [1497 bp, 498 aa] {ON} Anc_8.6...    51   2e-05
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    52   2e-05
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    52   2e-05
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    52   2e-05
Ecym_7178 Chr7 (363600..367409) [3810 bp, 1269 aa] {ON} similar ...    52   2e-05
YNL225C Chr14 complement(222724..224469) [1746 bp, 581 aa] {ON} ...    51   2e-05
SAKL0H20174g Chr8 (1764879..1769282) [4404 bp, 1467 aa] {ON} wea...    52   2e-05
KNAG0C00940 Chr3 complement(178596..180593) [1998 bp, 665 aa] {O...    51   2e-05
YIL144W Chr9 (78074..80149) [2076 bp, 691 aa] {ON}  TID3Componen...    51   2e-05
Smik_4.162 Chr4 complement(300502..302598) [2097 bp, 698 aa] {ON...    51   2e-05
CAGL0I01012g Chr9 complement(82834..83682) [849 bp, 282 aa] {ON}...    50   2e-05
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    51   3e-05
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....    51   3e-05
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    51   3e-05
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717      51   3e-05
TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7....    51   3e-05
ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} wea...    51   3e-05
KAFR0G00820 Chr7 complement(203068..205104) [2037 bp, 678 aa] {O...    51   3e-05
Kpol_479.8 s479 complement(16333..17766) [1434 bp, 477 aa] {ON} ...    50   3e-05
TBLA0A09700 Chr1 complement(2385365..2386963) [1599 bp, 532 aa] ...    50   3e-05
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    51   3e-05
TPHA0I02920 Chr9 (639184..642786) [3603 bp, 1200 aa] {ON} Anc_7....    51   3e-05
Suva_8.377 Chr8 (666400..671106) [4707 bp, 1568 aa] {ON} YOR326W...    51   4e-05
Suva_1.17 Chr1 complement(32060..33886) [1827 bp, 608 aa] {ON} Y...    50   4e-05
NCAS0J01230 Chr10 (215105..216064) [960 bp, 319 aa] {ON}               50   4e-05
KLTH0A05544g Chr1 (460303..462198) [1896 bp, 631 aa] {ON} weakly...    50   4e-05
Suva_4.5 Chr4 complement(14500..16401) [1902 bp, 633 aa] {ON} YD...    50   4e-05
AFL065C Chr6 complement(312000..313979) [1980 bp, 659 aa] {ON} S...    50   4e-05
Kpol_489.8 s489 (26766..28883) [2118 bp, 705 aa] {ON} (26766..28...    50   4e-05
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...    50   4e-05
ZYRO0C00814g Chr3 complement(61495..63636) [2142 bp, 713 aa] {ON...    50   4e-05
NDAI0J02920 Chr10 complement(730198..732477) [2280 bp, 759 aa] {...    50   4e-05
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...    50   4e-05
CAGL0G02959g Chr7 (272520..275276) [2757 bp, 918 aa] {ON} simila...    50   4e-05
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...    50   4e-05
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    50   4e-05
Kpol_340.5 s340 complement(8948..10549) [1602 bp, 533 aa] {ON} c...    50   4e-05
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    50   4e-05
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...    50   4e-05
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...    50   4e-05
Smik_5.123 Chr5 complement(172159..176259) [4101 bp, 1366 aa] {O...    50   4e-05
NDAI0A05310 Chr1 (1195094..1199215) [4122 bp, 1373 aa] {ON} Anc_...    50   4e-05
TBLA0B02370 Chr2 (552419..554335) [1917 bp, 638 aa] {ON} Anc_3.1...    50   5e-05
Kwal_26.8487 s26 (806801..808978) [2178 bp, 725 aa] {ON} YOR195W...    50   5e-05
Ecym_2368 Chr2 (715575..717851) [2277 bp, 758 aa] {ON} similar t...    50   5e-05
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...    50   5e-05
SAKL0G06512g Chr7 complement(543956..544978) [1023 bp, 340 aa] {...    49   5e-05
NCAS0C01160 Chr3 (214545..217124) [2580 bp, 859 aa] {ON} Anc_8.7...    50   5e-05
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...    50   5e-05
TBLA0E04090 Chr5 complement(1029923..1031368) [1446 bp, 481 aa] ...    50   5e-05
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...    50   5e-05
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    50   6e-05
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    50   6e-05
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    50   6e-05
NCAS0D00140 Chr4 complement(9836..11644) [1809 bp, 602 aa] {ON} ...    50   6e-05
NDAI0J00960 Chr10 complement(214481..221710) [7230 bp, 2409 aa] ...    50   6e-05
KNAG0L02080 Chr12 complement(371331..373340) [2010 bp, 669 aa] {...    50   6e-05
KNAG0B06780 Chr2 complement(1338912..1340945) [2034 bp, 677 aa] ...    50   6e-05
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...    50   6e-05
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...    50   6e-05
Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W...    49   7e-05
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...    50   7e-05
Skud_16.106 Chr16 complement(192440..195055) [2616 bp, 871 aa] {...    50   7e-05
ZYRO0C17094g Chr3 complement(1327234..1328682) [1449 bp, 482 aa]...    49   7e-05
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    50   7e-05
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    50   7e-05
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    50   8e-05
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...    50   8e-05
KLLA0E17931g Chr5 complement(1598775..1599242,1599482..1599499) ...    47   8e-05
NCAS0C03480 Chr3 (695650..697023) [1374 bp, 457 aa] {ON} Anc_3.1...    49   9e-05
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    49   1e-04
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    49   1e-04
Kpol_1013.69 s1013 complement(167435..171169) [3735 bp, 1244 aa]...    49   1e-04
KNAG0F03650 Chr6 (681394..685188) [3795 bp, 1264 aa] {ON} Anc_7....    49   1e-04
KLTH0E01650g Chr5 complement(159757..163947) [4191 bp, 1396 aa] ...    49   1e-04
Kwal_26.7055 s26 complement(190653..195320) [4668 bp, 1555 aa] {...    49   1e-04
CAGL0I07711g Chr9 (740473..742197) [1725 bp, 574 aa] {ON} weakly...    49   1e-04
ZYRO0G08250g Chr7 (671493..673457) [1965 bp, 654 aa] {ON} simila...    49   1e-04
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    49   1e-04
Suva_11.45 Chr11 complement(95306..97351) [2046 bp, 681 aa] {ON}...    49   1e-04
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...    49   1e-04
TPHA0D01440 Chr4 complement(296591..299176) [2586 bp, 861 aa] {O...    49   1e-04
Kpol_1032.20 s1032 complement(46064..47467) [1404 bp, 467 aa] {O...    49   1e-04
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...    49   1e-04
TBLA0J01890 Chr10 (444942..447923) [2982 bp, 993 aa] {ON}              49   1e-04
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...    49   1e-04
CAGL0K10648g Chr11 complement(1036025..1039063) [3039 bp, 1012 a...    49   1e-04
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    49   1e-04
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    49   1e-04
Skud_14.240 Chr14 (442718..446449) [3732 bp, 1243 aa] {ON} YNL09...    49   1e-04
TBLA0E03950 Chr5 (998042..999973) [1932 bp, 643 aa] {ON} Anc_8.1...    49   1e-04
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    49   1e-04
Ecym_3189 Chr3 complement(364109..366115) [2007 bp, 668 aa] {ON}...    49   1e-04
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    49   1e-04
Kpol_1067.22 s1067 complement(46246..48414) [2169 bp, 722 aa] {O...    49   1e-04
AER424C Chr5 complement(1450443..1450913,1450963..1450980) [489 ...    46   2e-04
CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} simil...    49   2e-04
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...    49   2e-04
CAGL0L12914g Chr12 complement(1379249..1381906) [2658 bp, 885 aa...    49   2e-04
TBLA0F03210 Chr6 complement(779351..780796) [1446 bp, 481 aa] {O...    48   2e-04
Suva_5.26 Chr5 (46040..48943) [2904 bp, 967 aa] {ON} YEL043W (REAL)    49   2e-04
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...    49   2e-04
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    49   2e-04
CAGL0E01265g Chr5 complement(113167..119454) [6288 bp, 2095 aa] ...    49   2e-04
TPHA0I03250 Chr9 complement(715976..717922) [1947 bp, 648 aa] {O...    48   2e-04
Smik_11.51 Chr11 complement(95977..97992) [2016 bp, 671 aa] {ON}...    48   2e-04
KLLA0E13003g Chr5 (1151967..1153988) [2022 bp, 673 aa] {ON} simi...    48   2e-04
Smik_9.25 Chr9 (55776..57854) [2079 bp, 692 aa] {ON} YIL144W (REAL)    48   2e-04
ZYRO0F10714g Chr6 (871970..874096) [2127 bp, 708 aa] {ON} weakly...    48   2e-04
YBR130C Chr2 complement(495592..496869) [1278 bp, 425 aa] {ON}  ...    48   2e-04
TPHA0C02960 Chr3 complement(647899..648384) [486 bp, 161 aa] {ON...    45   2e-04
KAFR0J01770 Chr10 (339037..339522) [486 bp, 161 aa] {ON} Anc_2.2...    45   2e-04
TBLA0E00350 Chr5 (61567..63984) [2418 bp, 805 aa] {ON} Anc_3.546...    48   2e-04
KAFR0H03720 Chr8 (709077..709934) [858 bp, 285 aa] {ON} Anc_1.19...    47   2e-04
TPHA0A03760 Chr1 (821355..824855) [3501 bp, 1166 aa] {ON} Anc_3....    48   2e-04
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...    48   2e-04
Suva_9.45 Chr9 (72816..74882) [2067 bp, 688 aa] {ON} YIL144W (REAL)    48   3e-04
KNAG0A07400 Chr1 complement(1157757..1159022) [1266 bp, 421 aa] ...    47   3e-04
Kwal_23.5662 s23 complement(1259373..1260641) [1269 bp, 422 aa] ...    47   3e-04
Smik_6.371 Chr6 (601287..603902) [2616 bp, 872 aa] {ON} YPL174C ...    48   3e-04
SAKL0E09350g Chr5 complement(778947..779414,779476..779493) [486...    45   3e-04
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...    48   3e-04
SAKL0C03652g Chr3 (344282..347464) [3183 bp, 1060 aa] {ON} weakl...    48   3e-04
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    48   3e-04
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    48   3e-04
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    48   3e-04
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...    48   3e-04
KAFR0C04820 Chr3 complement(956762..958402) [1641 bp, 546 aa] {O...    47   3e-04
NCAS0A00230 Chr1 complement(32748..33881) [1134 bp, 377 aa] {ON}...    47   3e-04
Suva_15.75 Chr15 (118591..120414) [1824 bp, 607 aa] {ON} YOL091W...    47   3e-04
TBLA0C04550 Chr3 (1102139..1102897) [759 bp, 252 aa] {ON}              46   3e-04
NDAI0I00650 Chr9 complement(141492..143537) [2046 bp, 681 aa] {O...    47   3e-04
Skud_15.83 Chr15 (158051..159406) [1356 bp, 451 aa] {ON} YOL069W...    47   4e-04
YOL069W Chr15 (198942..200297) [1356 bp, 451 aa] {ON}  NUF2Compo...    47   4e-04
YPL174C Chr16 complement(220167..222773) [2607 bp, 868 aa] {ON} ...    47   4e-04
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    47   4e-04
Kpol_1002.120 s1002 complement(301247..301732) [486 bp, 161 aa] ...    45   4e-04
Suva_8.269 Chr8 complement(486474..487931) [1458 bp, 485 aa] {ON...    47   4e-04
NCAS0G01370 Chr7 complement(244659..246122) [1464 bp, 487 aa] {O...    47   4e-04
KAFR0J01540 Chr10 complement(277907..281113) [3207 bp, 1068 aa] ...    47   4e-04
NCAS0B02720 Chr2 complement(456271..459615) [3345 bp, 1114 aa] {...    47   4e-04
Kpol_1056.19 s1056 complement(40349..43744) [3396 bp, 1131 aa] {...    47   4e-04
TBLA0G01870 Chr7 complement(493326..496832) [3507 bp, 1168 aa] {...    47   4e-04
NDAI0C04970 Chr3 (1154143..1157751) [3609 bp, 1202 aa] {ON}            47   4e-04
KAFR0B00590 Chr2 complement(117951..121736) [3786 bp, 1261 aa] {...    47   4e-04
NCAS0I00130 Chr9 (9673..14376) [4704 bp, 1567 aa] {ON} Anc_7.68 ...    47   4e-04
Kpol_1032.80 s1032 complement(173475..174347) [873 bp, 290 aa] {...    46   4e-04
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....    47   4e-04
YNL041C Chr14 complement(549468..551987) [2520 bp, 839 aa] {ON} ...    47   5e-04
Smik_14.247 Chr14 complement(458876..459475) [600 bp, 199 aa] {O...    45   5e-04
TDEL0A05540 Chr1 complement(974302..975696) [1395 bp, 464 aa] {O...    47   5e-04
Smik_6.170 Chr6 (280902..283706) [2805 bp, 934 aa] {ON} YGR089W ...    47   5e-04
KLLA0D18799g Chr4 complement(1584644..1586047) [1404 bp, 467 aa]...    47   5e-04
AAR042W Chr1 (416525..417937) [1413 bp, 470 aa] {ON} Syntenic ho...    47   5e-04
Skud_15.365 Chr15 complement(657763..659175) [1413 bp, 470 aa] {...    47   5e-04
Suva_2.311 Chr2 (551150..554047) [2898 bp, 965 aa] {ON} YDR150W ...    47   5e-04
CAGL0I10967g Chr9 complement(1081047..1082474) [1428 bp, 475 aa]...    47   5e-04
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    47   5e-04
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...    47   5e-04
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....    47   5e-04
ZYRO0C15488g Chr3 complement(1209452..1213954) [4503 bp, 1500 aa...    47   5e-04
KLLA0E03477g Chr5 (316716..317579) [864 bp, 287 aa] {ON} conserv...    46   5e-04
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    47   5e-04
Smik_15.65 Chr15 (108429..110267) [1839 bp, 612 aa] {ON} YOL091W...    47   5e-04
Skud_16.26 Chr16 complement(45266..47215) [1950 bp, 650 aa] {ON}...    47   6e-04
KLTH0D17688g Chr4 (1470627..1472669) [2043 bp, 680 aa] {ON} weak...    47   6e-04
Kwal_56.22618 s56 complement(207409..209631) [2223 bp, 740 aa] {...    47   6e-04
TPHA0E00390 Chr5 complement(64714..67113) [2400 bp, 799 aa] {ON}...    47   6e-04
TBLA0G01410 Chr7 complement(371934..374366) [2433 bp, 810 aa] {O...    47   6e-04
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    47   6e-04
TPHA0M00410 Chr13 complement(79537..80919) [1383 bp, 460 aa] {ON...    46   6e-04
Suva_14.260 Chr14 complement(477268..477867) [600 bp, 199 aa] {O...    45   6e-04
Skud_14.251 Chr14 complement(468833..469432) [600 bp, 199 aa] {O...    45   6e-04
YNL079C Chr14 complement(478566..479165) [600 bp, 199 aa] {ON}  ...    45   6e-04
KAFR0L01860 Chr12 complement(342086..344989) [2904 bp, 967 aa] {...    47   6e-04
Kpol_1072.53 s1072 (122356..123771) [1416 bp, 471 aa] {ON} (1223...    46   6e-04
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    47   6e-04
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    47   6e-04
KAFR0J01250 Chr10 complement(230562..234002) [3441 bp, 1146 aa] ...    47   6e-04
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    47   7e-04
Smik_14.236 Chr14 (432694..436392) [3699 bp, 1232 aa] {ON} YNL09...    47   7e-04
KLTH0D02068g Chr4 complement(200288..204958) [4671 bp, 1556 aa] ...    47   7e-04
Kwal_55.21515 s55 complement(868702..870405) [1704 bp, 567 aa] {...    46   7e-04
Suva_13.484 Chr13 (838813..839940) [1128 bp, 375 aa] {ON} YMR294...    46   7e-04
Smik_4.393 Chr4 (716271..717188,717198..718106) [1827 bp, 609 aa...    46   7e-04
YAL047C Chr1 complement(54989..56857) [1869 bp, 622 aa] {ON}  SP...    46   7e-04
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    46   7e-04
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...    46   7e-04
TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1...    46   8e-04
KLTH0D00924g Chr4 complement(87310..89439) [2130 bp, 709 aa] {ON...    46   8e-04
TBLA0E03490 Chr5 complement(868330..870579) [2250 bp, 749 aa] {O...    46   8e-04
Kpol_1018.141 s1018 complement(374392..376686) [2295 bp, 764 aa]...    46   8e-04
YDL239C Chr4 complement(26403..28775) [2373 bp, 790 aa] {ON}  AD...    46   8e-04
ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {...    46   8e-04
Skud_16.199 Chr16 (365262..367796) [2535 bp, 844 aa] {ON} YPL084...    46   8e-04
ZYRO0F01188g Chr6 (94085..96631) [2547 bp, 848 aa] {ON} similar ...    46   8e-04
Ecym_8321 Chr8 complement(652652..653986) [1335 bp, 444 aa] {ON}...    46   8e-04
TPHA0M01780 Chr13 (368492..371146) [2655 bp, 884 aa] {ON} Anc_3....    46   8e-04
ACL086C Chr3 complement(192736..196359) [3624 bp, 1207 aa] {ON} ...    46   9e-04
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...    46   9e-04
NDAI0F03790 Chr6 (900580..902166) [1587 bp, 528 aa] {ON}               46   9e-04
YBR148W Chr2 (537876..539705) [1830 bp, 609 aa] {ON}  YSW1Protei...    46   0.001
KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {...    46   0.001
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...    46   0.001
Ecym_7020 Chr7 complement(37877..39115) [1239 bp, 412 aa] {ON} s...    45   0.001
Suva_5.227 Chr5 (346596..347537) [942 bp, 313 aa] {ON} YER106W (...    45   0.001
SAKL0D14454g Chr4 (1186923..1189358) [2436 bp, 811 aa] {ON} weak...    46   0.001
Kwal_23.4010 s23 complement(525504..528128) [2625 bp, 874 aa] {O...    46   0.001
NCAS0A00840 Chr1 (160625..163525) [2901 bp, 966 aa] {ON} Anc_1.1...    46   0.001
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...    46   0.001
TBLA0B05230 Chr2 complement(1230182..1233130) [2949 bp, 982 aa] ...    46   0.001
Ecym_3434 Chr3 (816557..818017) [1461 bp, 486 aa] {ON} similar t...    45   0.001
NDAI0B03700 Chr2 complement(925092..928517) [3426 bp, 1141 aa] {...    46   0.001
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    46   0.001
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...    46   0.001
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....    46   0.001
KLTH0G08250g Chr7 (672012..675770) [3759 bp, 1252 aa] {ON} some ...    46   0.001
CAGL0F04609g Chr6 (463702..467637) [3936 bp, 1311 aa] {ON} simil...    46   0.001
NCAS0B07600 Chr2 complement(1435998..1439957) [3960 bp, 1319 aa]...    46   0.001
NDAI0H03390 Chr8 (817230..821762) [4533 bp, 1510 aa] {ON} Anc_2....    46   0.001
NDAI0H02420 Chr8 complement(586713..588605) [1893 bp, 630 aa] {O...    45   0.001
KLLA0E04841g Chr5 complement(429714..431624) [1911 bp, 636 aa] {...    45   0.001
SAKL0H20306g Chr8 complement(1779248..1781161) [1914 bp, 637 aa]...    45   0.001
CAGL0G09867g Chr7 complement(942215..944149) [1935 bp, 644 aa] {...    45   0.001
Skud_4.182 Chr4 complement(319563..321665) [2103 bp, 700 aa] {ON...    45   0.001
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...    45   0.001
CAGL0M12254g Chr13 (1222321..1224765) [2445 bp, 814 aa] {ON} wea...    45   0.001
KAFR0C01110 Chr3 complement(225557..226903) [1347 bp, 448 aa] {O...    45   0.001
KLTH0F19734g Chr6 (1599275..1602520) [3246 bp, 1081 aa] {ON} sim...    45   0.001
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    45   0.001
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    45   0.001
NDAI0H02810 Chr8 complement(691568..695029) [3462 bp, 1153 aa] {...    45   0.001
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....    45   0.001
SAKL0B10274g Chr2 (881660..886324) [4665 bp, 1554 aa] {ON} unipr...    45   0.002
YOR326W Chr15 (925721..930445) [4725 bp, 1574 aa] {ON}  MYO2One ...    45   0.002
Skud_14.111 Chr14 complement(211532..213280) [1749 bp, 582 aa] {...    45   0.002
NDAI0G05680 Chr7 complement(1410181..1412061) [1881 bp, 626 aa] ...    45   0.002
Suva_16.511 Chr16 complement(876329..878284) [1956 bp, 651 aa] {...    45   0.002
CAGL0L08338g Chr12 complement(920067..920552) [486 bp, 161 aa] {...    43   0.002
TBLA0D01460 Chr4 complement(360907..361797) [891 bp, 296 aa] {ON...    44   0.002
NDAI0B01380 Chr2 complement(318357..320486) [2130 bp, 709 aa] {O...    45   0.002
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...    45   0.002
AFR364C Chr6 complement(1095524..1097917) [2394 bp, 797 aa] {ON}...    45   0.002
Suva_13.199 Chr13 complement(322643..325165) [2523 bp, 840 aa] {...    45   0.002
NDAI0A01170 Chr1 complement(246363..248897) [2535 bp, 844 aa] {O...    45   0.002
KAFR0B03130 Chr2 complement(649445..651979) [2535 bp, 844 aa] {O...    45   0.002
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    45   0.002
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...    45   0.002
Kpol_1039.26 s1039 (82489..86103) [3615 bp, 1204 aa] {ON} (82489...    45   0.002
Suva_16.53 Chr16 complement(80323..81798) [1476 bp, 491 aa] {ON}...    45   0.002
KLLA0C13794g Chr3 (1178848..1182747) [3900 bp, 1299 aa] {ON} som...    45   0.002
CAGL0L07282g Chr12 complement(807622..808650) [1029 bp, 342 aa] ...    44   0.002
NDAI0B04950 Chr2 complement(1207146..1211363) [4218 bp, 1405 aa]...    45   0.002
Ecym_5126 Chr5 (269547..270581) [1035 bp, 344 aa] {ON} similar t...    44   0.002
CAGL0K06435g Chr11 (630381..635204) [4824 bp, 1607 aa] {ON} weak...    45   0.002
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...    45   0.002
KLTH0B09174g Chr2 (748355..749449) [1095 bp, 364 aa] {ON} weakly...    44   0.002
Kwal_55.19698 s55 (83302..83781) [480 bp, 159 aa] {OFF} [contig ...    42   0.002
Smik_9.31 Chr9 complement(66905..67390) [486 bp, 161 aa] {ON} YI...    42   0.002
NDAI0E02600 Chr5 complement(540099..542687) [2589 bp, 862 aa] {O...    45   0.002
KLLA0C14498g Chr3 complement(1266410..1269187) [2778 bp, 925 aa]...    45   0.002
Suva_7.371 Chr7 (633643..636471) [2829 bp, 942 aa] {ON} YGR089W ...    45   0.002
KLLA0B12133g Chr2 (1058858..1061998) [3141 bp, 1046 aa] {ON} sim...    45   0.002
NDAI0E03400 Chr5 complement(724039..727341) [3303 bp, 1100 aa] {...    45   0.002
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    45   0.002
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...    45   0.002
Suva_5.103 Chr5 (154173..157616) [3444 bp, 1147 aa] {ON} YER013W...    45   0.003
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...    45   0.003
KAFR0B04870 Chr2 (1012538..1014562) [2025 bp, 674 aa] {ON} Anc_2...    44   0.003
AFR495C Chr6 complement(1329555..1331663) [2109 bp, 702 aa] {ON}...    44   0.003
TPHA0H01420 Chr8 complement(318539..320650) [2112 bp, 703 aa] {O...    44   0.003
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...    44   0.003
YKL054C Chr11 complement(336537..338753) [2217 bp, 738 aa] {ON} ...    44   0.003
YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON} ...    44   0.003
ZYRO0C15114g Chr3 (1177152..1177637) [486 bp, 161 aa] {ON} simil...    42   0.003
KLTH0B01232g Chr2 complement(108265..110865) [2601 bp, 866 aa] {...    44   0.003
Smik_8.29 Chr8 complement(61133..62062) [930 bp, 309 aa] {ON} YH...    44   0.003
Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa] ...    44   0.003
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...    44   0.003
AGL058C Chr7 complement(599289..602198) [2910 bp, 969 aa] {ON} N...    44   0.003
Ecym_7269 Chr7 complement(566660..569602) [2943 bp, 980 aa] {ON}...    44   0.003
ZYRO0F10824g Chr6 complement(883483..884865) [1383 bp, 460 aa] {...    44   0.003
Smik_15.362 Chr15 complement(622220..623617) [1398 bp, 465 aa] {...    44   0.003
TPHA0F01220 Chr6 complement(275858..279094) [3237 bp, 1078 aa] {...    44   0.003
Suva_11.21 Chr11 complement(47761..48159,48580..51708) [3528 bp,...    44   0.003
SAKL0G18084g Chr7 complement(1567873..1568871) [999 bp, 332 aa] ...    44   0.003
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...    44   0.004
Kpol_2002.66 s2002 complement(148606..150774) [2169 bp, 722 aa] ...    44   0.004
NDAI0C03640 Chr3 (834228..835439) [1212 bp, 403 aa] {ON} Anc_5.3...    44   0.004
KNAG0D01260 Chr4 complement(211416..213680) [2265 bp, 754 aa] {O...    44   0.004
YMR031C Chr13 complement(332212..334743) [2532 bp, 843 aa] {ON} ...    44   0.004
SAKL0D11990g Chr4 complement(994808..997408) [2601 bp, 866 aa] {...    44   0.004
KNAG0H00590 Chr8 (94345..97116) [2772 bp, 923 aa] {ON} Anc_2.590...    44   0.004
NDAI0B03930 Chr2 (990168..990653) [486 bp, 161 aa] {ON} Anc_2.21...    42   0.004
KNAG0J02310 Chr10 complement(427668..430634) [2967 bp, 988 aa] {...    44   0.004
TPHA0H02660 Chr8 complement(622277..625420) [3144 bp, 1047 aa] {...    44   0.004
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....    44   0.004
Kpol_480.5 s480 complement(10930..12384) [1455 bp, 484 aa] {ON} ...    44   0.004
NDAI0F02570 Chr6 complement(630462..634955) [4494 bp, 1497 aa] {...    44   0.004
NCAS0B03630 Chr2 (643499..650842) [7344 bp, 2447 aa] {ON} Anc_8....    44   0.005
KLTH0H08712g Chr8 complement(756097..757845) [1749 bp, 582 aa] {...    44   0.005
TPHA0G02745 Chr7 complement(583768..585921) [2154 bp, 717 aa] {ON}     44   0.005
Kpol_1026.9 s1026 complement(17746..19992) [2247 bp, 748 aa] {ON...    44   0.005
TBLA0D01050 Chr4 (271605..273953) [2349 bp, 782 aa] {ON} Anc_8.7...    44   0.005
NCAS0G00530 Chr7 (88814..91513) [2700 bp, 899 aa] {ON} Anc_5.658...    44   0.005
ZYRO0B05192g Chr2 complement(420331..421653) [1323 bp, 440 aa] {...    43   0.005
Suva_15.96 Chr15 (171608..172963) [1356 bp, 451 aa] {ON} YOL069W...    43   0.006
SAKL0B08624g Chr2 complement(733369..734733) [1365 bp, 454 aa] {...    43   0.006
AEL015W Chr5 (608518..609885) [1368 bp, 455 aa] {ON} Syntenic ho...    43   0.006
KLTH0G08734g Chr7 complement(713923..714390,714494..714511) [486...    41   0.006
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    44   0.006
Kpol_378.2 s378 (7331..8101) [771 bp, 256 aa] {ON} (7331..8101) ...    42   0.006
NDAI0A08140 Chr1 (1865702..1867156) [1455 bp, 484 aa] {ON}             43   0.006
SAKL0H15136g Chr8 complement(1312258..1316298) [4041 bp, 1346 aa...    44   0.006
Ecym_5067 Chr5 complement(146782..151458) [4677 bp, 1558 aa] {ON...    44   0.006
ADR354W Chr4 (1328354..1333030) [4677 bp, 1558 aa] {ON} Syntenic...    44   0.006
ZYRO0B10362g Chr2 complement(812053..818526) [6474 bp, 2157 aa] ...    44   0.006
KNAG0E02930 Chr5 (588769..590532) [1764 bp, 587 aa] {ON} Anc_2.1...    43   0.006
Kwal_27.11232 s27 (697964..707974) [10011 bp, 3336 aa] {ON} YDR1...    44   0.006
SAKL0H15378g Chr8 complement(1328983..1340172) [11190 bp, 3729 a...    44   0.006
Suva_13.380 Chr13 (640164..641963) [1800 bp, 599 aa] {ON} YMR198...    43   0.006
ZYRO0G16940g Chr7 complement(1392603..1394501) [1899 bp, 632 aa]...    43   0.006
AER074W Chr5 (775019..776950) [1932 bp, 643 aa] {ON} Syntenic ho...    43   0.006
SAKL0C04862g Chr3 complement(466119..468167) [2049 bp, 682 aa] {...    43   0.007
CAGL0M11858g Chr13 (1178837..1179550) [714 bp, 237 aa] {ON} weak...    42   0.007
TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa] ...    43   0.007
ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} simila...    43   0.007
NCAS0C02660 Chr3 complement(495031..497862) [2832 bp, 943 aa] {O...    43   0.007
TPHA0E03680 Chr5 (779557..780873) [1317 bp, 438 aa] {ON} Anc_1.4...    43   0.007
KLLA0B10329g Chr2 (902691..904532) [1842 bp, 613 aa] {ON} weakly...    42   0.007
Suva_16.309 Chr16 complement(539454..540172,540248..540493,54090...    43   0.007
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...    43   0.007
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....    43   0.007
Kpol_197.3 s197 complement(7781..9256) [1476 bp, 491 aa] {ON} co...    43   0.008
TBLA0E03890 Chr5 complement(977425..981744) [4320 bp, 1439 aa] {...    43   0.008
KAFR0E01370 Chr5 (272717..274522) [1806 bp, 601 aa] {ON} Anc_5.3...    43   0.008
TBLA0B02840 Chr2 (655241..657064) [1824 bp, 607 aa] {ON} Anc_8.7...    43   0.008
Skud_15.62 Chr15 (104695..106530) [1836 bp, 611 aa] {ON} YOL091W...    43   0.008
NCAS0A12840 Chr1 complement(2532530..2534368) [1839 bp, 612 aa] ...    43   0.008
KLTH0F04334g Chr6 complement(382773..384677) [1905 bp, 634 aa] {...    43   0.008
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    43   0.009
Kpol_1053.37 s1053 (57362..59596) [2235 bp, 744 aa] {ON} (57362....    43   0.009
TDEL0H04300 Chr8 (739853..742180) [2328 bp, 775 aa] {ON} Anc_7.2...    43   0.009
KLTH0D11902g Chr4 complement(971208..973667) [2460 bp, 819 aa] {...    43   0.009
KAFR0K01510 Chr11 (311581..314298) [2718 bp, 905 aa] {ON} Anc_3....    43   0.009
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    43   0.009
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...    43   0.009
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    43   0.010
Kwal_27.12530 s27 complement(1261137..1264400) [3264 bp, 1087 aa...    43   0.010
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    43   0.010
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    43   0.010
ZYRO0B12518g Chr2 (1009363..1010334) [972 bp, 323 aa] {ON} simil...    42   0.010
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    41   0.010
Skud_15.493 Chr15 (865472..870196) [4725 bp, 1574 aa] {ON} YOR32...    43   0.010
YIL138C Chr9 complement(89230..89715) [486 bp, 161 aa] {ON}  TPM...    40   0.010
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...    43   0.010
Suva_11.248 Chr11 (453665..455284) [1620 bp, 539 aa] {ON} YKR016...    42   0.010
Kwal_56.23256 s56 complement(468118..469821) [1704 bp, 567 aa] {...    42   0.011
Sklu_YGOB_Anc_5.296 Chr7 (891742..892812) [1071 bp, 356 aa] {ON}...    42   0.011
YOL091W Chr15 (145334..147163) [1830 bp, 609 aa] {ON}  SPO21Comp...    42   0.011
Kwal_23.5731 s23 complement(1296239..1298104) [1866 bp, 621 aa] ...    42   0.011
TBLA0B00890 Chr2 complement(197208..199166) [1959 bp, 652 aa] {O...    42   0.011
Skud_15.440 Chr15 complement(777845..779860) [2016 bp, 671 aa] {...    42   0.011
KAFR0D02270 Chr4 (459308..461437) [2130 bp, 709 aa] {ON} Anc_5.6...    42   0.011
TPHA0A00730 Chr1 (131951..134104) [2154 bp, 717 aa] {ON} Anc_3.1...    42   0.011
TDEL0A06490 Chr1 complement(1135618..1137783) [2166 bp, 721 aa] ...    42   0.012
NDAI0E04380 Chr5 (990651..992933) [2283 bp, 760 aa] {ON} Anc_7.3...    42   0.012
NDAI0C02690 Chr3 (625861..628203) [2343 bp, 780 aa] {ON} Anc_6.3...    42   0.012
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...    42   0.012
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...    42   0.012
Skud_12.111 Chr12 complement(219890..222556) [2667 bp, 888 aa] {...    42   0.012
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...    42   0.012
NDAI0G01310 Chr7 complement(290871..293945) [3075 bp, 1024 aa] {...    42   0.012
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    42   0.013
YKL201C Chr11 complement(63930..67466) [3537 bp, 1178 aa] {ON}  ...    42   0.013
Suva_14.249 Chr14 (451061..454795) [3735 bp, 1244 aa] {ON} YNL09...    42   0.013
NCAS0G02720 Chr7 (487110..491003) [3894 bp, 1297 aa] {ON} Anc_2....    42   0.013
Kwal_26.8516 s26 complement(820299..821723) [1425 bp, 474 aa] {O...    42   0.013
Kpol_1029.17 s1029 (32401..36405) [4005 bp, 1334 aa] {ON} (32401...    42   0.013
SAKL0C03410g Chr3 (321385..325407) [4023 bp, 1340 aa] {ON} simil...    42   0.013
KAFR0B04690 Chr2 complement(977296..981438) [4143 bp, 1380 aa] {...    42   0.013
TBLA0A10600 Chr1 complement(2623051..2624499) [1449 bp, 482 aa] ...    42   0.013
TPHA0G00920 Chr7 complement(173183..177376) [4194 bp, 1397 aa] {...    42   0.013
Smik_4.43 Chr4 complement(83111..84703) [1593 bp, 530 aa] {ON} Y...    42   0.014
ADL022C Chr4 complement(660327..670505) [10179 bp, 3392 aa] {ON}...    42   0.014
NDAI0A00460 Chr1 complement(80213..81943) [1731 bp, 576 aa] {ON}...    42   0.014
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    42   0.015
TPHA0E02810 Chr5 complement(587446..589374) [1929 bp, 642 aa] {O...    42   0.015
ZYRO0G14652g Chr7 complement(1172048..1174063) [2016 bp, 671 aa]...    42   0.015
KNAG0E04130 Chr5 (818796..820829) [2034 bp, 677 aa] {ON} Anc_7.2...    42   0.015
KAFR0F03620 Chr6 complement(716398..718497) [2100 bp, 699 aa] {O...    42   0.015
CAGL0H01331g Chr8 complement(130263..132407) [2145 bp, 714 aa] {...    42   0.015
Kwal_26.6821 s26 complement(77837..80014) [2178 bp, 725 aa] {ON}...    42   0.015
KLTH0C09966g Chr3 (823260..825542) [2283 bp, 760 aa] {ON} conser...    42   0.015
SAKL0G14850g Chr7 (1270484..1273090) [2607 bp, 868 aa] {ON} simi...    42   0.016
TPHA0B00500 Chr2 complement(109658..112504) [2847 bp, 948 aa] {O...    42   0.016
TBLA0B04370 Chr2 complement(1010226..1013075) [2850 bp, 949 aa] ...    42   0.016
TDEL0C05300 Chr3 complement(943838..945118) [1281 bp, 426 aa] {O...    42   0.016
TBLA0I00160 Chr9 complement(18521..21808) [3288 bp, 1095 aa] {ON...    42   0.017
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    42   0.017
CAGL0K09834g Chr11 complement(960893..964855) [3963 bp, 1320 aa]...    42   0.017
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...    42   0.017
ACR101C Chr3 complement(534019..535467) [1449 bp, 482 aa] {ON} S...    42   0.017
ABL103W Chr2 (205066..206019) [954 bp, 317 aa] {ON} Syntenic hom...    41   0.017
Kpol_1009.17 s1009 (37274..41821) [4548 bp, 1515 aa] {ON} (37274...    42   0.017
Kwal_23.3059 s23 complement(138649..139194) [546 bp, 181 aa] {ON...    40   0.018
TPHA0A02470 Chr1 (528174..529766) [1593 bp, 530 aa] {ON} Anc_3.3...    42   0.018
TDEL0F04560 Chr6 (855489..862637) [7149 bp, 2382 aa] {ON} Anc_8....    42   0.018
Smik_4.137 Chr4 (259959..260975) [1017 bp, 338 aa] {ON} YDL099W ...    41   0.018
KLLA0F12386g Chr6 complement(1140511..1141605) [1095 bp, 364 aa]...    41   0.019
ZYRO0C08030g Chr3 (616547..618682) [2136 bp, 711 aa] {ON} simila...    42   0.020
TBLA0I01560 Chr9 complement(340408..341091) [684 bp, 227 aa] {ON...    40   0.020
Kwal_26.8312 s26 complement(735774..738464) [2691 bp, 896 aa] {O...    42   0.021
SAKL0B06380g Chr2 complement(545026..548034) [3009 bp, 1002 aa] ...    42   0.021
KAFR0F01030 Chr6 complement(191735..194971) [3237 bp, 1078 aa] {...    42   0.022
YNL091W Chr14 (452408..456130) [3723 bp, 1240 aa] {ON}  NST1Prot...    42   0.022
KLLA0F13420g Chr6 (1240135..1244145) [4011 bp, 1336 aa] {ON} uni...    42   0.022
Skud_11.249 Chr11 (450052..451668) [1617 bp, 538 aa] {ON} YKR016...    41   0.024
KLTH0G15334g Chr7 (1343754..1345502) [1749 bp, 582 aa] {ON} cons...    41   0.024
TDEL0A07030 Chr1 (1229629..1231527) [1899 bp, 632 aa] {ON} Anc_6...    41   0.025
TPHA0A03870 Chr1 complement(853599..855521) [1923 bp, 640 aa] {O...    41   0.025
KNAG0E01670 Chr5 complement(336548..337033) [486 bp, 161 aa] {ON...    39   0.025
Skud_7.295 Chr7 complement(512515..514464) [1950 bp, 649 aa] {ON...    41   0.025
Smik_11.206 Chr11 (344948..346039) [1092 bp, 363 aa] {ON} YKL042...    41   0.025
TDEL0E01020 Chr5 complement(208284..210287) [2004 bp, 667 aa] {O...    41   0.025
KAFR0I01600 Chr9 (335090..337192) [2103 bp, 700 aa] {ON} Anc_2.5...    41   0.026
KAFR0C01340 Chr3 complement(279474..281588) [2115 bp, 704 aa] {O...    41   0.026
KLLA0D12584g Chr4 complement(1066032..1068155) [2124 bp, 707 aa]...    41   0.026
YLR319C Chr12 complement(769318..771684) [2367 bp, 788 aa] {ON} ...    41   0.027
TBLA0D04830 Chr4 complement(1184707..1185909) [1203 bp, 400 aa] ...    41   0.027
NDAI0A07640 Chr1 (1756757..1759429) [2673 bp, 890 aa] {ON}             41   0.027
TPHA0D00840 Chr4 complement(169497..172547) [3051 bp, 1016 aa] {...    41   0.028
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...    41   0.028
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    41   0.028
CAGL0M02409g Chr13 complement(283059..284402) [1344 bp, 447 aa] ...    41   0.029
NCAS0A10990 Chr1 complement(2188430..2191987) [3558 bp, 1185 aa]...    41   0.029
TDEL0D04730 Chr4 complement(867639..869009) [1371 bp, 456 aa] {O...    41   0.029
Suva_5.96 Chr5 complement(143615..147583) [3969 bp, 1322 aa] {ON...    41   0.029
TBLA0G02190 Chr7 complement(568903..573144) [4242 bp, 1413 aa] {...    41   0.029
Kpol_1012.11 s1012 (25467..25895,25897..26913) [1446 bp, 481 aa]...    41   0.030
ZYRO0D04158g Chr4 (336740..341503) [4764 bp, 1587 aa] {ON} simil...    41   0.030
SAKL0G00616g Chr7 complement(59495..60487) [993 bp, 330 aa] {ON}...    40   0.031
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    41   0.032
Kpol_1036.24 s1036 complement(59431..60216) [786 bp, 261 aa] {ON...    40   0.033
KLTH0G06160g Chr7 (485950..487806) [1857 bp, 618 aa] {ON} simila...    41   0.033
YPL253C Chr16 complement(71063..73006) [1944 bp, 647 aa] {ON}  V...    41   0.033
TDEL0B02260 Chr2 (408913..410901) [1989 bp, 662 aa] {ON} Anc_5.6...    41   0.033
KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.8...    41   0.033
CAGL0E04972g Chr5 complement(480915..482930) [2016 bp, 671 aa] {...    41   0.033
TDEL0C04830 Chr3 (875334..877403) [2070 bp, 689 aa] {ON} Anc_3.3...    41   0.034
KNAG0F02120 Chr6 complement(403190..405319) [2130 bp, 709 aa] {O...    41   0.034
CAGL0H05357g Chr8 complement(514513..516825) [2313 bp, 770 aa] {...    41   0.035
KLLA0C12573g Chr3 (1068765..1071257) [2493 bp, 830 aa] {ON} simi...    41   0.035
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    41   0.036
CAGL0F06369g Chr6 complement(628054..630723) [2670 bp, 889 aa] {...    41   0.036
Kpol_1045.30 s1045 (68925..71675) [2751 bp, 916 aa] {ON} (68927....    41   0.036
NCAS0I02870 Chr9 complement(532862..534100) [1239 bp, 412 aa] {O...    40   0.036
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...    41   0.036
Kpol_1018.21 s1018 (56444..57697) [1254 bp, 417 aa] {ON} (56444....    40   0.036
TDEL0D03220 Chr4 (600997..603954) [2958 bp, 985 aa] {ON} Anc_3.3...    41   0.036
TBLA0C05760 Chr3 (1397735..1399000) [1266 bp, 421 aa] {ON} Anc_1...    40   0.037
Smik_2.270 Chr2 complement(480391..481668) [1278 bp, 425 aa] {ON...    40   0.037
Kwal_47.16881 s47 complement(156308..157603) [1296 bp, 431 aa] {...    40   0.037
ADL307W Chr4 (155322..158540) [3219 bp, 1072 aa] {ON} Syntenic h...    41   0.037
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    41   0.037
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    41   0.037
ZYRO0C15686g Chr3 complement(1228374..1231691) [3318 bp, 1105 aa...    41   0.037
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...    41   0.037
Skud_11.19 Chr11 complement(47376..50876) [3501 bp, 1166 aa] {ON...    41   0.038
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...    41   0.038
Skud_15.344 Chr15 complement(616669..618066) [1398 bp, 465 aa] {...    40   0.038
NDAI0C03260 Chr3 (740705..742180) [1476 bp, 491 aa] {ON} Anc_5.8...    40   0.039
Kpol_541.47 s541 (151235..151846) [612 bp, 203 aa] {ON} (151235....    39   0.040
Kwal_27.11697 s27 complement(909030..910601) [1572 bp, 523 aa] {...    40   0.040
AGR043W Chr7 (787120..798057) [10938 bp, 3645 aa] {ON} Syntenic ...    41   0.041
ZYRO0G20262g Chr7 complement(1674553..1675179) [627 bp, 208 aa] ...    39   0.042
KAFR0A06570 Chr1 (1331473..1333203) [1731 bp, 576 aa] {ON} Anc_4...    40   0.042
NDAI0B02390 Chr2 complement(599601..601472) [1872 bp, 623 aa] {O...    40   0.043
Ecym_2129 Chr2 complement(238725..240635) [1911 bp, 636 aa] {ON}...    40   0.043
NCAS0H02580 Chr8 (512845..514755) [1911 bp, 636 aa] {ON} Anc_5.5...    40   0.043
YDL074C Chr4 complement(324047..326149) [2103 bp, 700 aa] {ON}  ...    40   0.044
KLTH0E08492g Chr5 complement(773530..775734) [2205 bp, 734 aa] {...    40   0.045
NDAI0F02950 Chr6 (722002..722562) [561 bp, 186 aa] {ON} Anc_2.13...    39   0.046
KLLA0C06116g Chr3 complement(536524..538881) [2358 bp, 785 aa] {...    40   0.046
Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {O...    40   0.046
Ecym_2137 Chr2 complement(252320..254815) [2496 bp, 831 aa] {ON}...    40   0.046
KLTH0F12144g Chr6 complement(1023571..1026102) [2532 bp, 843 aa]...    40   0.046
TPHA0B02800 Chr2 complement(636209..638764) [2556 bp, 851 aa] {O...    40   0.047
Smik_13.181 Chr13 (299161..300354) [1194 bp, 397 aa] {ON} YMR017...    40   0.047
KLLA0C01474g Chr3 complement(111545..112765) [1221 bp, 406 aa] {...    40   0.047
TBLA0B02490 Chr2 (571880..574615) [2736 bp, 911 aa] {ON} Anc_3.3...    40   0.047
KLTH0E09108g Chr5 (823623..826409) [2787 bp, 928 aa] {ON} some s...    40   0.047
YGR089W Chr7 (656960..659770) [2811 bp, 936 aa] {ON}  NNF2Protei...    40   0.047
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...    40   0.047
Skud_12.334 Chr12 complement(590993..591565) [573 bp, 190 aa] {O...    39   0.047
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...    40   0.047
NDAI0E03160 Chr5 complement(673686..676526) [2841 bp, 946 aa] {O...    40   0.047
Kpol_397.11 s397 (32117..34993) [2877 bp, 958 aa] {ON} (32117..3...    40   0.048
KNAG0G00970 Chr7 (203236..206256) [3021 bp, 1006 aa] {ON} Anc_8....    40   0.048
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...    40   0.048
NCAS0A01200 Chr1 (236349..237635) [1287 bp, 428 aa] {ON} Anc_5.237     40   0.049
KLTH0E14784g Chr5 complement(1313245..1316493) [3249 bp, 1082 aa...    40   0.049
TBLA0B02580 Chr2 (588481..591882) [3402 bp, 1133 aa] {ON} Anc_3....    40   0.049
CAGL0B00924g Chr2 complement(81492..82808) [1317 bp, 438 aa] {ON...    40   0.049
Kpol_2002.41 s2002 complement(81923..83242) [1320 bp, 439 aa] {O...    40   0.049
Skud_3.33 Chr3 complement(56442..57770) [1329 bp, 442 aa] {ON} Y...    40   0.049
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    40   0.050
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...    40   0.050
TPHA0B01370 Chr2 complement(304248..308387) [4140 bp, 1379 aa] {...    40   0.050
TBLA0A03650 Chr1 complement(911358..915677) [4320 bp, 1439 aa] {...    40   0.051
NDAI0A04970 Chr1 (1131663..1133069) [1407 bp, 468 aa] {ON} Anc_3...    40   0.051
TBLA0D01500 Chr4 (374387..375796) [1410 bp, 469 aa] {ON} Anc_5.5...    40   0.051
Kpol_413.9 s413 (23927..28999) [5073 bp, 1690 aa] {ON} (23927..2...    40   0.051
CAGL0L10626g Chr12 (1136212..1137753) [1542 bp, 513 aa] {ON} som...    40   0.053
Kpol_282.3 s282 (6337..7932) [1596 bp, 531 aa] {ON} (6337..7932)...    40   0.053
Kpol_1051.34 s1051 complement(81976..83598) [1623 bp, 540 aa] {O...    40   0.054
Skud_13.366 Chr13 (633641..635425) [1785 bp, 594 aa] {ON} YMR198...    40   0.056
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    40   0.056
NCAS0D04290 Chr4 (812757..814610) [1854 bp, 617 aa] {ON} Anc_6.2...    40   0.056
CAGL0C05577g Chr3 (536419..538278) [1860 bp, 619 aa] {ON} weakly...    40   0.056
ZYRO0D01100g Chr4 (84898..86826) [1929 bp, 642 aa] {ON} similar ...    40   0.057
Ecym_3368 Chr3 (700956..702965) [2010 bp, 669 aa] {ON} similar t...    40   0.058
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    40   0.058
KNAG0F00130 Chr6 complement(7147..8238) [1092 bp, 363 aa] {ON} A...    40   0.058
Kpol_1060.36 s1060 (86412..88643) [2232 bp, 743 aa] {ON} (86412....    40   0.059
Suva_2.659 Chr2 complement(1176734..1179154) [2421 bp, 806 aa] {...    40   0.060
Suva_9.51 Chr9 complement(83968..84453) [486 bp, 161 aa] {ON} YI...    38   0.062
TDEL0G01450 Chr7 (290625..293444) [2820 bp, 939 aa] {ON} Anc_6.2...    40   0.062
KLLA0D03718g Chr4 (318725..319957) [1233 bp, 410 aa] {ON} weakly...    40   0.062
YLR423C Chr12 complement(971917..973170) [1254 bp, 417 aa] {ON} ...    40   0.063
NCAS0A03860 Chr1 (784217..785479) [1263 bp, 420 aa] {ON} Anc_8.1...    40   0.063
SAKL0C13772g Chr3 (1211712..1214984) [3273 bp, 1090 aa] {ON} sim...    40   0.064
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    40   0.064
CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} simil...    40   0.064
Smik_11.136 Chr11 complement(225921..229253) [3333 bp, 1110 aa] ...    40   0.064
KNAG0H00820 Chr8 (127894..131364) [3471 bp, 1156 aa] {ON} Anc_3....    40   0.064
Suva_16.378 Chr16 complement(667893..671423) [3531 bp, 1176 aa] ...    40   0.064
TBLA0H02840 Chr8 (664282..665604) [1323 bp, 440 aa] {ON}               40   0.065
KLLA0E05787g Chr5 (515081..518767) [3687 bp, 1228 aa] {ON} weakl...    40   0.065
KAFR0K00750 Chr11 (169761..171143) [1383 bp, 460 aa] {ON} Anc_7....    40   0.066
KLLA0F21758g Chr6 complement(2023805..2028523) [4719 bp, 1572 aa...    40   0.067
Kpol_YGOB_1012.11 s1012 (25467..25886,25888..26913) [1446 bp, 48...    40   0.067
TBLA0J00690 Chr10 (157822..163251) [5430 bp, 1809 aa] {ON} Anc_5...    40   0.068
SAKL0G12804g Chr7 complement(1091709..1097228) [5520 bp, 1839 aa...    40   0.068
AFR702W Chr6 (1735187..1736680) [1494 bp, 497 aa] {ON} Syntenic ...    40   0.068
Kpol_274.4 s274 (5051..6838) [1788 bp, 595 aa] {ON} (5051..6838)...    40   0.073
TBLA0A01720 Chr1 (414871..416682) [1812 bp, 603 aa] {ON} Anc_8.4...    40   0.073
Suva_2.461 Chr2 complement(817421..819445) [2025 bp, 674 aa] {ON...    40   0.076
KAFR0H00740 Chr8 (139077..140207) [1131 bp, 376 aa] {ON} Anc_3.3...    39   0.078
Skud_12.403 Chr12 complement(710260..712629) [2370 bp, 789 aa] {...    40   0.079
Kpol_367.10 s367 (35401..36213) [813 bp, 270 aa] {ON} (35401..36...    39   0.079
AAL085C Chr1 complement(192432..193783,193783..194932) [2502 bp,...    40   0.080
Skud_13.186 Chr13 complement(318929..321460) [2532 bp, 843 aa] {...    40   0.080
TBLA0I02840 Chr9 complement(668598..671168) [2571 bp, 856 aa] {O...    40   0.080
TDEL0F03070 Chr6 (559392..562025) [2634 bp, 877 aa] {ON} Anc_3.4...    40   0.080
ADR373W Chr4 (1369498..1372386) [2889 bp, 962 aa] {ON} Syntenic ...    40   0.082
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...    40   0.082
Skud_14.195 Chr14 (360526..361788) [1263 bp, 420 aa] {ON} YNL136...    39   0.083
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    40   0.084
TDEL0C04310 Chr3 complement(770014..770499) [486 bp, 161 aa] {ON...    38   0.084
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    40   0.084
SAKL0H06952g Chr8 complement(609523..610884) [1362 bp, 453 aa] {...    39   0.086
TBLA0G01790 Chr7 complement(464679..468977) [4299 bp, 1432 aa] {...    40   0.087
NDAI0G05870 Chr7 (1456354..1457745) [1392 bp, 463 aa] {ON} Anc_1...    39   0.087
NDAI0J02550 Chr10 (629573..631012) [1440 bp, 479 aa] {ON} Anc_4....    39   0.089
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...    40   0.089
TBLA0A08000 Chr1 (1980261..1980980) [720 bp, 239 aa] {ON} Anc_5....    39   0.091
Skud_4.60 Chr4 complement(102282..103841) [1560 bp, 519 aa] {ON}...    39   0.091
YKR016W Chr11 (469717..471339) [1623 bp, 540 aa] {ON}  FCJ1Mitoc...    39   0.093
Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa]...    40   0.093
KAFR0I00540 Chr9 (111521..113239) [1719 bp, 572 aa] {ON} Anc_4.3...    39   0.095
CAGL0L05698g Chr12 (628965..629975) [1011 bp, 336 aa] {ON} simil...    39   0.096
Smik_4.447 Chr4 complement(809898..811712) [1815 bp, 604 aa] {ON...    39   0.096
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...    39   0.097
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    39   0.099
Kwal_55.19733 s55 (99488..101518) [2031 bp, 676 aa] {ON} YIL144W...    39   0.099
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    39   0.10 
ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weak...    39   0.10 
TPHA0B01260 Chr2 (281006..283360) [2355 bp, 784 aa] {ON} Anc_1.2...    39   0.10 
ADR400W Chr4 (1423238..1425628) [2391 bp, 796 aa] {ON} Syntenic ...    39   0.10 
Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON} (1441...    39   0.10 
Kpol_1025.17 s1025 (46552..49041) [2490 bp, 829 aa] {ON} (46552....    39   0.10 
KAFR0A02280 Chr1 complement(473811..476303) [2493 bp, 830 aa] {O...    39   0.10 
NCAS0D00650 Chr4 complement(111678..114257) [2580 bp, 859 aa] {O...    39   0.11 
NCAS0E01180 Chr5 complement(225933..228776) [2844 bp, 947 aa] {O...    39   0.11 
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...    39   0.11 
Suva_4.319 Chr4 complement(562745..565642) [2898 bp, 965 aa] {ON...    39   0.11 
NDAI0A00750 Chr1 complement(144773..151225) [6453 bp, 2150 aa] {...    33   0.11 
CAGL0M12144g Chr13 (1212803..1215718) [2916 bp, 971 aa] {ON} hig...    39   0.11 
NDAI0H01240 Chr8 complement(298365..299039) [675 bp, 224 aa] {ON...    38   0.11 
TPHA0D04340 Chr4 complement(932744..934045) [1302 bp, 433 aa] {O...    39   0.11 
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...    39   0.11 
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...    39   0.11 
KLLA0B08327g Chr2 (742205..746809) [4605 bp, 1534 aa] {ON} simil...    39   0.11 
TBLA0J01910 Chr10 (448704..454556) [5853 bp, 1950 aa] {ON} Anc_7...    39   0.12 
NCAS0B08810 Chr2 (1692462..1693919) [1458 bp, 485 aa] {ON} Anc_1...    39   0.12 
Suva_16.136 Chr16 complement(230590..232062) [1473 bp, 490 aa] {...    39   0.12 
YDR150W Chr4 (755628..763874) [8247 bp, 2748 aa] {ON}  NUM1Prote...    39   0.12 
TPHA0M00680 Chr13 (129702..130646) [945 bp, 314 aa] {ON} Anc_3.1...    39   0.12 
KLLA0C15235g Chr3 complement(1325851..1327485) [1635 bp, 544 aa]...    39   0.12 
TBLA0C00680 Chr3 complement(134587..136227) [1641 bp, 546 aa] {O...    39   0.12 
NDAI0H01010 Chr8 (224416..225141) [726 bp, 241 aa] {ON} Anc_5.59...    38   0.12 
TPHA0C01930 Chr3 (438203..439906) [1704 bp, 567 aa] {ON} Anc_8.4...    39   0.12 
TPHA0G02270 Chr7 (461474..462208) [735 bp, 244 aa] {ON} Anc_2.42...    38   0.12 
Kwal_27.11410 s27 complement(792024..793019) [996 bp, 331 aa] {O...    39   0.13 
Suva_4.397 Chr4 (707076..708917) [1842 bp, 613 aa] {ON} YBR148W ...    39   0.13 
TBLA0C01020 Chr3 complement(201774..203645) [1872 bp, 623 aa] {O...    39   0.13 
KLLA0C10483g Chr3 (897356..899260) [1905 bp, 634 aa] {ON} simila...    39   0.13 
NDAI0J00340 Chr10 complement(56120..58030) [1911 bp, 636 aa] {ON...    39   0.13 
NDAI0F01180 Chr6 complement(284217..286136) [1920 bp, 639 aa] {O...    39   0.13 
AEL136C Chr5 complement(367453..369381) [1929 bp, 642 aa] {ON} S...    39   0.13 
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    39   0.13 
TPHA0A04760 Chr1 complement(1079032..1081032) [2001 bp, 666 aa] ...    39   0.13 
KLLA0C18359g Chr3 (1622747..1624840) [2094 bp, 697 aa] {ON} simi...    39   0.13 
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...    39   0.13 
TBLA0A08900 Chr1 (2186029..2188221) [2193 bp, 730 aa] {ON} Anc_4...    39   0.13 
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...    39   0.13 
Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {O...    39   0.13 
TPHA0C02300 Chr3 complement(519246..520355) [1110 bp, 369 aa] {O...    39   0.13 
Ecym_5020 Chr5 complement(43098..45470) [2373 bp, 790 aa] {ON} s...    39   0.14 
Suva_10.279 Chr10 (490526..492937) [2412 bp, 803 aa] {ON} YLR182...    39   0.14 
TPHA0H00930 Chr8 complement(192292..194943) [2652 bp, 883 aa] {O...    39   0.14 
Kpol_1059.15 s1059 (35836..38529) [2694 bp, 897 aa] {ON} (35836....    39   0.14 
TPHA0C04070 Chr3 complement(876703..877347) [645 bp, 214 aa] {ON...    38   0.14 
Skud_7.385 Chr7 (642159..644966) [2808 bp, 935 aa] {ON} YGR089W ...    39   0.14 
CAGL0M01804g Chr13 (211439..214294) [2856 bp, 951 aa] {ON} highl...    39   0.14 
Smik_1.29 Chr1 (59406..62372) [2967 bp, 988 aa] {ON} YAL035W (REAL)    39   0.14 
TPHA0A02930 Chr1 complement(635681..636922) [1242 bp, 413 aa] {O...    39   0.14 
KAFR0A08660 Chr1 (1735466..1738753) [3288 bp, 1095 aa] {ON} Anc_...    39   0.14 
KLTH0F11396g Chr6 (967691..968962) [1272 bp, 423 aa] {ON} some s...    39   0.14 
Smik_16.292 Chr16 complement(537812..541357) [3546 bp, 1181 aa] ...    39   0.15 
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...    39   0.15 
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    39   0.15 
Suva_13.256 Chr13 complement(403199..403867) [669 bp, 222 aa] {O...    38   0.15 
KNAG0M01840 Chr13 complement(341241..345116) [3876 bp, 1291 aa] ...    39   0.15 
KLTH0H08602g Chr8 (744917..749275) [4359 bp, 1452 aa] {ON} weakl...    39   0.15 
NDAI0A01120 Chr1 complement(236062..240519) [4458 bp, 1485 aa] {...    39   0.15 
KNAG0C04600 Chr3 complement(903342..904697) [1356 bp, 451 aa] {O...    39   0.15 
CAGL0H00594g Chr8 (57283..58644) [1362 bp, 453 aa] {ON} weakly s...    39   0.15 
KLLA0A03905g Chr1 complement(345818..350470) [4653 bp, 1550 aa] ...    39   0.15 
AAR147W Chr1 (608865..613607) [4743 bp, 1580 aa] {ON} Syntenic h...    39   0.15 
TBLA0F00350 Chr6 (81759..83177) [1419 bp, 472 aa] {ON} Anc_3.214...    39   0.15 
Skud_9.29 Chr9 complement(66341..66826) [486 bp, 161 aa] {ON} YI...    37   0.15 
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      39   0.15 
NCAS0C01380 Chr3 (253465..254163) [699 bp, 232 aa] {ON} Anc_8.61...    38   0.16 
NDAI0K01770 Chr11 (395335..396270) [936 bp, 311 aa] {ON} Anc_2.5...    38   0.16 
CAGL0G07711g Chr7 (732457..734019) [1563 bp, 520 aa] {ON} simila...    39   0.16 
CAGL0M04719g Chr13 complement(510921..511862) [942 bp, 313 aa] {...    38   0.16 
TDEL0A00580 Chr1 complement(99187..100875) [1689 bp, 562 aa] {ON...    39   0.16 
KAFR0F00150 Chr6 complement(46123..47844) [1722 bp, 573 aa] {ON}...    39   0.16 
Kwal_33.13556 s33 (280291..282030) [1740 bp, 580 aa] {OFF} YNL24...    39   0.16 
Kwal_YGOB_33.13556 s33 (280291..282063) [1773 bp, 591 aa] {ON} A...    39   0.16 
NCAS0A09270 Chr1 complement(1831820..1832827) [1008 bp, 335 aa] ...    38   0.17 
KLLA0C03784g Chr3 (344101..345969) [1869 bp, 622 aa] {ON} weakly...    39   0.17 
TPHA0D00910 Chr4 (180414..182294) [1881 bp, 626 aa] {ON} Anc_8.1...    39   0.17 
KNAG0M01630 Chr13 (289388..291340) [1953 bp, 650 aa] {ON} Anc_5....    39   0.17 
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...    39   0.17 
TBLA0E04110 Chr5 complement(1035628..1037751) [2124 bp, 707 aa] ...    39   0.17 
TBLA0B05740 Chr2 (1356539..1358689) [2151 bp, 716 aa] {ON} Anc_5...    39   0.17 
Smik_4.395 Chr4 (718191..718436) [246 bp, 82 aa] {ON} YBL047C (R...    35   0.17 
Skud_11.186 Chr11 (338133..339227) [1095 bp, 364 aa] {ON} YKL042...    38   0.18 
TPHA0L01860 Chr12 complement(388495..390885) [2391 bp, 796 aa] {...    39   0.18 
KAFR0I00620 Chr9 complement(125349..127802) [2454 bp, 817 aa] {O...    39   0.18 
AFL161C Chr6 complement(128026..130515) [2490 bp, 829 aa] {ON} S...    39   0.18 
TPHA0A04290 Chr1 complement(965764..966903) [1140 bp, 379 aa] {O...    38   0.18 
Kpol_269.2 s269 (2702..5299) [2598 bp, 865 aa] {ON} (2702..5299)...    39   0.18 
KNAG0F02180 Chr6 complement(414832..417456) [2625 bp, 874 aa] {O...    39   0.18 
SAKL0D00418g Chr4 (34574..37228) [2655 bp, 884 aa] {ON} similar ...    39   0.18 
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...    38   0.18 
YCR037C Chr3 complement(194414..197185) [2772 bp, 923 aa] {ON}  ...    39   0.18 
KLTH0D08558g Chr4 complement(715949..718741) [2793 bp, 930 aa] {...    39   0.18 
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...    36   0.18 
TBLA0A09060 Chr1 complement(2233745..2234386) [642 bp, 213 aa] {...    37   0.18 
TPHA0A02530 Chr1 complement(541907..543100) [1194 bp, 397 aa] {O...    38   0.18 
TDEL0C04040 Chr3 complement(707532..710555) [3024 bp, 1007 aa] {...    39   0.19 
KLLA0D18821g Chr4 (1586393..1586854) [462 bp, 153 aa] {ON} simil...    37   0.19 
YGR142W Chr7 (772454..773686) [1233 bp, 410 aa] {ON}  BTN2v-SNAR...    38   0.19 
CAGL0D04246g Chr4 complement(417103..417753) [651 bp, 216 aa] {O...    37   0.19 
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...    39   0.19 
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...    39   0.19 
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    39   0.19 
TBLA0C02340 Chr3 complement(554335..557685) [3351 bp, 1116 aa] {...    39   0.19 
KNAG0E02580 Chr5 complement(509587..513030) [3444 bp, 1147 aa] {...    39   0.19 
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...    39   0.19 
TPHA0K00130 Chr11 (17764..21999) [4236 bp, 1411 aa] {ON} Anc_5.5...    39   0.19 
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    39   0.20 
KNAG0A04320 Chr1 complement(591254..595846) [4593 bp, 1530 aa] {...    39   0.20 
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...    38   0.20 
KAFR0D01140 Chr4 complement(225762..230420) [4659 bp, 1552 aa] {...    39   0.20 
Kpol_316.1 s316 complement(395..2935,2937..5180) [4785 bp, 1594 ...    39   0.20 
Ecym_5282 Chr5 (572467..573837) [1371 bp, 456 aa] {ON} similar t...    38   0.20 
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...    38   0.20 
NCAS0B02730 Chr2 complement(459931..464904) [4974 bp, 1657 aa] {...    39   0.20 
Kpol_1031.7 s1031 (14919..19916) [4998 bp, 1665 aa] {ON} (14919....    39   0.20 
TPHA0A01520 Chr1 complement(296953..302685) [5733 bp, 1910 aa] {...    39   0.20 
Kwal_55.21831 s55 (996564..997244) [681 bp, 226 aa] {ON} YOR078W...    37   0.20 
NDAI0B05390 Chr2 complement(1313930..1326160) [12231 bp, 4076 aa...    39   0.21 
NDAI0H02720 Chr8 complement(671139..671843) [705 bp, 234 aa] {ON...    37   0.21 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    38   0.21 
Kpol_526.15 s526 (43631..45349) [1719 bp, 572 aa] {ON} (43631..4...    38   0.21 
Smik_2.287 Chr2 (522414..524273) [1860 bp, 619 aa] {ON} YBR148W ...    38   0.22 
TBLA0C01800 Chr3 (425478..426410,426412..427365) [1887 bp, 628 a...    38   0.22 
Smik_15.457 Chr15 complement(788706..790682) [1977 bp, 658 aa] {...    38   0.22 
TBLA0B03680 Chr2 (848989..850977) [1989 bp, 662 aa] {ON} Anc_8.7...    38   0.22 
Kpol_1004.71 s1004 complement(152942..154954) [2013 bp, 670 aa] ...    38   0.22 
Skud_2.68 Chr2 complement(135267..137171,137172..137384) [2118 b...    38   0.23 
YMR192W Chr13 (647118..649280) [2163 bp, 720 aa] {ON}  GYL1Putat...    38   0.23 
Skud_13.359 Chr13 (621124..623334) [2211 bp, 736 aa] {ON} YMR192...    38   0.23 
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9         38   0.23 
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    38   0.23 
KLLA0A03509g Chr1 complement(318067..320397) [2331 bp, 776 aa] {...    38   0.23 
Kpol_1053.30 s1053 (46793..49177) [2385 bp, 794 aa] {ON} (46793....    38   0.23 
NDAI0C04010 Chr3 complement(912963..914075) [1113 bp, 370 aa] {O...    38   0.23 
AFR604C Chr6 complement(1528397..1530934) [2538 bp, 845 aa] {ON}...    38   0.24 
Kpol_1002.72 s1002 complement(192029..194572) [2544 bp, 847 aa] ...    38   0.24 
YPL105C Chr16 complement(352863..355412) [2550 bp, 849 aa] {ON} ...    38   0.24 
Kpol_1010.46 s1010 complement(101192..103756) [2565 bp, 854 aa] ...    38   0.24 
KAFR0H01520 Chr8 complement(280214..282796) [2583 bp, 860 aa] {O...    38   0.24 
Kpol_1010.72 s1010 (178801..179937) [1137 bp, 378 aa] {ON} (1788...    38   0.24 
KAFR0H03620 Chr8 (688084..688084,688241..690834) [2595 bp, 864 a...    38   0.24 
NDAI0C05690 Chr3 (1315886..1318501) [2616 bp, 871 aa] {ON} Anc_8...    38   0.24 
YLR045C Chr12 complement(235037..237703) [2667 bp, 888 aa] {ON} ...    38   0.24 
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    38   0.24 
TPHA0H00430 Chr8 complement(86587..87216) [630 bp, 209 aa] {ON} ...    37   0.24 
Skud_13.468 Chr13 (830417..831577) [1161 bp, 386 aa] {ON} YMR294...    38   0.24 
Smik_5.50 Chr5 (72674..75550) [2877 bp, 958 aa] {ON} YEL043W (REAL)    38   0.24 
KAFR0A08090 Chr1 complement(1623348..1626242) [2895 bp, 964 aa] ...    38   0.24 
NCAS0B07520 Chr2 (1418653..1419834) [1182 bp, 393 aa] {ON}             38   0.24 
SAKL0B03872g Chr2 complement(342546..345728) [3183 bp, 1060 aa] ...    38   0.25 
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    38   0.25 
Smik_1.107 Chr1 (171768..175307) [3540 bp, 1179 aa] {ON} YAR042W...    38   0.25 
KAFR0H01060 Chr8 (192119..195664) [3546 bp, 1181 aa] {ON} Anc_3....    38   0.25 
Kpol_1039.23 s1039 complement(70067..73954) [3888 bp, 1295 aa] {...    38   0.25 
TBLA0J00140 Chr10 (15936..16781) [846 bp, 281 aa] {ON} Anc_7.531...    37   0.25 
NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.34...    37   0.25 
CAGL0F03971g Chr6 (386224..390591) [4368 bp, 1455 aa] {ON} weakl...    38   0.26 
Kwal_47.18287 s47 complement(766156..767484) [1329 bp, 442 aa] {...    38   0.26 
TPHA0J03190 Chr10 complement(697463..698317) [855 bp, 284 aa] {O...    37   0.26 
TDEL0G02860 Chr7 (551435..552292) [858 bp, 285 aa] {ON} Anc_2.35...    37   0.26 
NDAI0C04960 Chr3 (1148694..1153595) [4902 bp, 1633 aa] {ON} Anc_...    38   0.26 
NCAS0C02810 Chr3 (531673..533052) [1380 bp, 459 aa] {ON} Anc_8.4...    38   0.26 
KAFR0H02830 Chr8 complement(539280..540695) [1416 bp, 471 aa] {O...    38   0.26 
KLLA0D16566g Chr4 (1399913..1407328) [7416 bp, 2471 aa] {ON} wea...    38   0.27 
KLTH0G12144g Chr7 complement(1020201..1030949) [10749 bp, 3582 a...    38   0.27 
KAFR0H01630 Chr8 (305054..306703) [1650 bp, 549 aa] {ON} Anc_8.4...    38   0.28 
NCAS0E02780 Chr5 (549396..551111) [1716 bp, 571 aa] {ON} Anc_7.3...    38   0.28 
TBLA0A01380 Chr1 complement(326864..327577) [714 bp, 237 aa] {ON...    37   0.28 
TPHA0H00790 Chr8 (162043..163785) [1743 bp, 580 aa] {ON} Anc_3.1...    38   0.28 
NCAS0A10060 Chr1 (2011707..2013479) [1773 bp, 590 aa] {ON} Anc_3...    38   0.28 
YDR200C Chr4 complement(854279..856093) [1815 bp, 604 aa] {ON}  ...    38   0.29 
NCAS0G01040 Chr7 complement(179805..181631) [1827 bp, 608 aa] {O...    38   0.29 
NCAS0A08680 Chr1 complement(1716853..1718706) [1854 bp, 617 aa] ...    38   0.29 
KAFR0A07210 Chr1 (1458996..1460918) [1923 bp, 640 aa] {ON} Anc_6...    38   0.29 
NCAS0C00920 Chr3 (166192..168159) [1968 bp, 655 aa] {ON} Anc_8.7...    38   0.29 
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    38   0.30 
Ecym_3250 Chr3 complement(473064..475115) [2052 bp, 683 aa] {ON}...    38   0.30 
TPHA0E03390 Chr5 (719360..721417) [2058 bp, 685 aa] {ON} Anc_1.1...    38   0.30 
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...    38   0.30 
TPHA0B01780 Chr2 (395221..396279) [1059 bp, 352 aa] {ON} Anc_4.3...    37   0.30 
Smik_13.397 Chr13 (631479..633656) [2178 bp, 725 aa] {ON} YMR192...    38   0.30 
Suva_13.411 Chr13 complement(703383..705641) [2259 bp, 752 aa] {...    38   0.30 
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    38   0.30 
KLLA0A09867g Chr1 (864111..865193) [1083 bp, 360 aa] {ON} simila...    37   0.30 
Smik_12.404 Chr12 complement(707440..709794) [2355 bp, 784 aa] {...    38   0.30 
NDAI0D04920 Chr4 (1169676..1170188) [513 bp, 170 aa] {ON} Anc_4....    36   0.31 
SAKL0A02816g Chr1 complement(254792..257407) [2616 bp, 871 aa] {...    38   0.31 
Kpol_1002.17 s1002 complement(45456..48299) [2844 bp, 947 aa] {O...    38   0.32 
CAGL0H05929g Chr8 (582132..584999) [2868 bp, 955 aa] {ON} some s...    38   0.32 
TPHA0A00740 Chr1 (134562..137474) [2913 bp, 970 aa] {ON} Anc_3.1...    38   0.32 
Suva_4.204 Chr4 complement(359600..360229) [630 bp, 209 aa] {ON}...    37   0.32 
TDEL0A00240 Chr1 complement(39383..42562) [3180 bp, 1059 aa] {ON...    38   0.32 
TBLA0F01680 Chr6 complement(418052..421234) [3183 bp, 1060 aa] {...    38   0.32 
KLLA0C10967g Chr3 (943312..944514) [1203 bp, 400 aa] {ON} simila...    37   0.32 
TPHA0E01620 Chr5 complement(329373..332666) [3294 bp, 1097 aa] {...    38   0.32 
KLTH0B00990g Chr2 (86383..87597) [1215 bp, 404 aa] {ON} similar ...    37   0.32 
SAKL0B07062g Chr2 complement(611326..614658) [3333 bp, 1110 aa] ...    38   0.32 
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    38   0.32 
ZYRO0B12892g Chr2 (1039950..1040765) [816 bp, 271 aa] {ON} simil...    37   0.33 
TPHA0B01730 Chr2 complement(385899..387152) [1254 bp, 417 aa] {O...    37   0.33 
Suva_2.394 Chr2 (697318..701532) [4215 bp, 1404 aa] {ON} YDR227W...    38   0.33 
KLLA0F01320g Chr6 complement(123277..124602) [1326 bp, 441 aa] {...    37   0.34 
SAKL0A07546g Chr1 complement(665410..670134) [4725 bp, 1574 aa] ...    38   0.34 
Smik_3.48 Chr3 complement(70262..71590) [1329 bp, 442 aa] {ON} Y...    37   0.34 
KNAG0B06430 Chr2 (1266215..1267555) [1341 bp, 446 aa] {ON} Anc_4...    37   0.34 
Kwal_56.22860 s56 complement(305227..306570) [1344 bp, 447 aa] {...    37   0.34 
CAGL0J04906g Chr10 complement(466782..468128) [1347 bp, 448 aa] ...    37   0.34 
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...    35   0.34 
CAGL0H10164g Chr8 complement(991125..992579) [1455 bp, 484 aa] {...    37   0.35 
TPHA0E03840 Chr5 complement(808740..810215) [1476 bp, 491 aa] {O...    37   0.35 
Kwal_55.20629 s55 complement(497100..497654) [555 bp, 184 aa] {O...    36   0.35 
NCAS0B02980 Chr2 (514099..515658) [1560 bp, 519 aa] {ON} Anc_8.4...    37   0.36 
NDAI0B03970 Chr2 complement(1001308..1002891) [1584 bp, 527 aa] ...    37   0.36 
Skud_16.160 Chr16 (293660..295324) [1665 bp, 554 aa] {ON} YPL120...    37   0.37 
TBLA0D04700 Chr4 complement(1164422..1166146) [1725 bp, 574 aa] ...    37   0.37 
KLLA0E01475g Chr5 complement(143257..144213) [957 bp, 318 aa] {O...    37   0.37 
SAKL0F10824g Chr6 (844268..846073) [1806 bp, 601 aa] {ON} simila...    37   0.38 
TPHA0N01340 Chr14 complement(291919..292917) [999 bp, 332 aa] {O...    37   0.38 
NDAI0E00760 Chr5 (158141..159145) [1005 bp, 334 aa] {ON} Anc_8.7...    37   0.38 
Kpol_1070.27 s1070 complement(60990..62939) [1950 bp, 649 aa] {O...    37   0.38 
NDAI0C02240 Chr3 complement(502165..504162) [1998 bp, 665 aa] {O...    37   0.39 
Kpol_1055.22 s1055 (53408..54433) [1026 bp, 341 aa] {ON} (53408....    37   0.39 
Smik_10.252 Chr10 (399101..401155) [2055 bp, 684 aa] {ON} YJL019...    37   0.39 
Ecym_8240 Chr8 complement(492932..495018,495139..495139) [2088 b...    37   0.39 
NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1...    37   0.39 
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...    37   0.39 
TPHA0L00610 Chr12 (106262..108382) [2121 bp, 706 aa] {ON} Anc_7....    37   0.39 
NCAS0C05590 Chr3 complement(1132608..1134791) [2184 bp, 727 aa] ...    37   0.39 
CAGL0F05159g Chr6 (525230..527617) [2388 bp, 795 aa] {ON} simila...    37   0.40 
YLR182W Chr12 (517940..520351) [2412 bp, 803 aa] {ON}  SWI6Trans...    37   0.40 
Suva_11.183 Chr11 (341481..342575) [1095 bp, 364 aa] {ON} YKL042...    37   0.40 
KAFR0E02010 Chr5 (397131..399647) [2517 bp, 838 aa] {ON} Anc_5.1...    37   0.41 
CAGL0F00803g Chr6 (88454..90970) [2517 bp, 838 aa] {ON} similar ...    37   0.41 
Skud_14.290 Chr14 complement(533440..535959) [2520 bp, 839 aa] {...    37   0.41 
NDAI0C05190 Chr3 (1205357..1207927) [2571 bp, 856 aa] {ON} Anc_8...    37   0.41 
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    37   0.41 
YMR054W Chr13 (383303..385975) [2673 bp, 890 aa] {ON}  STV1Subun...    37   0.41 
ZYRO0A03278g Chr1 (264444..267179) [2736 bp, 911 aa] {ON} simila...    37   0.41 
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...    37   0.41 
ZYRO0D10494g Chr4 complement(880439..883555) [3117 bp, 1038 aa] ...    37   0.42 
TBLA0E02560 Chr5 complement(645365..646555) [1191 bp, 396 aa] {O...    37   0.42 
NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3....    37   0.42 
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....    37   0.42 
ZYRO0E07260g Chr5 complement(551290..554739) [3450 bp, 1149 aa] ...    37   0.43 
Suva_16.200 Chr16 complement(350324..353983) [3660 bp, 1219 aa] ...    37   0.43 
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    37   0.43 
Kwal_26.9097 s26 complement(1073425..1074240) [816 bp, 271 aa] {...    37   0.43 
TDEL0B01860 Chr2 complement(331604..332854) [1251 bp, 416 aa] {O...    37   0.43 
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...    37   0.43 
TDEL0C04640 Chr3 complement(838217..842107) [3891 bp, 1296 aa] {...    37   0.43 
KNAG0L00830 Chr12 complement(145662..149741) [4080 bp, 1359 aa] ...    37   0.43 
KAFR0K01770 Chr11 complement(366906..371042) [4137 bp, 1378 aa] ...    37   0.44 
KLTH0H09240g Chr8 (796183..796234,796342..796934) [645 bp, 214 a...    36   0.44 
NDAI0A08650 Chr1 (1993764..1998506) [4743 bp, 1580 aa] {ON} Anc_...    37   0.44 
YCL029C Chr3 complement(68599..69921) [1323 bp, 440 aa] {ON}  BI...    37   0.44 
Suva_4.97 Chr4 (178752..180089) [1338 bp, 445 aa] {ON} YDL147W (...    37   0.44 
TPHA0I02610 Chr9 complement(573932..575278) [1347 bp, 448 aa] {O...    37   0.45 
TBLA0B09420 Chr2 (2240096..2240638) [543 bp, 180 aa] {ON} Anc_2....    36   0.45 
KAFR0A07940 Chr1 (1590563..1592155) [1593 bp, 530 aa] {ON} Anc_2...    37   0.47 
SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar ...    37   0.49 
CAGL0M03905g Chr13 (437944..439704) [1761 bp, 586 aa] {ON} simil...    37   0.49 
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    37   0.49 
SAKL0B02354g Chr2 (228276..229238) [963 bp, 320 aa] {ON} conserv...    37   0.49 
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    37   0.49 
Smik_16.259 Chr16 (470185..472002) [1818 bp, 605 aa] {ON} YPR018...    37   0.49 
KNAG0H00530 Chr8 complement(85687..86169) [483 bp, 160 aa] {ON} ...    35   0.50 
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...    37   0.50 
NDAI0G03560 Chr7 complement(855635..857566) [1932 bp, 643 aa] {O...    37   0.50 
KAFR0B00360 Chr2 (81284..83215) [1932 bp, 643 aa] {ON} Anc_7.535...    37   0.50 
SAKL0F15994g Chr6 complement(1293064..1294998) [1935 bp, 644 aa]...    37   0.50 
NCAS0A01840 Chr1 complement(353929..355866) [1938 bp, 645 aa] {O...    37   0.50 
KAFR0C03180 Chr3 complement(636764..638713) [1950 bp, 649 aa] {O...    37   0.50 
TBLA0G01880 Chr7 (497716..499671) [1956 bp, 651 aa] {ON} Anc_2.5...    37   0.50 
Skud_16.483 Chr16 complement(836307..838274) [1968 bp, 655 aa] {...    37   0.50 
TBLA0D01130 Chr4 (289830..291818) [1989 bp, 662 aa] {ON} Anc_8.7...    37   0.51 
NDAI0K02740 Chr11 complement(615510..616232) [723 bp, 240 aa] {O...    36   0.51 
NDAI0H01260 Chr8 (304590..305600) [1011 bp, 336 aa] {ON} Anc_5.5...    37   0.51 
SAKL0E14740g Chr5 complement(1216985..1219024) [2040 bp, 679 aa]...    37   0.51 
NDAI0C00620 Chr3 complement(118964..121021) [2058 bp, 685 aa] {O...    37   0.51 
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...    37   0.51 
NDAI0C00550 Chr3 complement(100689..101738) [1050 bp, 349 aa] {O...    37   0.52 
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...    37   0.52 
KNAG0A01960 Chr1 (155185..157449) [2265 bp, 754 aa] {ON} Anc_8.5...    37   0.52 
TBLA0G00570 Chr7 (120848..123202) [2355 bp, 784 aa] {ON} Anc_4.1...    37   0.52 
Skud_12.248 Chr12 (464584..466986) [2403 bp, 800 aa] {ON} YLR182...    37   0.53 
Skud_2.165 Chr2 complement(303570..305999) [2430 bp, 809 aa] {ON...    37   0.53 
Kpol_2001.55 s2001 complement(149236..151980) [2745 bp, 914 aa] ...    37   0.54 
KAFR0K00380 Chr11 (82200..85001) [2802 bp, 933 aa] {ON} Anc_6.20...    37   0.54 
Skud_16.30 Chr16 complement(50752..53643) [2892 bp, 963 aa] {ON}...    37   0.54 
NDAI0E03890 Chr5 complement(853042..855999) [2958 bp, 985 aa] {O...    37   0.55 
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    37   0.55 
KAFR0F01350 Chr6 complement(264531..267707) [3177 bp, 1058 aa] {...    37   0.55 
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    37   0.55 
KLLA0F14124g Chr6 (1305690..1308992) [3303 bp, 1100 aa] {ON} sim...    37   0.55 
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...    37   0.56 
Kpol_1036.98 s1036 (258065..258685) [621 bp, 206 aa] {ON} (25806...    36   0.56 
KNAG0B00700 Chr2 complement(130358..131572) [1215 bp, 404 aa] {O...    37   0.56 
TPHA0P00930 Chr16 complement(187009..190944) [3936 bp, 1311 aa] ...    37   0.57 
Kwal_23.3864 s23 (465097..466368) [1272 bp, 423 aa] {ON} YBR130C...    37   0.57 
KNAG0C00520 Chr3 complement(85639..86910) [1272 bp, 423 aa] {ON}...    37   0.57 
Suva_13.371 Chr13 complement(621139..625512) [4374 bp, 1457 aa] ...    37   0.57 
Smik_14.238 Chr14 (437861..442330) [4470 bp, 1489 aa] {ON} YNL08...    37   0.57 
TBLA0J01860 Chr10 complement(429301..433824) [4524 bp, 1507 aa] ...    37   0.58 
TBLA0C00580 Chr3 (107861..109168) [1308 bp, 435 aa] {ON} Anc_8.8...    37   0.58 
TBLA0F03300 Chr6 complement(808450..813378) [4929 bp, 1642 aa] {...    37   0.58 
ZYRO0F11220g Chr6 complement(918059..919393) [1335 bp, 444 aa] {...    37   0.58 
TBLA0A01670 Chr1 complement(396377..401803) [5427 bp, 1808 aa] {...    37   0.58 
Suva_2.570 Chr2 (1011195..1012535) [1341 bp, 446 aa] {ON} YDR393...    37   0.59 
NCAS0C04220 Chr3 complement(866036..867403) [1368 bp, 455 aa] {O...    37   0.59 
AGL106C Chr7 complement(504816..506228) [1413 bp, 470 aa] {ON} S...    37   0.60 
TDEL0C06560 Chr3 (1204545..1205957) [1413 bp, 470 aa] {ON} Anc_1...    37   0.60 
Ecym_4261 Chr4 (543956..555052) [11097 bp, 3698 aa] {ON} similar...    37   0.61 
KLLA0A05621g Chr1 complement(516514..528711) [12198 bp, 4065 aa]...    37   0.61 
Skud_6.130 Chr6 complement(227074..228588) [1515 bp, 504 aa] {ON...    37   0.61 
CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 ...    37   0.61 
Suva_2.332 Chr2 (584351..585871) [1521 bp, 506 aa] {ON} YDR168W ...    37   0.61 
SAKL0C01496g Chr3 complement(128271..129794) [1524 bp, 507 aa] {...    37   0.61 
Ecym_5271 Chr5 complement(556773..557693) [921 bp, 306 aa] {ON} ...    36   0.63 
YGR023W Chr7 (529264..530919) [1656 bp, 551 aa] {ON}  MTL1Putati...    37   0.63 
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    37   0.64 
NCAS0B03020 Chr2 complement(519918..521741) [1824 bp, 607 aa] {O...    37   0.65 
KNAG0A03050 Chr1 complement(374568..375266) [699 bp, 232 aa] {ON...    36   0.65 
YPR179C Chr16 complement(893797..895764) [1968 bp, 655 aa] {ON} ...    37   0.66 
Smik_16.443 Chr16 complement(756453..758426) [1974 bp, 657 aa] {...    37   0.66 
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     37   0.66 
NDAI0J02340 Chr10 complement(572358..574559) [2202 bp, 733 aa] {...    37   0.68 
KNAG0E03170 Chr5 complement(632635..634875) [2241 bp, 746 aa] {O...    37   0.68 
TBLA0A01840 Chr1 (447415..449661) [2247 bp, 748 aa] {ON} Anc_6.1...    37   0.68 
Ecym_3565 Chr3 (1072011..1074380) [2370 bp, 789 aa] {ON} similar...    37   0.69 
Suva_4.282 Chr4 complement(499405..501493,501971..502326) [2445 ...    37   0.69 
CAGL0K08404g Chr11 complement(846867..849335) [2469 bp, 822 aa] ...    37   0.69 
KLLA0E16897g Chr5 (1500700..1503177) [2478 bp, 825 aa] {ON} high...    37   0.69 
NCAS0A06820 Chr1 (1350166..1352661) [2496 bp, 831 aa] {ON} Anc_5...    37   0.70 
Smik_13.200 Chr13 complement(326426..328939) [2514 bp, 837 aa] {...    37   0.70 
TBLA0B04240 Chr2 (977985..980519) [2535 bp, 844 aa] {ON} Anc_8.6...    37   0.70 
SAKL0H01232g Chr8 complement(133275..134372) [1098 bp, 365 aa] {...    36   0.70 
YKL050C Chr11 complement(342852..345620) [2769 bp, 922 aa] {ON} ...    37   0.71 
KLLA0D04774g Chr4 (406024..408846) [2823 bp, 940 aa] {ON} some s...    37   0.71 
ABR035C Chr2 complement(461280..464225) [2946 bp, 981 aa] {ON} S...    37   0.72 
TBLA0B04730 Chr2 complement(1106452..1109436) [2985 bp, 994 aa] ...    37   0.72 
KNAG0L01820 Chr12 complement(330442..333621) [3180 bp, 1059 aa] ...    37   0.72 
YOL145C Chr15 complement(49555..52788) [3234 bp, 1077 aa] {ON}  ...    37   0.72 
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...    37   0.73 
TDEL0F01580 Chr6 complement(288032..291721) [3690 bp, 1229 aa] {...    37   0.74 
Smik_9.43 Chr9 (95836..99915) [4080 bp, 1359 aa] {ON} YIL126W (R...    37   0.75 
TBLA0A10610 Chr1 (2624948..2626219) [1272 bp, 423 aa] {ON} Anc_2...    36   0.75 
YNL136W Chr14 (370368..371645) [1278 bp, 425 aa] {ON}  EAF7Subun...    36   0.75 
Skud_2.258 Chr2 complement(463205..464494) [1290 bp, 429 aa] {ON...    36   0.76 
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    36   0.76 
KAFR0H02460 Chr8 (470593..471933) [1341 bp, 446 aa] {ON} Anc_8.6...    36   0.77 
KNAG0B06440 Chr2 complement(1267685..1274248) [6564 bp, 2187 aa]...    37   0.78 
SAKL0F06424g Chr6 (490525..497946) [7422 bp, 2473 aa] {ON} simil...    37   0.78 
SAKL0D07920g Chr4 (659019..659546) [528 bp, 175 aa] {ON} similar...    35   0.78 
CAGL0F05489g Chr6 (553902..555365) [1464 bp, 487 aa] {ON} simila...    36   0.80 
TBLA0C06610 Chr3 (1596684..1598171) [1488 bp, 495 aa] {ON} Anc_5...    36   0.80 
KAFR0J02360 Chr10 (448781..450274) [1494 bp, 497 aa] {ON} Anc_6....    36   0.80 
TBLA0A04530 Chr1 complement(1120174..1121670) [1497 bp, 498 aa] ...    36   0.80 
NCAS0F00710 Chr6 (139427..140308) [882 bp, 293 aa] {ON} Anc_7.47...    36   0.81 
TPHA0C01360 Chr3 (309327..310937) [1611 bp, 536 aa] {ON} Anc_7.2...    36   0.82 
TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa] ...    36   0.83 
Suva_8.39 Chr8 complement(79457..80374) [918 bp, 305 aa] {ON} YH...    36   0.83 
NDAI0I03060 Chr9 (723481..725163) [1683 bp, 560 aa] {ON} Anc_3.5...    36   0.83 
Kwal_14.2183 s14 complement(647952..649676) [1725 bp, 574 aa] {O...    36   0.84 
Smik_7.31 Chr7 (62391..64133) [1743 bp, 580 aa] {ON} YGL228W (REAL)    36   0.84 
Smik_15.490 Chr15 complement(844395..846164) [1770 bp, 589 aa] {...    36   0.84 
YDL153C Chr4 complement(181186..183018) [1833 bp, 610 aa] {ON}  ...    36   0.85 
TPHA0G01910 Chr7 (397265..398221) [957 bp, 318 aa] {ON} Anc_2.35...    36   0.85 
KAFR0E02570 Chr5 complement(527199..528155) [957 bp, 318 aa] {ON...    36   0.85 
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    36   0.85 
TPHA0K02200 Chr11 complement(469540..471408) [1869 bp, 622 aa] {...    36   0.86 
KNAG0F03900 Chr6 complement(736561..738615) [2055 bp, 684 aa] {O...    36   0.88 
NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON...    36   0.88 
Skud_13.393 Chr13 complement(692641..694725) [2085 bp, 694 aa] {...    36   0.88 
NCAS0I02880 Chr9 (534759..536939) [2181 bp, 726 aa] {ON} Anc_1.1...    36   0.89 
KLLA0C12969g Chr3 (1098631..1100904) [2274 bp, 757 aa] {ON} simi...    36   0.90 
NCAS0B02510 Chr2 complement(418829..421171) [2343 bp, 780 aa] {O...    36   0.90 
Suva_10.415 Chr10 complement(730376..732751) [2376 bp, 791 aa] {...    36   0.90 
NCAS0H00940 Chr8 complement(175140..176195) [1056 bp, 351 aa] {O...    36   0.91 
SAKL0E02926g Chr5 (238748..241171) [2424 bp, 807 aa] {ON} some s...    36   0.91 
CAGL0G01496g Chr7 complement(140652..143150) [2499 bp, 832 aa] {...    36   0.91 
Suva_4.430 Chr4 complement(756076..758643) [2568 bp, 855 aa] {ON...    36   0.92 
CAGL0B04169g Chr2 complement(404713..407298) [2586 bp, 861 aa] {...    36   0.92 
ZYRO0C12276g Chr3 (968549..971236) [2688 bp, 895 aa] {ON} simila...    36   0.92 
TBLA0H03720 Chr8 complement(904264..906969) [2706 bp, 901 aa] {O...    36   0.93 
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    36   0.93 
Kpol_303.2 s303 (3836..6562) [2727 bp, 908 aa] {ON} (3836..6562)...    36   0.93 
KAFR0C06170 Chr3 complement(1227422..1230160) [2739 bp, 912 aa] ...    36   0.93 
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    36   0.95 
SAKL0G11220g Chr7 (956374..956550,956613..957206) [771 bp, 256 a...    35   0.95 
YAR042W Chr1 (192619..196185) [3567 bp, 1188 aa] {ON}  SWH1Prote...    36   0.96 
Kpol_520.37 s520 complement(91899..93089) [1191 bp, 396 aa] {ON}...    36   0.96 
KNAG0F01880 Chr6 (358750..362379) [3630 bp, 1209 aa] {ON} Anc_6....    36   0.96 
Smik_16.126 Chr16 complement(224488..228138) [3651 bp, 1216 aa] ...    36   0.96 
Kwal_33.13186 s33 complement(111561..112799) [1239 bp, 412 aa] {...    36   0.98 
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...    36   0.98 
TBLA0E04670 Chr5 (1191206..1192453) [1248 bp, 415 aa] {ON} Anc_4...    36   0.98 
TPHA0L01230 Chr12 (256218..260735) [4518 bp, 1505 aa] {ON} Anc_8...    36   0.99 
KNAG0L00430 Chr12 complement(60407..65089) [4683 bp, 1560 aa] {O...    36   0.99 
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...    36   0.99 
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...    36   1.00 
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...    36   1.0  
TPHA0A02490 Chr1 complement(531393..532715) [1323 bp, 440 aa] {O...    36   1.0  
SAKL0H18546g Chr8 (1646518..1652601) [6084 bp, 2027 aa] {ON} sim...    36   1.0  
Skud_4.107 Chr4 (186563..187900) [1338 bp, 445 aa] {ON} YDL147W ...    36   1.0  
NDAI0F03900 Chr6 complement(924630..926000) [1371 bp, 456 aa] {O...    36   1.0  
YDR393W Chr4 (1259901..1261271) [1371 bp, 456 aa] {ON}  SHE9Mito...    36   1.0  
Kwal_27.10602 s27 (415538..416173) [636 bp, 211 aa] {ON} YBL102W...    35   1.0  
SAKL0H13442g Chr8 (1153418..1154812) [1395 bp, 464 aa] {ON} simi...    36   1.0  
TBLA0G02120 Chr7 complement(555911..557317) [1407 bp, 468 aa] {O...    36   1.0  
Smik_11.316 Chr11 complement(525589..537861) [12273 bp, 4090 aa]...    36   1.0  
TPHA0D02760 Chr4 complement(575033..575686) [654 bp, 217 aa] {ON...    35   1.1  
TBLA0D03360 Chr4 (837880..839493) [1614 bp, 537 aa] {ON} Anc_5.2...    36   1.1  
Smik_11.273 Chr11 (457103..458722) [1620 bp, 539 aa] {ON} YKR016...    36   1.1  
KNAG0F00870 Chr6 complement(157306..158928) [1623 bp, 540 aa] {O...    36   1.1  
Smik_13.260 Chr13 complement(405892..406557) [666 bp, 221 aa] {O...    35   1.1  
YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit ...    36   1.1  
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    36   1.1  
TBLA0A01520 Chr1 (351280..352203) [924 bp, 307 aa] {ON} Anc_6.13...    35   1.1  
NCAS0G02100 Chr7 complement(379390..379779) [390 bp, 129 aa] {ON...    34   1.1  
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    36   1.1  
Ecym_8362 Chr8 complement(727291..729057) [1767 bp, 588 aa] {ON}...    36   1.1  
Skud_13.138 Chr13 (230356..232122) [1767 bp, 588 aa] {ON} YML013...    36   1.1  
Kpol_460.6 s460 complement(9217..10995) [1779 bp, 592 aa] {ON} c...    36   1.1  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...    36   1.1  
CAGL0K10934g Chr11 complement(1068680..1070479) [1800 bp, 599 aa...    36   1.1  
Smik_4.84 Chr4 complement(157976..159793) [1818 bp, 605 aa] {ON}...    36   1.1  
TPHA0K01400 Chr11 complement(291521..293392) [1872 bp, 623 aa] {...    36   1.1  
Kwal_33.13788 s33 complement(394432..396303) [1872 bp, 624 aa] {...    36   1.1  
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    36   1.1  
SAKL0A02596g Chr1 complement(235391..237295) [1905 bp, 634 aa] {...    36   1.1  
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...    36   1.1  
KAFR0H01720 Chr8 complement(317470..319404) [1935 bp, 644 aa] {O...    36   1.1  
Smik_6.457 Chr6 (751338..753281) [1944 bp, 647 aa] {ON} YPL253C ...    36   1.1  
Smik_4.123 Chr4 complement(233296..235242) [1947 bp, 648 aa] {ON...    36   1.1  
TBLA0C04250 Chr3 complement(1020759..1022708) [1950 bp, 649 aa] ...    36   1.1  
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...    36   1.1  
CAGL0M08668g Chr13 (862981..864954) [1974 bp, 657 aa] {ON} simil...    36   1.1  
Kwal_YGOB_33.13788 s33 complement(390628..390807,394432..396303)...    36   1.2  
TBLA0B05910 Chr2 complement(1387647..1389725) [2079 bp, 692 aa] ...    36   1.2  
TPHA0A04650 Chr1 (1052562..1054718) [2157 bp, 718 aa] {ON} Anc_5...    36   1.2  
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...    36   1.2  
Kpol_339.3 s339 (4040..6394) [2355 bp, 784 aa] {ON} (4040..6394)...    36   1.2  
KAFR0E00920 Chr5 (196279..198699) [2421 bp, 806 aa] {ON} Anc_8.5...    36   1.2  
Skud_11.307 Chr11 complement(556554..557603) [1050 bp, 349 aa] {...    35   1.2  
TPHA0E01390 Chr5 complement(282750..283097) [348 bp, 115 aa] {ON...    33   1.2  
Smik_10.28 Chr10 complement(48950..51466) [2517 bp, 838 aa] {ON}...    36   1.2  
Suva_14.299 Chr14 complement(541627..544146) [2520 bp, 839 aa] {...    36   1.2  
KAFR0A05510 Chr1 (1098387..1100939) [2553 bp, 850 aa] {ON} Anc_3...    36   1.2  
Kpol_YGOB_1017.2 s1017 complement(4453..7197) [2745 bp, 914 aa] ...    36   1.2  
Kpol_1017.2 s1017 complement(4453..7224) [2772 bp, 923 aa] {OFF}...    36   1.2  
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    36   1.2  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....    36   1.2  
CAGL0J07656g Chr10 complement(748336..751194) [2859 bp, 952 aa] ...    36   1.2  
TBLA0J00770 Chr10 complement(174609..177521) [2913 bp, 970 aa] {...    36   1.2  
SAKL0B10758g Chr2 complement(931458..934418) [2961 bp, 986 aa] {...    36   1.2  
CAGL0L06622g Chr12 complement(745599..749012) [3414 bp, 1137 aa]...    36   1.3  
YPR049C Chr16 complement(661137..664673) [3537 bp, 1178 aa] {ON}...    36   1.3  
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    36   1.3  
NDAI0I00850 Chr9 complement(193411..197169) [3759 bp, 1252 aa] {...    36   1.3  
Suva_13.307 Chr13 (501869..502778,503271..506152) [3792 bp, 1263...    36   1.3  
NCAS0A14330 Chr1 complement(2821561..2825718) [4158 bp, 1385 aa]...    36   1.3  
Smik_4.538 Chr4 complement(969834..971057) [1224 bp, 407 aa] {ON...    35   1.3  
KLLA0E01651g Chr5 complement(155975..160627) [4653 bp, 1550 aa] ...    36   1.3  
Smik_12.43 Chr12 (86975..91723) [4749 bp, 1582 aa] {ON} YLL021W ...    36   1.3  
TBLA0E02420 Chr5 (600043..604803) [4761 bp, 1586 aa] {ON} Anc_7....    36   1.3  
YKL172W Chr11 (125759..127042) [1284 bp, 427 aa] {ON}  EBP2Requi...    35   1.3  
Skud_4.408 Chr4 (727248..733340) [6093 bp, 2030 aa] {ON} YDR150W...    36   1.3  
CAGL0M00968g Chr13 (107989..109311) [1323 bp, 440 aa] {ON} simil...    35   1.3  
Suva_4.257 Chr4 (452826..454172) [1347 bp, 448 aa] {ON} YDR004W ...    35   1.3  
KAFR0C02900 Chr3 (576118..584142) [8025 bp, 2674 aa] {ON} Anc_8....    36   1.3  
KAFR0C05990 Chr3 (1194868..1195707) [840 bp, 279 aa] {ON} Anc_5....    35   1.4  
KNAG0I01310 Chr9 complement(253551..254993) [1443 bp, 480 aa] {O...    35   1.4  
Suva_2.327 Chr2 (575454..575972) [519 bp, 172 aa] {ON} YDR163W (...    34   1.4  
SAKL0F13552g Chr6 complement(1076192..1076833) [642 bp, 213 aa] ...    35   1.4  
TPHA0B02880 Chr2 (657768..659264) [1497 bp, 498 aa] {ON} Anc_8.6...    35   1.4  
TBLA0G03150 Chr7 (832779..834314) [1536 bp, 511 aa] {ON} Anc_3.1...    35   1.4  
Kpol_463.15 s463 complement(40654..42216) [1563 bp, 520 aa] {ON}...    35   1.4  
TPHA0F01540 Chr6 complement(354829..356412) [1584 bp, 527 aa] {O...    35   1.4  
SAKL0D02310g Chr4 (183271..184920) [1650 bp, 549 aa] {ON} simila...    35   1.4  
YGL228W Chr7 (67598..69331) [1734 bp, 577 aa] {ON}  SHE10Putativ...    35   1.4  
NDAI0H00240 Chr8 complement(36673..37341) [669 bp, 222 aa] {ON} ...    35   1.5  
Smik_6.320 Chr6 (502607..503278) [672 bp, 223 aa] {ON} YPL121C (...    35   1.5  
TPHA0M00170 Chr13 complement(33610..35478) [1869 bp, 622 aa] {ON...    35   1.5  
KNAG0H02360 Chr8 (432371..434245) [1875 bp, 624 aa] {ON} Anc_5.2...    35   1.5  
NCAS0I02430 Chr9 complement(455519..457399) [1881 bp, 626 aa] {O...    35   1.5  
KAFR0J02130 Chr10 (409639..411528) [1890 bp, 629 aa] {ON} Anc_2....    35   1.5  
TBLA0E03540 Chr5 complement(877477..878157) [681 bp, 226 aa] {ON...    35   1.5  
TDEL0E03150 Chr5 (592206..594128) [1923 bp, 640 aa] {ON} Anc_5.3...    35   1.5  
TPHA0L01640 Chr12 complement(345058..347004) [1947 bp, 648 aa] {...    35   1.5  
Suva_8.324 Chr8 complement(578609..580591) [1983 bp, 660 aa] {ON...    35   1.5  
ZYRO0F11858g Chr6 complement(968249..970243) [1995 bp, 664 aa] {...    35   1.5  
KLTH0E10054g Chr5 (909503..911500) [1998 bp, 665 aa] {ON} simila...    35   1.5  
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    35   1.5  
Smik_13.432 Chr13 complement(702520..702741,702742..704598) [207...    35   1.5  
TBLA0A03280 Chr1 complement(781437..783647) [2211 bp, 736 aa] {O...    35   1.5  
TPHA0D02240 Chr4 complement(464064..466289) [2226 bp, 741 aa] {O...    35   1.5  
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    35   1.5  
NDAI0I00720 Chr9 complement(156237..158486) [2250 bp, 749 aa] {O...    35   1.5  
Kpol_1036.58 s1036 (164177..166498) [2322 bp, 773 aa] {ON} (1641...    35   1.5  
KLLA0E08955g Chr5 (793287..794315) [1029 bp, 342 aa] {ON} simila...    35   1.6  
KLLA0C11253g Chr3 complement(967067..969457) [2391 bp, 796 aa] {...    35   1.6  
Kwal_55.19808 s55 (136074..138551) [2478 bp, 825 aa] {ON} YBL047...    35   1.6  
TPHA0L02120 Chr12 complement(437903..440479) [2577 bp, 858 aa] {...    35   1.6  
Smik_12.88 Chr12 (181254..181976) [723 bp, 240 aa] {ON} YLR025W ...    35   1.6  
TPHA0F03370 Chr6 complement(726379..729012) [2634 bp, 877 aa] {O...    35   1.6  
Suva_13.227 Chr13 (364556..367234) [2679 bp, 892 aa] {ON} YMR054...    35   1.6  
NCAS0G01090 Chr7 complement(189888..192761) [2874 bp, 957 aa] {O...    35   1.6  
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    35   1.6  
NDAI0C00420 Chr3 complement(72037..74940) [2904 bp, 967 aa] {ON}...    35   1.6  
NDAI0B03960 Chr2 (999856..1000956) [1101 bp, 366 aa] {ON} Anc_2....    35   1.6  
KLLA0F07469g Chr6 (703955..706933) [2979 bp, 992 aa] {ON} simila...    35   1.6  
KAFR0F00140 Chr6 (42967..46071) [3105 bp, 1034 aa] {ON} Anc_2.2 ...    35   1.6  
NDAI0A07630 Chr1 (1750982..1754107) [3126 bp, 1041 aa] {ON} Anc_...    35   1.6  
TBLA0G01270 Chr7 complement(340901..344152) [3252 bp, 1083 aa] {...    35   1.6  
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    35   1.6  
Suva_11.119 Chr11 complement(225373..228735) [3363 bp, 1120 aa] ...    35   1.6  
Suva_2.714 Chr2 complement(1252541..1253695) [1155 bp, 384 aa] {...    35   1.6  
SAKL0A04004g Chr1 (373666..377208) [3543 bp, 1180 aa] {ON} simil...    35   1.6  
Skud_16.336 Chr16 complement(625927..629469) [3543 bp, 1180 aa] ...    35   1.6  
Ecym_5364 Chr5 (738965..742579) [3615 bp, 1204 aa] {ON} similar ...    35   1.7  
Suva_7.131 Chr7 (253940..257770) [3831 bp, 1276 aa] {ON} YGL133W...    35   1.7  
TPHA0A03860 Chr1 (849477..853478) [4002 bp, 1333 aa] {ON} Anc_3....    35   1.7  
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...    35   1.7  
TPHA0G01360 Chr7 complement(271772..276250) [4479 bp, 1492 aa] {...    35   1.7  
SAKL0H04532g Chr8 (420999..421052,421145..426025) [4935 bp, 1644...    35   1.7  
KAFR0E02920 Chr5 complement(586394..587665) [1272 bp, 423 aa] {O...    35   1.7  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...    35   1.7  
Suva_12.76 Chr12 (107539..113613) [6075 bp, 2024 aa] {ON} YJL005...    35   1.7  
KLTH0F08250g Chr6 (716337..717635) [1299 bp, 432 aa] {ON} simila...    35   1.7  
NDAI0E02340 Chr5 (489675..491027) [1353 bp, 450 aa] {ON} Anc_8.6...    35   1.8  
Smik_12.527 Chr12 complement(929323..930687) [1365 bp, 454 aa] {...    35   1.8  
SAKL0H07986g Chr8 complement(687202..688569) [1368 bp, 455 aa] {...    35   1.8  
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...    35   1.8  
Suva_11.162 Chr11 complement(303720..304226) [507 bp, 168 aa] {O...    34   1.8  
YOR177C Chr15 complement(665785..667179) [1395 bp, 464 aa] {ON} ...    35   1.8  
NDAI0F02990 Chr6 (728178..729644) [1467 bp, 488 aa] {ON} Anc_2.1...    35   1.8  
Kpol_1010.23 s1010 (52012..52878) [867 bp, 288 aa] {ON} (52012.....    35   1.8  
TDEL0F01120 Chr6 complement(202602..204149) [1548 bp, 515 aa] {O...    35   1.8  
NCAS0F00770 Chr6 complement(155203..155721) [519 bp, 172 aa] {ON...    34   1.8  
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...    35   1.8  
TPHA0K02060 Chr11 complement(439779..441347) [1569 bp, 522 aa] {...    35   1.8  
NCAS0F01540 Chr6 complement(306406..308016) [1611 bp, 536 aa] {O...    35   1.9  
NCAS0E02360 Chr5 complement(462936..463820) [885 bp, 294 aa] {ON...    35   1.9  
Skud_4.450 Chr4 complement(797339..798229) [891 bp, 296 aa] {ON}...    35   1.9  
NCAS0G01250 Chr7 (220605..221501) [897 bp, 298 aa] {ON} Anc_6.25...    35   1.9  
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...    35   1.9  
Kpol_1060.55 s1060 (131883..132548) [666 bp, 221 aa] {ON} (13188...    34   1.9  
Suva_7.295 Chr7 (506525..508351) [1827 bp, 608 aa] {ON} YGR013W ...    35   1.9  
Skud_2.275 Chr2 (505315..507144) [1830 bp, 609 aa] {ON} YBR148W ...    35   1.9  
Smik_7.301 Chr7 (506286..508148) [1863 bp, 620 aa] {ON} YGR013W ...    35   1.9  
KNAG0E01830 Chr5 complement(377725..379620) [1896 bp, 631 aa] {O...    35   1.9  
KAFR0C03120 Chr3 complement(622232..624130) [1899 bp, 632 aa] {O...    35   1.9  
KLLA0A01177g Chr1 (108738..110648) [1911 bp, 636 aa] {ON} weakly...    35   1.9  
AEL270W Chr5 (132790..134703) [1914 bp, 637 aa] {ON} Syntenic ho...    35   1.9  
TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.3...    35   2.0  
Suva_13.172 Chr13 (274893..275432) [540 bp, 179 aa] {ON} YMR009W...    34   2.0  
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    35   2.0  
TBLA0I02640 Chr9 complement(617916..619922) [2007 bp, 668 aa] {O...    35   2.0  
Suva_13.408 Chr13 complement(699377..701455) [2079 bp, 692 aa] {...    35   2.0  
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...    35   2.0  
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    35   2.0  
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    35   2.0  
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...    35   2.0  
Kpol_1048.61 s1048 (176743..179121) [2379 bp, 792 aa] {ON} (1767...    35   2.0  
KLLA0B01826g Chr2 complement(155830..156444,156659..158455) [241...    35   2.0  
KLTH0H01782g Chr8 complement(159110..161554) [2445 bp, 814 aa] {...    35   2.0  
KAFR0B04670 Chr2 (972408..973442) [1035 bp, 344 aa] {ON} Anc_2.3...    35   2.1  
TBLA0E01470 Chr5 (335873..336910) [1038 bp, 345 aa] {ON} Anc_4.2...    35   2.1  
KAFR0L00640 Chr12 (120745..120763,120859..121175) [336 bp, 111 a...    33   2.1  
Suva_3.159 Chr3 (241189..243714) [2526 bp, 841 aa] {ON} YCL054W ...    35   2.1  
KLLA0B13343g Chr2 complement(1170477..1171127,1171345..1171404) ...    34   2.1  
CAGL0K09746g Chr11 complement(952549..955125) [2577 bp, 858 aa] ...    35   2.1  
Skud_11.153 Chr11 (281737..284382) [2646 bp, 881 aa] {ON} YKL073...    35   2.1  
TDEL0B06830 Chr2 complement(1208432..1211107) [2676 bp, 891 aa] ...    35   2.1  
Smik_3.140 Chr3 complement(192527..195298) [2772 bp, 923 aa] {ON...    35   2.1  
NCAS0A10940 Chr1 complement(2178281..2181088) [2808 bp, 935 aa] ...    35   2.1  
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    35   2.1  
YEL043W Chr5 (70478..73348) [2871 bp, 956 aa] {ON} Predicted cyt...    35   2.1  
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...    35   2.1  
TBLA0G03280 Chr7 complement(868646..871540) [2895 bp, 964 aa] {O...    35   2.1  
YLR187W Chr12 (524865..527945) [3081 bp, 1026 aa] {ON}  SKG3Prot...    35   2.1  
Suva_2.219 Chr2 (370438..370575,370606..370854,371377..374085) [...    35   2.1  
NDAI0I02760 Chr9 complement(646478..649687) [3210 bp, 1069 aa] {...    35   2.1  
KNAG0K02630 Chr11 (523259..526489) [3231 bp, 1076 aa] {ON} Anc_3...    35   2.1  
Smik_5.256 Chr5 complement(391451..394711) [3261 bp, 1086 aa] {O...    35   2.1  
NDAI0H00310 Chr8 (55797..56921) [1125 bp, 374 aa] {ON} Anc_4.27 ...    35   2.1  
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    35   2.1  
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    35   2.1  
Suva_15.15 Chr15 complement(27309..30623) [3315 bp, 1104 aa] {ON...    35   2.1  
Ecym_3157 Chr3 (294832..298155) [3324 bp, 1107 aa] {ON} similar ...    35   2.1  
Kpol_1018.134 s1018 complement(356768..360142) [3375 bp, 1124 aa...    35   2.1  
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    35   2.2  
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    35   2.2  
TBLA0J01090 Chr10 (248068..251592) [3525 bp, 1174 aa] {ON} Anc_1...    35   2.2  
Smik_4.394 Chr4 (718158..721880) [3723 bp, 1240 aa] {ON} YDR150W...    35   2.2  
NDAI0D03160 Chr4 (753435..754598) [1164 bp, 387 aa] {ON} Anc_4.342     35   2.2  
TPHA0D03600 Chr4 complement(754714..758556) [3843 bp, 1280 aa] {...    35   2.2  
Ecym_4466 Chr4 (947849..951742) [3894 bp, 1297 aa] {ON} similar ...    35   2.2  
CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} simila...    35   2.2  
KAFR0J01380 Chr10 (253377..253859) [483 bp, 160 aa] {ON} Anc_4.1...    33   2.2  
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...    33   2.2  
Kpol_1044.17 s1044 (36316..37518) [1203 bp, 400 aa] {ON} (36316....    35   2.2  
Kpol_1050.93 s1050 (211544..215908) [4365 bp, 1454 aa] {ON} (211...    35   2.2  
Skud_10.300 Chr10 complement(532841..534091) [1251 bp, 416 aa] {...    35   2.2  
Suva_5.277 Chr5 complement(437529..438791) [1263 bp, 420 aa] {ON...    35   2.3  
CAGL0M03267g Chr13 complement(374158..374958) [801 bp, 266 aa] {...    34   2.3  
KNAG0K01060 Chr11 (207381..208709) [1329 bp, 442 aa] {ON} Anc_3....    35   2.3  
ZYRO0D00550g Chr4 (41646..42449) [804 bp, 267 aa] {ON} no simila...    34   2.3  
NDAI0A06730 Chr1 complement(1536357..1537694) [1338 bp, 445 aa] ...    35   2.3  
Skud_16.136 Chr16 complement(247743..249101) [1359 bp, 452 aa] {...    35   2.3  
KAFR0A00870 Chr1 (159691..161052) [1362 bp, 453 aa] {ON} Anc_1.3...    35   2.3  
Kpol_1028.88 s1028 (197112..197723) [612 bp, 203 aa] {ON} (19711...    34   2.3  
Kpol_64.1 s64 complement(1..1371) [1371 bp, 457 aa] {ON} complem...    35   2.3  
KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} si...    35   2.4  
TDEL0B03300 Chr2 (588444..589889) [1446 bp, 481 aa] {ON}               35   2.4  
KLTH0G11330g Chr7 complement(956495..958000) [1506 bp, 501 aa] {...    35   2.4  
Suva_7.341 Chr7 (582829..584364) [1536 bp, 511 aa] {ON} YGR059W ...    35   2.4  
CAGL0J06886g Chr10 (660284..661822) [1539 bp, 512 aa] {ON} simil...    35   2.4  
TBLA0G00630 Chr7 (138896..140458) [1563 bp, 520 aa] {ON} Anc_4.1...    35   2.4  
KAFR0K00520 Chr11 (111490..112356) [867 bp, 288 aa] {ON} Anc_7.4...    34   2.4  
Smik_15.523 Chr15 complement(920171..921037) [867 bp, 288 aa] {O...    34   2.4  
KLTH0C05566g Chr3 (482829..483464) [636 bp, 211 aa] {ON} similar...    34   2.4  
KLTH0G05324g Chr7 complement(431556..432425) [870 bp, 289 aa] {O...    34   2.4  
Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...    35   2.5  
TDEL0B01750 Chr2 (313881..315521) [1641 bp, 546 aa] {ON} Anc_8.4...    35   2.5  
TPHA0C01490 Chr3 complement(341068..342714) [1647 bp, 548 aa] {O...    35   2.5  
CAGL0K02453g Chr11 complement(223090..224844) [1755 bp, 584 aa] ...    35   2.5  
Smik_13.406 Chr13 (643912..645687) [1776 bp, 591 aa] {ON} YMR198...    35   2.5  
KLLA0E15467g Chr5 (1385802..1386722) [921 bp, 306 aa] {ON} weakl...    34   2.5  
Suva_2.207 Chr2 (352967..354853) [1887 bp, 628 aa] {ON} YDR049W ...    35   2.5  
Suva_4.133 Chr4 complement(245073..246995) [1923 bp, 640 aa] {ON...    35   2.6  
Suva_16.189 Chr16 complement(330526..331191) [666 bp, 221 aa] {O...    34   2.6  
Skud_13.234 Chr13 complement(395722..396387) [666 bp, 221 aa] {O...    34   2.6  
SAKL0G00814g Chr7 complement(75297..77240) [1944 bp, 647 aa] {ON...    35   2.6  
NCAS0C04210 Chr3 complement(863817..865814) [1998 bp, 665 aa] {O...    35   2.6  
Ecym_8108 Chr8 (230588..232636) [2049 bp, 682 aa] {ON} similar t...    35   2.6  
YMR224C Chr13 complement(718575..720653) [2079 bp, 692 aa] {ON} ...    35   2.6  
TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4...    35   2.6  
KLLA0C03652g Chr3 (333038..335155) [2118 bp, 705 aa] {ON} some s...    35   2.6  
Skud_15.450 Chr15 complement(789809..790789) [981 bp, 326 aa] {O...    34   2.6  
Ecym_7124 Chr7 complement(250068..252305) [2238 bp, 745 aa] {ON}...    35   2.6  
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...    35   2.7  
TDEL0A01960 Chr1 complement(358370..359059) [690 bp, 229 aa] {ON...    34   2.7  
Suva_2.660 Chr2 complement(1179366..1180055) [690 bp, 229 aa] {O...    34   2.7  
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...    35   2.7  
KAFR0F01520 Chr6 (298731..301094) [2364 bp, 787 aa] {ON} Anc_1.1...    35   2.7  
KAFR0D03440 Chr4 (675689..675748,675819..676451) [693 bp, 230 aa...    34   2.7  
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    35   2.7  
NDAI0A00600 Chr1 complement(111082..113478) [2397 bp, 798 aa] {O...    35   2.7  
TPHA0J02150 Chr10 (481398..483827) [2430 bp, 809 aa] {ON} Anc_6....    35   2.7  
Skud_3.10 Chr3 (19395..21917) [2523 bp, 840 aa] {ON} YCL054W (REAL)    35   2.7  
YCL054W Chr3 (31449..33974) [2526 bp, 841 aa] {ON}  SPB1AdoMet-d...    35   2.7  
Suva_10.361 Chr10 (631532..634063) [2532 bp, 843 aa] {ON} YLR263...    35   2.7  
Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W ...    35   2.7  
Skud_16.9 Chr16 (14373..16991) [2619 bp, 872 aa] {ON} YPL268W (R...    35   2.7  
TBLA0E03140 Chr5 complement(784998..787637) [2640 bp, 879 aa] {O...    35   2.7  
Smik_10.36 Chr10 (58828..61470) [2643 bp, 880 aa] {ON} YCR037C (...    35   2.7  
Smik_11.165 Chr11 (282628..285273) [2646 bp, 881 aa] {ON} YKL073...    35   2.7  
Skud_4.156 Chr4 (278886..279947) [1062 bp, 353 aa] {ON} YDL099W ...    34   2.7  
NDAI0I02390 Chr9 (544806..547631) [2826 bp, 941 aa] {ON} Anc_6.5...    35   2.7  
KLLA0B08261g Chr2 (735279..736346) [1068 bp, 355 aa] {ON} some s...    34   2.8  
Kwal_56.22613 s56 complement(204309..207179) [2871 bp, 956 aa] {...    35   2.8  
ZYRO0B06160g Chr2 complement(493345..496218) [2874 bp, 957 aa] {...    35   2.8  
YHR120W Chr8 (349574..352453) [2880 bp, 959 aa] {ON}  MSH1DNA-bi...    35   2.8  
KNAG0K00810 Chr11 (150427..153351) [2925 bp, 974 aa] {ON} Anc_3....    35   2.8  
SAKL0A01452g Chr1 (137799..140771) [2973 bp, 990 aa] {ON} simila...    35   2.8  
ZYRO0B15642g Chr2 complement(1269949..1272987) [3039 bp, 1012 aa...    35   2.8  
YER111C Chr5 complement(382595..385876) [3282 bp, 1093 aa] {ON} ...    35   2.8  
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    35   2.8  
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    35   2.8  
Ecym_2183 Chr2 (359314..362934) [3621 bp, 1206 aa] {ON} similar ...    35   2.8  
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    35   2.8  
KAFR0J01990 Chr10 (381369..382109) [741 bp, 246 aa] {ON} Anc_2.1...    34   2.8  
TBLA0H01300 Chr8 complement(292876..293628) [753 bp, 250 aa] {ON...    34   2.9  
NDAI0K00600 Chr11 (129991..134304) [4314 bp, 1437 aa] {ON} Anc_8...    35   2.9  
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...    32   2.9  
Kpol_1055.13 s1055 (30639..35297) [4659 bp, 1552 aa] {ON} (30639...    35   2.9  
TPHA0N00540 Chr14 complement(107050..111780) [4731 bp, 1576 aa] ...    35   2.9  
Kpol_298.3 s298 (6306..11309) [5004 bp, 1667 aa] {ON} (6306..113...    35   2.9  
TBLA0B09660 Chr2 (2292300..2297510) [5211 bp, 1736 aa] {ON} Anc_...    35   2.9  
Kpol_1052.29 s1052 (92118..93359) [1242 bp, 413 aa] {ON} (92118....    34   2.9  
Suva_11.51 Chr11 (110669..111937) [1269 bp, 422 aa] {ON} YKL172W...    34   3.0  
Skud_11.53 Chr11 (112067..113341) [1275 bp, 424 aa] {ON} YKL172W...    34   3.0  
CAGL0J07502g Chr10 complement(726663..727961) [1299 bp, 432 aa] ...    34   3.0  
Smik_14.191 Chr14 (349918..351222) [1305 bp, 434 aa] {ON} YNL136...    34   3.0  
KNAG0K00990 Chr11 complement(194211..195521) [1311 bp, 436 aa] {...    34   3.0  
Ecym_2412 Chr2 complement(801242..802564) [1323 bp, 440 aa] {ON}...    34   3.0  
CAGL0F03839g Chr6 (372239..373561) [1323 bp, 440 aa] {ON} simila...    34   3.0  
TPHA0C00980 Chr3 (211443..212237) [795 bp, 264 aa] {ON} Anc_8.29...    34   3.0  
Smik_4.51 Chr4 (100471..101835) [1365 bp, 454 aa] {ON} YDL189W (...    34   3.1  
YKR054C Chr11 complement(535647..547925) [12279 bp, 4092 aa] {ON...    35   3.1  
TBLA0F01000 Chr6 (244570..245991) [1422 bp, 473 aa] {ON} Anc_3.1...    34   3.1  
TDEL0H04040 Chr8 complement(691879..692700) [822 bp, 273 aa] {ON...    34   3.1  
NDAI0H03940 Chr8 complement(968853..969680) [828 bp, 275 aa] {ON...    34   3.1  
Kpol_479.11 s479 complement(21571..23034) [1464 bp, 487 aa] {ON}...    34   3.1  
TDEL0H03000 Chr8 complement(497316..498149) [834 bp, 277 aa] {ON...    34   3.1  
NDAI0C03250 Chr3 (739350..739976) [627 bp, 208 aa] {ON}                33   3.2  
Skud_4.464 Chr4 (822809..823315) [507 bp, 168 aa] {ON} YDR201W (...    33   3.2  
KNAG0B03100 Chr2 complement(597560..598429) [870 bp, 289 aa] {ON...    34   3.2  
CAGL0G04565g Chr7 complement(434012..435706) [1695 bp, 564 aa] {...    34   3.3  
Kpol_376.19 s376 complement(31603..33303) [1701 bp, 566 aa] {ON}...    34   3.3  
NCAS0F03880 Chr6 complement(777549..779264) [1716 bp, 571 aa] {O...    34   3.3  
ADL028W Chr4 (650426..652159) [1734 bp, 577 aa] {ON} Syntenic ho...    34   3.3  
SAKL0H23166g Chr8 (2007625..2009382) [1758 bp, 585 aa] {ON} weak...    34   3.3  
NDAI0A07400 Chr1 complement(1690185..1691090) [906 bp, 301 aa] {...    34   3.3  
TPHA0F01930 Chr6 complement(435235..437037) [1803 bp, 600 aa] {O...    34   3.3  
NDAI0F02980 Chr6 complement(725796..727634) [1839 bp, 612 aa] {O...    34   3.3  
YGR013W Chr7 (514554..516416) [1863 bp, 620 aa] {ON}  SNU71Compo...    34   3.3  
TBLA0B00280 Chr2 complement(50508..51161) [654 bp, 217 aa] {ON} ...    33   3.3  
TPHA0C02080 Chr3 complement(469182..469703) [522 bp, 173 aa] {ON...    33   3.3  
Kpol_1010.27 s1010 (61612..62268) [657 bp, 218 aa] {ON} (61612.....    33   3.4  
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    34   3.4  
ACR060W Chr3 (463771..463771,463861..465866) [2007 bp, 668 aa] {...    34   3.4  
Suva_15.230 Chr15 (397889..399964) [2076 bp, 691 aa] {ON} YHR042...    34   3.4  
Suva_2.635 Chr2 (1136014..1136979) [966 bp, 321 aa] {ON} YDR460W...    34   3.4  
NDAI0K00980 Chr11 complement(223506..225650) [2145 bp, 714 aa] {...    34   3.4  
KAFR0D02360 Chr4 complement(476864..477535) [672 bp, 223 aa] {ON...    33   3.4  
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...    34   3.4  
TPHA0K01150 Chr11 (241560..242534) [975 bp, 324 aa] {ON} Anc_6.6...    34   3.5  
CAGL0J11660g Chr10 (1135618..1137852) [2235 bp, 744 aa] {ON} hig...    34   3.5  
TPHA0P00570 Chr16 (113762..116020) [2259 bp, 752 aa] {ON} Anc_3....    34   3.5  
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    34   3.5  
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    34   3.5  
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...    34   3.5  
SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {...    34   3.5  
CAGL0J02376g Chr10 complement(232589..233593) [1005 bp, 334 aa] ...    34   3.5  
Smik_4.763 Chr4 complement(1348756..1349442) [687 bp, 228 aa] {O...    33   3.5  
Kpol_1033.35 s1033 (95318..97771) [2454 bp, 817 aa] {ON} (95318....    34   3.5  
Smik_2.173 Chr2 complement(316103..318565) [2463 bp, 820 aa] {ON...    34   3.5  
NCAS0F01380 Chr6 complement(273134..275599) [2466 bp, 821 aa] {O...    34   3.5  
Kpol_1032.63 s1032 complement(145306..147774) [2469 bp, 822 aa] ...    34   3.5  
Skud_4.760 Chr4 complement(1347176..1347865) [690 bp, 229 aa] {O...    33   3.5  
YDR486C Chr4 complement(1427431..1428120) [690 bp, 229 aa] {ON} ...    33   3.5  
Smik_3.21 Chr3 (32872..35382) [2511 bp, 836 aa] {ON} YCL054W (REAL)    34   3.5  
Smik_14.287 Chr14 complement(523278..525800) [2523 bp, 840 aa] {...    34   3.5  
TPHA0E01020 Chr5 complement(208049..210583) [2535 bp, 844 aa] {O...    34   3.5  
TBLA0J00170 Chr10 complement(20249..22786) [2538 bp, 845 aa] {ON...    34   3.5  
SAKL0B10384g Chr2 (895586..896278) [693 bp, 230 aa] {ON} similar...    33   3.6  
Kpol_1024.31 s1024 (90996..93569) [2574 bp, 857 aa] {ON} (90996....    34   3.6  
ZYRO0F03366g Chr6 (288271..290865) [2595 bp, 864 aa] {ON} simila...    34   3.6  
TPHA0G00900 Chr7 (168372..169403) [1032 bp, 343 aa] {ON} Anc_2.3...    34   3.6  
Kpol_534.3 s534 (8057..9091) [1035 bp, 344 aa] {ON} (8057..9091)...    34   3.6  
TPHA0L01870 Chr12 complement(391448..394126) [2679 bp, 892 aa] {...    34   3.6  
TBLA0I01900 Chr9 complement(428105..430870) [2766 bp, 921 aa] {O...    34   3.6  
Ecym_7425 Chr7 complement(870347..873136) [2790 bp, 929 aa] {ON}...    34   3.6  
NDAI0B01390 Chr2 (321257..324073) [2817 bp, 938 aa] {ON} Anc_2.590     34   3.6  
KLLA0F24156g Chr6 (2251454..2254276) [2823 bp, 940 aa] {ON} simi...    34   3.6  
SAKL0H20064g Chr8 complement(1755850..1756905) [1056 bp, 351 aa]...    34   3.6  
NDAI0H02170 Chr8 (530742..533591) [2850 bp, 949 aa] {ON} Anc_2.4...    34   3.6  
Smik_13.488 Chr13 complement(798674..801622) [2949 bp, 982 aa] {...    34   3.6  
Skud_12.535 Chr12 complement(953328..956336) [3009 bp, 1002 aa] ...    34   3.6  
Smik_4.298 Chr4 (537177..540269) [3093 bp, 1030 aa] {ON} YDR060W...    34   3.6  
TBLA0A06650 Chr1 complement(1622626..1625757) [3132 bp, 1043 aa]...    34   3.7  
Kpol_1043.1 s1043 (1441..4608) [3168 bp, 1055 aa] {ON} (1441..46...    34   3.7  
YHR154W Chr8 (402966..406178) [3213 bp, 1070 aa] {ON}  RTT107Pro...    34   3.7  
KAFR0I01420 Chr9 complement(297324..298421) [1098 bp, 365 aa] {O...    34   3.7  
Kwal_55.21029 s55 (655389..658706) [3318 bp, 1105 aa] {ON} YER01...    34   3.7  
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    34   3.7  
TPHA0J01240 Chr10 complement(292710..296051) [3342 bp, 1113 aa] ...    34   3.7  
YER013W Chr5 (178841..182278) [3438 bp, 1145 aa] {ON}  PRP22DEAH...    34   3.7  
Skud_5.117 Chr5 (176045..179494) [3450 bp, 1149 aa] {ON} YER013W...    34   3.7  
CAGL0K05533g Chr11 (542446..543171) [726 bp, 241 aa] {ON} simila...    33   3.7  
TBLA0A08760 Chr1 complement(2145660..2149229) [3570 bp, 1189 aa]...    34   3.7  
ZYRO0G03872g Chr7 complement(309117..312716) [3600 bp, 1199 aa] ...    34   3.7  
Kpol_543.1 s543 complement(143..871) [729 bp, 242 aa] {ON} compl...    33   3.7  
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...    34   3.7  
NCAS0B03390 Chr2 complement(592225..595950) [3726 bp, 1241 aa] {...    34   3.7  
TBLA0E04730 Chr5 (1208306..1212190) [3885 bp, 1294 aa] {ON}            34   3.7  
Skud_4.230 Chr4 complement(410772..414656) [3885 bp, 1294 aa] {O...    34   3.7  
TBLA0A06360 Chr1 (1561496..1565389) [3894 bp, 1297 aa] {ON} Anc_...    34   3.7  
KAFR0A07190 Chr1 complement(1453748..1457704) [3957 bp, 1318 aa]...    34   3.8  
TBLA0A02090 Chr1 complement(502747..506940) [4194 bp, 1397 aa] {...    34   3.8  
Kpol_YGOB_Anc_7.141 s499 (62798..63037) [240 bp, 79 aa] {ON} ANN...    31   3.8  
TBLA0G02590 Chr7 complement(680382..684743) [4362 bp, 1453 aa] {...    34   3.8  
Kwal_14.2150 s14 (636185..641263) [5079 bp, 1692 aa] {ON} YLL021...    34   3.8  
Skud_13.388 Chr13 (681093..686231) [5139 bp, 1712 aa] {ON} YMR21...    34   3.8  
TBLA0A05140 Chr1 complement(1260690..1261445) [756 bp, 251 aa] {...    33   3.8  
Kpol_1060.38 s1060 (90816..92033) [1218 bp, 405 aa] {ON} (90816....    34   3.8  
TBLA0A09210 Chr1 complement(2282468..2283226) [759 bp, 252 aa] {...    33   3.9  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...    34   3.9  
YJR076C Chr10 complement(575354..576601) [1248 bp, 415 aa] {ON} ...    34   3.9  
YDR255C Chr4 complement(966557..967822) [1266 bp, 421 aa] {ON}  ...    34   3.9  
Kpol_1018.8 s1018 (20865..27560) [6696 bp, 2231 aa] {ON} (20865....    34   3.9  
KLTH0B05060g Chr2 complement(416976..418274) [1299 bp, 432 aa] {...    34   3.9  
Ecym_4273 Chr4 (575663..590410) [14748 bp, 4915 aa] {ON} similar...    34   4.0  
Smik_4.321 Chr4 (577043..578524) [1482 bp, 493 aa] {ON} YDR082W ...    34   4.1  
SAKL0G01144g Chr7 (98449..99990) [1542 bp, 513 aa] {ON} similar ...    34   4.2  
Ecym_1413 Chr1 (859045..860589) [1545 bp, 514 aa] {ON} similar t...    34   4.2  
Ecym_5119 Chr5 (255736..257292) [1557 bp, 518 aa] {ON} similar t...    34   4.2  
NDAI0B05470 Chr2 complement(1338456..1340039) [1584 bp, 527 aa] ...    34   4.2  
Kwal_26.8750 s26 complement(928205..928558) [354 bp, 117 aa] {OF...    32   4.2  
Kpol_1066.2 s1066 complement(689..2371) [1683 bp, 560 aa] {ON} c...    34   4.3  
YOR344C Chr15 complement(977194..978069) [876 bp, 291 aa] {ON}  ...    33   4.3  
Suva_16.190 Chr16 (331619..333319) [1701 bp, 566 aa] {ON} YPL120...    34   4.3  
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    34   4.3  
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    34   4.4  
NDAI0H01780 Chr8 (429837..430745) [909 bp, 302 aa] {ON} Anc_5.56...    33   4.4  
CAGL0M13365g Chr13 (1314673..1316544) [1872 bp, 623 aa] {ON} wea...    34   4.4  
KAFR0K00770 Chr11 (173033..174928) [1896 bp, 631 aa] {ON} Anc_7....    34   4.4  
Kpol_1002.98 s1002 (246036..246953) [918 bp, 305 aa] {ON} (24603...    33   4.4  
YDL113C Chr4 complement(256633..258555) [1923 bp, 640 aa] {ON}  ...    34   4.4  
NDAI0B03210 Chr2 (819236..820156) [921 bp, 306 aa] {ON} Anc_2.35...    33   4.4  
NDAI0G00220 Chr7 (29472..31436) [1965 bp, 654 aa] {ON} Anc_1.493...    34   4.4  
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    34   4.4  
TPHA0A04910 Chr1 (1106316..1107245) [930 bp, 309 aa] {ON} Anc_5....    33   4.4  
CAGL0H04103g Chr8 (388457..390460) [2004 bp, 667 aa] {ON} simila...    34   4.5  
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    34   4.5  
KLLA0E16743g Chr5 (1487301..1489316) [2016 bp, 671 aa] {ON} some...    34   4.5  
TPHA0D02380 Chr4 (493047..495077) [2031 bp, 676 aa] {ON} Anc_5.5...    34   4.5  
Kpol_431.3 s431 complement(10675..11331) [657 bp, 218 aa] {ON} c...    33   4.5  
Kpol_1064.50 s1064 complement(90816..91757) [942 bp, 313 aa] {ON...    33   4.5  
SAKL0C10604g Chr3 (960046..962115) [2070 bp, 689 aa] {ON} conser...    34   4.5  
Kpol_413.14 s413 complement(35188..37269) [2082 bp, 693 aa] {ON}...    34   4.5  
TBLA0F03420 Chr6 (844932..847049) [2118 bp, 705 aa] {ON} Anc_1.3...    34   4.5  
ABR202C Chr2 complement(781597..782553) [957 bp, 318 aa] {ON} Sy...    33   4.5  
Skud_4.735 Chr4 (1303900..1304865) [966 bp, 321 aa] {ON} YDR460W...    33   4.5  
YDR460W Chr4 (1383811..1384776) [966 bp, 321 aa] {ON}  TFB3Subun...    33   4.5  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....    34   4.5  
Kpol_1070.8 s1070 (23401..25638) [2238 bp, 745 aa] {ON} (23401.....    34   4.5  
NCAS0D04210 Chr4 (797525..799825) [2301 bp, 766 aa] {ON} Anc_6.2...    34   4.6  
TBLA0D01020 Chr4 (267733..268713) [981 bp, 326 aa] {ON} Anc_8.74...    33   4.6  
TPHA0L00230 Chr12 complement(24415..26748) [2334 bp, 777 aa] {ON...    34   4.6  
SAKL0G07106g Chr7 complement(582144..584519) [2376 bp, 791 aa] {...    34   4.6  
TPHA0C00640 Chr3 complement(120261..122636) [2376 bp, 791 aa] {O...    34   4.6  
NDAI0F00330 Chr6 (77559..79946) [2388 bp, 795 aa] {ON} Anc_5.696...    34   4.6  
Kpol_1037.19 s1037 complement(37269..39668) [2400 bp, 799 aa] {O...    34   4.6  
YBR049C Chr2 complement(334386..336818) [2433 bp, 810 aa] {ON}  ...    34   4.6  
TDEL0A05040 Chr1 complement(890030..892504) [2475 bp, 824 aa] {O...    34   4.6  
ZYRO0C03982g Chr3 complement(314543..317032) [2490 bp, 829 aa] {...    34   4.6  
SAKL0F05918g Chr6 (444390..446882) [2493 bp, 830 aa] {ON} simila...    34   4.6  
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    34   4.6  
TPHA0C01280 Chr3 (291235..293799) [2565 bp, 854 aa] {ON} Anc_7.2...    34   4.7  
Smik_2.319 Chr2 complement(572736..575303) [2568 bp, 855 aa] {ON...    34   4.7  
Kpol_1051.2 s1051 complement(3094..5697) [2604 bp, 867 aa] {ON} ...    34   4.7  
TBLA0A05260 Chr1 complement(1285922..1288537) [2616 bp, 871 aa] ...    34   4.7  
KNAG0B01160 Chr2 complement(216662..219280) [2619 bp, 872 aa] {O...    34   4.7  
KAFR0F01550 Chr6 (307792..310437) [2646 bp, 881 aa] {ON} Anc_1.1...    34   4.7  
Skud_10.21 Chr10 (35766..38414) [2649 bp, 882 aa] {ON} YJL198W (...    34   4.7  
SAKL0A08822g Chr1 (774870..774929,775006..775227,775290..775697)...    33   4.7  
Suva_16.58 Chr16 complement(85382..88258) [2877 bp, 958 aa] {ON}...    34   4.7  
Kwal_27.12369 s27 complement(1196578..1199502) [2925 bp, 974 aa]...    34   4.7  
TBLA0A10530 Chr1 (2601721..2602776) [1056 bp, 351 aa] {ON} Anc_1...    33   4.8  
CAGL0I00968g Chr9 (78375..81368) [2994 bp, 997 aa] {ON} similar ...    34   4.8  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     34   4.8  
KLLA0E22617g Chr5 complement(2018248..2021349) [3102 bp, 1033 aa...    34   4.8  
Suva_15.67 Chr15 complement(105988..109104) [3117 bp, 1038 aa] {...    34   4.8  
TBLA0A01610 Chr1 complement(378694..381852) [3159 bp, 1052 aa] {...    34   4.8  
TBLA0C06690 Chr3 (1614873..1618070) [3198 bp, 1065 aa] {ON} Anc_...    34   4.8  
TDEL0D03560 Chr4 (656347..657429) [1083 bp, 360 aa] {ON} Anc_3.2...    33   4.8  
Kpol_1014.32 s1014 (58546..61800) [3255 bp, 1084 aa] {ON} (58546...    34   4.8  
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...    34   4.8  
Skud_11.123 Chr11 complement(225550..228843) [3294 bp, 1097 aa] ...    34   4.8  
KLLA0C10758g Chr3 (924736..925824) [1089 bp, 362 aa] {ON} simila...    33   4.8  
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...    34   4.8  
NCAS0B01050 Chr2 (171520..174942) [3423 bp, 1140 aa] {ON} Anc_8....    34   4.8  
Kpol_1010.59 s1010 complement(142978..146415) [3438 bp, 1145 aa]...    34   4.8  
NCAS0B01400 Chr2 (227497..231096) [3600 bp, 1199 aa] {ON} Anc_8....    34   4.9  
TPHA0J02490 Chr10 complement(549151..552789) [3639 bp, 1212 aa] ...    34   4.9  
YPL110C Chr16 complement(341068..344739) [3672 bp, 1223 aa] {ON}...    34   4.9  
CAGL0J01892g Chr10 (187614..191738) [4125 bp, 1374 aa] {ON} simi...    34   4.9  
KAFR0J01560 Chr10 (283054..287208) [4155 bp, 1384 aa] {ON} Anc_2...    34   4.9  
Smik_13.381 Chr13 (596187..600449) [4263 bp, 1420 aa] {ON} YMR17...    34   4.9  
NDAI0A04630 Chr1 complement(1039623..1043981) [4359 bp, 1452 aa]...    34   5.0  
YLL021W Chr12 (100947..105347) [4401 bp, 1466 aa] {ON}  SPA2Comp...    34   5.0  
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    34   5.0  
Kpol_534.5 s534 complement(13392..18062) [4671 bp, 1556 aa] {ON}...    34   5.0  
TPHA0M00380 Chr13 (75380..75943) [564 bp, 187 aa] {ON} Anc_3.152...    33   5.0  
NDAI0G00400 Chr7 (78577..79731,79733..84067) [5490 bp, 1829 aa] ...    34   5.0  
NCAS0D00840 Chr4 (151160..157006) [5847 bp, 1948 aa] {ON}              34   5.1  
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...    33   5.1  
Smik_6.237 Chr6 (390290..391525) [1236 bp, 411 aa] {ON} YGR142W ...    33   5.1  
TBLA0H00560 Chr8 complement(107440..114090) [6651 bp, 2216 aa] {...    34   5.1  
NCAS0J01800 Chr10 complement(336846..338093) [1248 bp, 415 aa] {...    33   5.1  
Smik_10.366 Chr10 complement(564219..565466) [1248 bp, 415 aa] {...    33   5.1  
NDAI0J02480 Chr10 complement(606429..613145) [6717 bp, 2238 aa] ...    34   5.1  
ZYRO0B13618g Chr2 complement(1104318..1105574) [1257 bp, 418 aa]...    33   5.1  
NCAS0B07450 Chr2 complement(1406096..1407364) [1269 bp, 422 aa] ...    33   5.1  
Kwal_47.18943 s47 (1034388..1035659) [1272 bp, 423 aa] {ON} YGR1...    33   5.1  
TPHA0N01670 Chr14 (360932..362239) [1308 bp, 435 aa] {ON} Anc_2....    33   5.2  
Smik_6.82 Chr6 (154495..155823) [1329 bp, 442 aa] {ON} YFL001W (...    33   5.2  
TBLA0H00950 Chr8 (206384..207742) [1359 bp, 452 aa] {ON} Anc_8.3...    33   5.3  
YLR431C Chr12 complement(1000342..1001703) [1362 bp, 453 aa] {ON...    33   5.3  
SAKL0B03036g Chr2 complement(282513..283931) [1419 bp, 472 aa] {...    33   5.3  
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    32   5.4  
TBLA0H00800 Chr8 (179344..180789) [1446 bp, 481 aa] {ON} Anc_8.4...    33   5.4  
NDAI0D01960 Chr4 (463685..465130) [1446 bp, 481 aa] {ON} Anc_5.1...    33   5.4  
SAKL0G05434g Chr7 complement(445684..447177) [1494 bp, 497 aa] {...    33   5.4  
KLTH0F11528g Chr6 complement(976482..977978) [1497 bp, 498 aa] {...    33   5.4  
Skud_11.133 Chr11 (247837..248664) [828 bp, 275 aa] {ON} YKL095W...    33   5.5  
Suva_6.202 Chr6 (360351..361865) [1515 bp, 504 aa] {ON} YJL123C ...    33   5.5  
CAGL0K03619g Chr11 complement(335752..336357) [606 bp, 201 aa] {...    33   5.5  
YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON} ...    33   5.5  
NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852...    33   5.5  
YDL197C Chr4 complement(104917..106494) [1578 bp, 525 aa] {ON}  ...    33   5.5  
TDEL0F02080 Chr6 complement(376188..377834) [1647 bp, 548 aa] {O...    33   5.6  
KLLA0E07877g Chr5 complement(705849..707534) [1686 bp, 561 aa] {...    33   5.6  
NCAS0E00440 Chr5 complement(71936..73627) [1692 bp, 563 aa] {ON}...    33   5.6  
Kpol_413.5 s413 (13659..15365) [1707 bp, 568 aa] {ON} (13659..15...    33   5.6  
TBLA0B00190 Chr2 complement(30769..32499) [1731 bp, 576 aa] {ON}...    33   5.7  
TPHA0F02770 Chr6 complement(612966..613847) [882 bp, 293 aa] {ON...    33   5.7  
KLLA0D02090g Chr4 (178880..180688) [1809 bp, 602 aa] {ON} some s...    33   5.7  
KNAG0G03560 Chr7 complement(756987..758855) [1869 bp, 622 aa] {O...    33   5.8  
KAFR0A00360 Chr1 (68581..69492) [912 bp, 303 aa] {ON} Anc_2.626 ...    33   5.8  
NDAI0F04330 Chr6 (1061030..1063003) [1974 bp, 657 aa] {ON} Anc_1...    33   5.8  
ZYRO0A10846g Chr1 complement(872490..874511) [2022 bp, 673 aa] {...    33   5.9  
ACR038W Chr3 (428006..430030) [2025 bp, 674 aa] {ON} Syntenic ho...    33   5.9  
NCAS0D01410 Chr4 (263759..265897) [2139 bp, 712 aa] {ON}               33   5.9  
ZYRO0G03322g Chr7 complement(255923..258088) [2166 bp, 721 aa] {...    33   5.9  
TDEL0G01520 Chr7 complement(300761..302935) [2175 bp, 724 aa] {O...    33   5.9  
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...    33   5.9  
Skud_10.46 Chr10 complement(76968..79172) [2205 bp, 734 aa] {ON}...    33   6.0  
NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {O...    33   6.0  
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    33   6.0  
TDEL0B05170 Chr2 complement(908649..910931) [2283 bp, 760 aa] {O...    33   6.0  
TPHA0A06030 Chr1 complement(1363382..1365667) [2286 bp, 761 aa] ...    33   6.0  
CAGL0L04466g Chr12 (519292..521643) [2352 bp, 783 aa] {ON} simil...    33   6.0  
SAKL0H15928g Chr8 complement(1388807..1391167) [2361 bp, 786 aa]...    33   6.0  
Kpol_483.6 s483 complement(10699..13068) [2370 bp, 789 aa] {ON} ...    33   6.0  
KLLA0B10285g Chr2 complement(900197..900862) [666 bp, 221 aa] {O...    33   6.0  
NDAI0E04900 Chr5 (1113519..1115924) [2406 bp, 801 aa] {ON} Anc_7...    33   6.0  
YPL121C Chr16 complement(320962..321630) [669 bp, 222 aa] {ON}  ...    33   6.1  
Kpol_1069.12 s1069 (24455..26917) [2463 bp, 820 aa] {ON} (24455....    33   6.1  
NCAS0H02980 Chr8 complement(578657..579022) [366 bp, 121 aa] {ON...    32   6.1  
KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {O...    33   6.1  
KNAG0M02260 Chr13 complement(417569..420112) [2544 bp, 847 aa] {...    33   6.1  
Kwal_23.3607 s23 (361204..362205) [1002 bp, 333 aa] {ON} YDL099W...    33   6.1  
Kpol_1037.39 s1037 (95994..98576) [2583 bp, 860 aa] {ON} (95994....    33   6.1  
TBLA0A00380 Chr1 complement(71855..74446) [2592 bp, 863 aa] {ON}...    33   6.1  
Kwal_47.19214 s47 complement(1136336..1138966) [2631 bp, 876 aa]...    33   6.1  
Suva_4.147 Chr4 (271952..272971) [1020 bp, 339 aa] {ON} YDL099W ...    33   6.2  
Kpol_1032.56 s1032 complement(126409..129156) [2748 bp, 915 aa] ...    33   6.2  
TBLA0C01420 Chr3 (324857..327610) [2754 bp, 917 aa] {ON} Anc_2.6...    33   6.2  
YGL093W Chr7 (334886..337639) [2754 bp, 917 aa] {ON}  SPC105Subu...    33   6.2  
Kpol_1012.4 s1012 (6918..7946) [1029 bp, 342 aa] {ON} (6918..794...    33   6.2  
Skud_7.119 Chr7 (220776..221804) [1029 bp, 342 aa] {ON} YGL153W ...    33   6.2  
TDEL0D00940 Chr4 complement(170061..171107) [1047 bp, 348 aa] {O...    33   6.2  
KLTH0D06292g Chr4 (553292..553351,553408..554037) [690 bp, 229 a...    33   6.2  
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    33   6.2  
Smik_15.305 Chr15 (523059..526106) [3048 bp, 1015 aa] {ON} YOR12...    33   6.3  
KLTH0G12452g Chr7 complement(1058360..1058896) [537 bp, 178 aa] ...    32   6.3  
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...    33   6.3  
NDAI0G04840 Chr7 complement(1165244..1168516) [3273 bp, 1090 aa]...    33   6.3  
Ecym_1250 Chr1 complement(509750..513049) [3300 bp, 1099 aa] {ON...    33   6.3  
NDAI0F02790 Chr6 (685315..688629) [3315 bp, 1104 aa] {ON} Anc_2....    33   6.3  
TBLA0H00570 Chr8 (116301..119630) [3330 bp, 1109 aa] {ON} Anc_8....    33   6.3  
NCAS0D04080 Chr4 (766605..770144) [3540 bp, 1179 aa] {ON} Anc_6....    33   6.4  
KAFR0K01520 Chr11 (315301..318942) [3642 bp, 1213 aa] {ON} Anc_3...    33   6.4  
SAKL0B00594g Chr2 (59062..59064,59124..59828) [708 bp, 235 aa] {...    33   6.4  
TBLA0A08600 Chr1 complement(2120498..2121604) [1107 bp, 368 aa] ...    33   6.4  
NCAS0I01830 Chr9 complement(336447..340220) [3774 bp, 1257 aa] {...    33   6.4  
SAKL0E08910g Chr5 complement(730567..734409) [3843 bp, 1280 aa] ...    33   6.4  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...    33   6.4  
YER008C Chr5 complement(167808..171818) [4011 bp, 1336 aa] {ON} ...    33   6.4  
Ecym_3119 Chr3 (221707..222843) [1137 bp, 378 aa] {ON} similar t...    33   6.5  
Skud_10.358 Chr10 complement(634658..635377) [720 bp, 239 aa] {O...    33   6.5  
CAGL0M09086g Chr13 complement(904879..909219) [4341 bp, 1446 aa]...    33   6.5  
TPHA0G01720 Chr7 complement(353681..354403) [723 bp, 240 aa] {ON...    33   6.5  
NCAS0B03010 Chr2 (519106..519828) [723 bp, 240 aa] {ON} Anc_8.40...    33   6.5  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....    33   6.5  
Smik_4.813 Chr4 complement(1422455..1423609) [1155 bp, 384 aa] {...    33   6.5  
KNAG0M00880 Chr13 complement(149355..154796) [5442 bp, 1813 aa] ...    33   6.6  
CAGL0G04807g Chr7 complement(458085..458822) [738 bp, 245 aa] {O...    33   6.6  
Kpol_526.27 s526 complement(66411..67637) [1227 bp, 408 aa] {ON}...    33   6.7  
Ecym_7030 Chr7 complement(60760..61998) [1239 bp, 412 aa] {ON} s...    33   6.7  
KLTH0D15642g Chr4 complement(1289632..1290873) [1242 bp, 413 aa]...    33   6.7  
TBLA0E00830 Chr5 (180964..182208) [1245 bp, 414 aa] {ON} Anc_7.5...    33   6.7  
Kwal_26.8633 s26 complement(874800..875366) [567 bp, 188 aa] {ON...    32   6.7  
KAFR0C03990 Chr3 complement(797646..798908) [1263 bp, 420 aa] {O...    33   6.8  
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    33   6.8  
Suva_2.421 Chr2 complement(746152..747417) [1266 bp, 421 aa] {ON...    33   6.8  
TPHA0A03000 Chr1 (649118..661423) [12306 bp, 4101 aa] {ON} Anc_1...    33   6.9  
CAGL0J11572g Chr10 complement(1124993..1126375) [1383 bp, 460 aa...    33   7.0  
NDAI0J02470 Chr10 (604730..606118) [1389 bp, 462 aa] {ON} Anc_4....    33   7.0  
CAGL0M03685g Chr13 complement(413333..414814) [1482 bp, 493 aa] ...    33   7.1  
ZYRO0F14278g Chr6 (1171697..1173184) [1488 bp, 495 aa] {ON} simi...    33   7.1  
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...    33   7.1  
NCAS0B08800 Chr2 complement(1690738..1692240) [1503 bp, 500 aa] ...    33   7.1  
NCAS0C02570 Chr3 (482669..484186) [1518 bp, 505 aa] {ON} Anc_8.4...    33   7.2  
YGR059W Chr7 (607563..609101) [1539 bp, 512 aa] {ON}  SPR3Sporul...    33   7.2  
TBLA0I00580 Chr9 complement(102907..104451) [1545 bp, 514 aa] {O...    33   7.2  
CAGL0J09636g Chr10 (946436..948028) [1593 bp, 530 aa] {ON} simil...    33   7.3  
NCAS0F02040 Chr6 (406821..408419) [1599 bp, 532 aa] {ON} Anc_5.5...    33   7.3  
CAGL0F08063g Chr6 complement(796793..798397) [1605 bp, 534 aa] {...    33   7.3  
KNAG0D02660 Chr4 (475678..477321) [1644 bp, 547 aa] {ON} Anc_8.7...    33   7.3  
TPHA0F03110 Chr6 complement(682012..683664) [1653 bp, 550 aa] {O...    33   7.3  
YKL083W Chr11 (280921..281535) [615 bp, 204 aa] {OFF} Dubious op...    32   7.4  
ZYRO0E02596g Chr5 complement(202673..204409) [1737 bp, 578 aa] {...    33   7.4  
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    33   7.5  
TPHA0C02270 Chr3 (514271..516055) [1785 bp, 594 aa] {ON} Anc_8.4...    33   7.5  
ZYRO0C14652g Chr3 complement(1141806..1142681) [876 bp, 291 aa] ...    33   7.5  
KLLA0F07821g Chr6 (737054..738874) [1821 bp, 606 aa] {ON} simila...    33   7.5  
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...    33   7.5  
NDAI0C01420 Chr3 complement(296940..298784) [1845 bp, 614 aa] {O...    33   7.5  
Skud_11.315 Chr11 (566382..568226) [1845 bp, 614 aa] {ON} YKR078...    33   7.5  
KAFR0D03630 Chr4 (708577..709464) [888 bp, 295 aa] {ON} Anc_1.50...    33   7.5  
TPHA0J02950 Chr10 complement(653615..654508) [894 bp, 297 aa] {O...    33   7.6  
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    33   7.6  
TPHA0F00540 Chr6 (126413..126452,126544..127139) [636 bp, 211 aa...    32   7.7  
NCAS0G01240 Chr7 (219702..220343) [642 bp, 213 aa] {ON} Anc_6.25...    32   7.7  
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    33   7.7  
KLLA0D18392g Chr4 complement(1550900..1553032) [2133 bp, 710 aa]...    33   7.8  
NCAS0B00630 Chr2 complement(91273..92211) [939 bp, 312 aa] {ON} ...    33   7.8  
Suva_13.373 Chr13 (627318..629513) [2196 bp, 731 aa] {ON} YMR192...    33   7.8  
TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1...    33   7.8  
TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {O...    33   7.8  
TDEL0C05860 Chr3 complement(1053330..1055570) [2241 bp, 746 aa] ...    33   7.8  
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    33   7.8  
TPHA0C02100 Chr3 complement(474863..477127) [2265 bp, 754 aa] {O...    33   7.8  
YNL258C Chr14 complement(158109..160373) [2265 bp, 754 aa] {ON} ...    33   7.8  
Kwal_55.19939 s55 complement(185588..187921) [2334 bp, 777 aa] {...    33   7.9  
TBLA0F01510 Chr6 (372581..374989) [2409 bp, 802 aa] {ON} Anc_7.4...    33   7.9  
Smik_12.243 Chr12 (464959..467373) [2415 bp, 804 aa] {ON} YLR182...    33   7.9  
CAGL0C04851g Chr3 complement(452035..452697) [663 bp, 220 aa] {O...    32   8.0  
Skud_16.178 Chr16 complement(324318..326855) [2538 bp, 845 aa] {...    33   8.0  
NDAI0H03500 Chr8 (852528..855134) [2607 bp, 868 aa] {ON} Anc_1.3...    33   8.0  
Kpol_1018.81 s1018 (222032..223027) [996 bp, 331 aa] {ON} (22203...    33   8.0  
Smik_8.127 Chr8 complement(190428..193079) [2652 bp, 883 aa] {ON...    33   8.0  
ZYRO0A11726g Chr1 (944766..945767) [1002 bp, 333 aa] {ON} simila...    33   8.1  
YLL003W Chr12 (143201..146041) [2841 bp, 946 aa] {ON}  SFI1Centr...    33   8.1  
YLR026C Chr12 complement(195450..196472) [1023 bp, 340 aa] {ON} ...    33   8.1  
SAKL0E11066g Chr5 (928800..931697) [2898 bp, 965 aa] {ON} simila...    33   8.1  
Smik_12.128 Chr12 complement(248572..251469) [2898 bp, 965 aa] {...    33   8.1  
Skud_1.25 Chr1 (52060..55038) [2979 bp, 992 aa] {ON} YAL035W (REAL)    33   8.2  
KAFR0C00300 Chr3 (57523..60540) [3018 bp, 1005 aa] {ON} Anc_3.30...    33   8.2  
TBLA0B09280 Chr2 complement(2201613..2204657) [3045 bp, 1014 aa]...    33   8.2  
Skud_4.573 Chr4 complement(1023479..1026652) [3174 bp, 1057 aa] ...    33   8.2  
NDAI0C03300 Chr3 complement(748846..752085) [3240 bp, 1079 aa] {...    33   8.3  
Kpol_1064.44 s1064 complement(81934..85191) [3258 bp, 1085 aa] {...    33   8.3  
TBLA0C02980 Chr3 complement(721351..724704) [3354 bp, 1117 aa] {...    33   8.3  
KLLA0C17380g Chr3 (1524716..1528075) [3360 bp, 1119 aa] {ON} wea...    33   8.3  
Kwal_23.2990 s23 (102421..105822) [3402 bp, 1134 aa] {OFF} YNL09...    33   8.3  
Kwal_YGOB_23.2990 s23 (102421..105852) [3432 bp, 1144 aa] {ON} A...    33   8.3  
NCAS0C03320 Chr3 complement(651717..652250) [534 bp, 177 aa] {ON...    32   8.3  
YKL042W Chr11 (358475..359566) [1092 bp, 363 aa] {ON}  SPC42Cent...    33   8.4  
Ecym_4590 Chr4 complement(1152852..1153949) [1098 bp, 365 aa] {O...    33   8.4  
Kwal_27.11281 s27 (723148..726984) [3837 bp, 1278 aa] {ON} YDR15...    33   8.4  
NDAI0E00680 Chr5 complement(138393..142256) [3864 bp, 1287 aa] {...    33   8.4  
Skud_9.41 Chr9 (95085..99164) [4080 bp, 1359 aa] {ON} YIL126W (R...    33   8.5  
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)    33   8.5  
Smik_9.205 Chr9 complement(341468..345799) [4332 bp, 1443 aa] {O...    33   8.5  
Kpol_2002.21 s2002 complement(42642..43778) [1137 bp, 378 aa] {O...    33   8.5  
Smik_2.80 Chr2 complement(147598..152148) [4551 bp, 1516 aa] {ON...    33   8.5  
Smik_2.81 Chr2 complement(147598..152148) [4551 bp, 1516 aa] {ON...    33   8.5  
CAGL0J05654g Chr10 (540710..545416) [4707 bp, 1568 aa] {ON} simi...    33   8.6  
Kwal_56.24033 s56 complement(819853..821013) [1161 bp, 386 aa] {...    33   8.6  
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...    33   8.7  
Kpol_344.6 s344 (13142..19165) [6024 bp, 2007 aa] {ON} (13142..1...    33   8.7  
YJL005W Chr10 (425157..431237) [6081 bp, 2026 aa] {ON}  CYR1Aden...    33   8.7  
Kpol_297.3 s297 complement(4030..4761) [732 bp, 243 aa] {ON} com...    32   8.7  
KLLA0F13794g Chr6 complement(1278244..1279446) [1203 bp, 400 aa]...    33   8.7  
Suva_4.248 Chr4 complement(438356..439573) [1218 bp, 405 aa] {ON...    33   8.8  
Suva_7.429 Chr7 (742946..744172) [1227 bp, 408 aa] {ON} YGR142W ...    33   8.8  
CAGL0D01826g Chr4 (189933..197933) [8001 bp, 2666 aa] {ON} simil...    33   8.8  
Skud_5.286 Chr5 complement(456819..458081) [1263 bp, 420 aa] {ON...    33   8.9  
NCAS0G00570 Chr7 (96859..98124) [1266 bp, 421 aa] {ON} Anc_5.650...    33   8.9  
Skud_4.517 Chr4 complement(921065..922330) [1266 bp, 421 aa] {ON...    33   8.9  
ACR258W Chr3 (809748..821999) [12252 bp, 4083 aa] {ON} Syntenic ...    33   9.0  
TBLA0D05690 Chr4 complement(1397632..1410426) [12795 bp, 4264 aa...    33   9.0  
Suva_3.184 Chr3 complement(279117..280448) [1332 bp, 443 aa] {ON...    33   9.0  
KAFR0D00430 Chr4 complement(62690..64060) [1371 bp, 456 aa] {ON}...    33   9.1  
Smik_4.667 Chr4 (1180706..1182076) [1371 bp, 456 aa] {ON} YDR393...    33   9.1  
Kwal_23.3213 s23 (201232..202605) [1374 bp, 457 aa] {ON} YLR238W...    33   9.1  
SAKL0C08558g Chr3 (785340..786755) [1416 bp, 471 aa] {ON} simila...    33   9.2  
Kwal_47.19212 s47 complement(1135094..1135894) [801 bp, 266 aa] ...    32   9.3  
SAKL0A00352g Chr1 complement(38015..39487) [1473 bp, 490 aa] {ON...    33   9.3  
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    33   9.4  
Smik_13.304 Chr13 (481156..482661) [1506 bp, 501 aa] {ON} YMR115...    33   9.4  
KNAG0C03850 Chr3 (753590..755101) [1512 bp, 503 aa] {ON} Anc_7.3...    33   9.4  
TPHA0H02730 Chr8 complement(642961..644511) [1551 bp, 516 aa] {O...    33   9.5  
TPHA0M01100 Chr13 complement(220631..222181) [1551 bp, 516 aa] {...    33   9.5  
KLTH0E10692g Chr5 complement(962373..963941) [1569 bp, 522 aa] {...    33   9.5  
TPHA0B02810 Chr2 (639564..641177) [1614 bp, 537 aa] {ON} Anc_7.2...    33   9.6  
KLTH0G17468g Chr7 complement(1513882..1515498) [1617 bp, 538 aa]...    33   9.6  
NDAI0E03270 Chr5 (703001..704662) [1662 bp, 553 aa] {ON} Anc_8.4...    33   9.6  
YKL109W Chr11 (232227..233891) [1665 bp, 554 aa] {ON}  HAP4Subun...    33   9.6  
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    33   9.7  
KAFR0D02810 Chr4 complement(559344..561029) [1686 bp, 561 aa] {O...    33   9.7  
NDAI0F03140 Chr6 (756038..756889) [852 bp, 283 aa] {ON} Anc_2.10...    32   9.7  
KLLA0B00803g Chr2 (62255..63982) [1728 bp, 575 aa] {ON} weakly s...    33   9.7  
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    33   9.8  
TBLA0D04210 Chr4 complement(1039847..1041622) [1776 bp, 591 aa] ...    33   9.8  
NCAS0H01750 Chr8 complement(335899..336073,336141..336253) [288 ...    30   9.9  
TPHA0M00670 Chr13 complement(128546..129421) [876 bp, 291 aa] {O...    32   9.9  
KAFR0E03620 Chr5 (726920..728791) [1872 bp, 623 aa] {ON} Anc_5.4...    33   9.9  
Kwal_23.5204 s23 complement(1060190..1061074) [885 bp, 294 aa] {...    32   9.9  
Suva_1.57 Chr1 (108430..110349) [1920 bp, 639 aa] {ON} YAL011W (...    33   10.0 
TDEL0G02590 Chr7 (496016..497950) [1935 bp, 644 aa] {ON} Anc_2.3...    33   10.0 

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score = 2682 bits (6951), Expect = 0.0
 Identities = 1430/1554 (92%), Positives = 1430/1554 (92%)
 Frame = +1

Query: 1    MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDI 180
            MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDI
Sbjct: 1    MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDI 60

Query: 181  KHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLI 360
            KHVYEGKINTISQKYF             SGYLVAREKLVSEKQKEFDSNDALNSEITLI
Sbjct: 61   KHVYEGKINTISQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLI 120

Query: 361  KYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQEL 540
            KYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQEL
Sbjct: 121  KYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQEL 180

Query: 541  WLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILS 720
            WLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILS
Sbjct: 181  WLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILS 240

Query: 721  LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS 900
            LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS
Sbjct: 241  LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS 300

Query: 901  YKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKF 1080
            YKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKF
Sbjct: 301  YKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKF 360

Query: 1081 GNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRIT 1260
            GNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRIT
Sbjct: 361  GNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRIT 420

Query: 1261 SSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTE 1440
            SSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTE
Sbjct: 421  SSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTE 480

Query: 1441 KEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXE 1620
            KEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNM                E
Sbjct: 481  KEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQE 540

Query: 1621 QEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXX 1800
            QEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLV         
Sbjct: 541  QEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVTNSTIQSNT 600

Query: 1801 XXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALN 1980
                      CELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALN
Sbjct: 601  SNNSISSLQQCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALN 660

Query: 1981 FDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQ 2160
            FDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQ
Sbjct: 661  FDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQ 720

Query: 2161 KISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEK 2340
            KISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEK
Sbjct: 721  KISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEK 780

Query: 2341 EPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHL 2520
            EPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHL
Sbjct: 781  EPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHL 840

Query: 2521 KLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTE 2700
            KLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQG               TE
Sbjct: 841  KLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGKEKELNELKSKLVEKTE 900

Query: 2701 KLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIES 2880
            KLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIES
Sbjct: 901  KLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIES 960

Query: 2881 NYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXX 3060
            NYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKM   
Sbjct: 961  NYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMLAL 1020

Query: 3061 XXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLI 3240
                     RRARYRNKNPREKFPSFVKIDQQS        VMENTTKLLALEESNAKLI
Sbjct: 1021 NLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEEDKEEVMENTTKLLALEESNAKLI 1080

Query: 3241 KEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQ 3420
            KEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQ
Sbjct: 1081 KEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQ 1140

Query: 3421 TILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQ 3600
            TILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQ
Sbjct: 1141 TILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQ 1200

Query: 3601 INLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELE 3780
            INLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELE
Sbjct: 1201 INLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELE 1260

Query: 3781 KKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXX 3960
            KKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQM      
Sbjct: 1261 KKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKT 1320

Query: 3961 XXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLP 4140
                   TILAQRKNNILANGQESANI            ALILKRITEAEENLKKRMRLP
Sbjct: 1321 KLEKEKETILAQRKNNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLP 1380

Query: 4141 SEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIK 4320
            SEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIK
Sbjct: 1381 SEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIK 1440

Query: 4321 KKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVXXXXXXXXXXXXXXXXG 4500
            KKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQV                G
Sbjct: 1441 KKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKINLSNINSSSPPLG 1500

Query: 4501 EKVLQLNYGANVVAETDNDDNPFTLQSGKDETLLTKRSADNEIIQDIIKRPKEE 4662
            EKVLQLNYGANVVAETDNDDNPFTLQSGKDETLLTKRSADNEIIQDIIKRPKEE
Sbjct: 1501 EKVLQLNYGANVVAETDNDDNPFTLQSGKDETLLTKRSADNEIIQDIIKRPKEE 1554

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  548 bits (1411), Expect = e-166
 Identities = 467/1651 (28%), Positives = 785/1651 (47%), Gaps = 182/1651 (11%)
 Frame = +1

Query: 40   IDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDIKHVYEGKINTISQ 219
            ++ +++  ++     E+++   LEKI  K     +E   ++A ID+ K     + +T+  
Sbjct: 4    LNNLATSLEVTATDLETIEPTVLEKINAKLLSSEQEKDRLNATIDNFKSKMSSQFDTVKN 63

Query: 220  KYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDL--------- 372
                               L+  +K +  K  +++   A + +I+  K DL         
Sbjct: 64   DL--------ELLQKEKELLIQDKKQLESKCIQWEQQYAQHQDIS--KTDLASDDVIKEN 113

Query: 373  EAMQRDHTTLEA-------RERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMT 531
            E  +RDH  L +       +    +  LE+      +   +N  ++ Q+  F+ +   + 
Sbjct: 114  ETFKRDHQLLTSDLMNLSKKLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLK 173

Query: 532  QELWLANTENKKLQTGMKLLRENNLYLEIKCKE-TDKNKKLY----SSAEDASRLQDQLQ 696
             +      + ++L+     ++    Y E   KE ++ + K Y    SS+ +    +D L 
Sbjct: 174  SKYERKVKDFEELKNAYSSMKT---YEETSRKELSEMSNKFYTLKTSSSNELRNAKDALH 230

Query: 697  IVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNE 876
             +  +   L  E    K  N  L+T +  +LF+ K L+++LN  K+ F +E+TL Q  N+
Sbjct: 231  SLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHEND 290

Query: 877  LLHNEIASYKKQIERLTSKNLETPEK-KIIQELVDLKEKLVNSEKECNELKSTVDKYINI 1053
            LL   I  Y K   + T+    T EK +++ ELVD+K+ L  SE E   L   +++Y+  
Sbjct: 291  LLKEHI-EYLKNTTKETTGGTSTLEKDRLLHELVDIKKSLEKSELENVHLNDFIEQYLTE 349

Query: 1054 DEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSS 1233
            +E+       +  +L+ +L+ QL+KEKR KD LQ QVE F++ELE +LP ++S K+RN +
Sbjct: 350  NEEST-----SDNELV-LLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQT 403

Query: 1234 LERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLC 1413
            LE+EL++IT  LEET +E DI+ +ELT   +++    +  + L+ QR DLAHQVQ+LLL 
Sbjct: 404  LEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLN 463

Query: 1414 IDNKSP----FTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXX 1581
            +D K       T  E T ++KI+ + N++ND+DS KIIS+RL+ F ++  LQ++NM    
Sbjct: 464  LDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLT 523

Query: 1582 XXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSY 1761
                          + +   +IT N    + AK     L++ I  L SK+  + +E+D+Y
Sbjct: 524  TTRNLAEQLE--SSDTKSVQKITRNESKEKIAK-----LQESINGLTSKLEKLQKEKDAY 576

Query: 1762 KLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEEL--------ENK 1917
            KLL                     +   E L ++L   ++Q  K LE +        E K
Sbjct: 577  KLLSLQNTGE--------------QTPTEELRSQLQKKEEQLTK-LERMSSLDSHLAEEK 621

Query: 1918 IKTLQKSQLTSKMEVEKHALNFDEMKDNNN--LLKEYVDKLENKIKTLEQ--DLA--ENE 2079
             K L +S +  K++ EK+ LN   +K+ +   + ++    LE+ ++ L +  DLA  + E
Sbjct: 622  AKVLNQSII--KLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKKYE 679

Query: 2080 LFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSK-------NKNLEDKILTM 2238
             +E  L      N++ S+  E    + KIS L KEI + K         N+N   K+   
Sbjct: 680  HYETLLNDHNAENIKHSR--ENETTQAKISILQKEIESYKQNLLQYSKDNENTLSKLAAA 737

Query: 2239 TLSKNLLDNKVLQLETSLSER-------------------ELPKNTQIKNEEK------- 2340
            T  K  L +++  ++  L ++                    L K ++I+ E+K       
Sbjct: 738  TQEKETLGSRLSTVKNELEQKINLMQERETYYKEHDSISERLLKKSKIQLEDKIKEVKDF 797

Query: 2341 EPAKQQTYTFERKKLESV---NDS------------DISYLYYENLEELQNQ-------- 2451
            E  K     + +K+L+S+   ND             +I  L   +LE+  +Q        
Sbjct: 798  EAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKISDLEKTLSQNTNGSSSL 857

Query: 2452 ------FRTLRRELKEVQEDLDM---------KTESHLKLE-NKYTKVKND--------- 2556
                  F  L+ ELKE Q +++          +T++ L+ + NK  ++ +D         
Sbjct: 858  PRVDQDFEKLKNELKEKQLEINQYRDLLNLAEETKNRLQKDLNKQRQIVDDAMEGKEQLD 917

Query: 2557 --LKQATYKLASVYTTLEQKNSF-----------------LANSVSQLQGXXXXXXXXXX 2679
              L + T + +S+ + L+++ +                  L NS+S L+           
Sbjct: 918  QQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKNSLSSLENKITTLENEMV 977

Query: 2680 XXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQ 2859
                  E+ +    E   K++ +  L++ M  EN  +K +    K +++    AI++ +Q
Sbjct: 978  EKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQ 1037

Query: 2860 QSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILES-------YDGKILN-TAAIG 3015
            + L  + N+  ++D   E ++    ++    GK + I           D  ++N T+   
Sbjct: 1038 KLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKN 1097

Query: 3016 HLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMEN 3195
             L+ +L  E+              +R  Y  +   E   + +   +QS          E 
Sbjct: 1098 ELILALRRERD----GLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEM 1153

Query: 3196 TT------------KLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINE 3339
            TT            +L  L+E+N +L +++    K N  + ++L  ++ ++ PL+ ++  
Sbjct: 1154 TTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVER 1213

Query: 3340 LKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRT 3519
            LK  + EK+Q L +  EE ERWKLRS+ IL + + V+ E H K +E++ TL+ QL+T   
Sbjct: 1214 LKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTK 1273

Query: 3520 ENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE---IEKNNQ 3690
            +N  L DRF+RLKKQAHEKLDAAK    +LT +I +L + K  LE  L +E   I++   
Sbjct: 1274 DNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVES 1333

Query: 3691 SGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDA--------KKFKNEIESLKSELQS 3846
                  D  + I  L  EL  S   S ++E+ +++         KK   E+ SLKS+L++
Sbjct: 1334 QLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLET 1393

Query: 3847 VK-------AYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKN 4005
            +K         + S +NS+ I  LKESF+ EK ELI  +              +L +++ 
Sbjct: 1394 LKNQNGVISVADGSAINSETIAHLKESFEVEKTELITTLKEEFKKQLEEEKKKLLEEKEK 1453

Query: 4006 NIL----ANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEK 4173
                     G E  +I             +I++RI +AEENLKKR+RLPSEEKIN VIEK
Sbjct: 1454 EYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIEK 1513

Query: 4174 RRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQS 4353
            RRK LE+E+E KL+  GL  +   +  + R ++E+ELR KF+ ELAE+KKKAF EGKQQS
Sbjct: 1514 RRKELEEEYEKKLKRQGLTTE-TAIEEELRKEVERELRVKFDNELAEVKKKAFLEGKQQS 1572

Query: 4354 MMKSTLLERKLSKLESQTLSPTKNNDSNETQ 4446
             MK+TLLERKLSKLESQ  SP++  D   +Q
Sbjct: 1573 QMKTTLLERKLSKLESQA-SPSRTPDLESSQ 1602

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  496 bits (1278), Expect = e-147
 Identities = 450/1688 (26%), Positives = 792/1688 (46%), Gaps = 225/1688 (13%)
 Frame = +1

Query: 16   RNEPT-PSIIDKI-----SSFFDLPGNTWESMDEHALEKIYTKAYD---LMKENSFVSAA 168
            +N PT PS+I +I     SSF +L  +   ++D   + ++  KA     L  +N   S  
Sbjct: 4    QNSPTTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVT 63

Query: 169  IDDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSE 348
            +D++K   E +      +                 +   + KL+ EK       + L S+
Sbjct: 64   LDELKSSSERRSEAFKLQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQ 123

Query: 349  ITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSM 528
            +T +K   E  +     +     +    LE S+ E +  L     L++Q+   E ++ + 
Sbjct: 124  LTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTF 183

Query: 529  TQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAED----ASRLQDQLQ 696
                     E ++L   M LL+ NN +LE         K+L S +E+      R+  +LQ
Sbjct: 184  KSNDLRGKAEMQRLTQEMNLLKSNNQWLE---------KELASKSEEFGSYRQRVNSELQ 234

Query: 697  IVSSEILSLKSEIA-------TLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEIT 855
               SE+ S++SE+        TLK     LS  LQ K+  +K L D+ +  KQEF +E+T
Sbjct: 235  TALSELNSIRSELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMT 294

Query: 856  LKQRVNELLHNEIASYKKQIERLTSKNLETPE------KKIIQELVDLKEKLVNSEKECN 1017
            LKQR+ +LL  +I S+K ++E   +K++   +      +KII+EL++ K+KL  SE +  
Sbjct: 295  LKQRLIDLLEKQIESFKTELESARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAV 354

Query: 1018 ELKSTVDKYINIDEKK---------LISKFGNPKKL---IEILRRQLVKEKRHKDTLQRQ 1161
            +L+ TVD+ ++ D ++         L SK     KL   I +L+++L++E+R K+ LQ Q
Sbjct: 355  KLEETVDELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQ 414

Query: 1162 VESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNN 1341
            VE+F++ELE K+P+++SFKER   LE+EL  +   LE T+K+++ K+ ELT+++ KI++ 
Sbjct: 415  VEAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADY 474

Query: 1342 EQFNDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTDSHK 1509
            E     L+RQRSDLAHQVQ+LL+ +    D+  P T +E   +KKI+++  +  + D+ +
Sbjct: 475  ETQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQR 534

Query: 1510 IISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTS 1689
            IIS+RL+ F+++ ELQ+KNM                E+E +   +  ++  + E AK   
Sbjct: 535  IISERLVRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKE-AKEAI 593

Query: 1690 VDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKER---LTN 1860
            + L+++ K+LES++ II++ERD++K+L                      L +E+   L N
Sbjct: 594  LTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELEN 653

Query: 1861 ELSSMKQQHVKVLEELENKIKTLQKSQLTSKME---------------------VEKHAL 1977
             LSS+ ++  K ++ L  +I +L ++Q  + +                      +E   +
Sbjct: 654  HLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKM 713

Query: 1978 NFDEMKDNNNLLKEYVDKLENKIK-TLE------------QDLAENELFEKNLITGGVNN 2118
              DE++   + L+E + K ++K + T+E            Q    N   E++L+     N
Sbjct: 714  ENDELRKRFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQEN 773

Query: 2119 LEQSK-------------IIELSVAE-QKISFLDKEISNLKSKNKNLEDKILTMTLSKNL 2256
            L++               I +L   + ++ S L++   N + K   LE + L+ TL K  
Sbjct: 774  LKKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETE-LSDTLEK-- 830

Query: 2257 LDNKVLQLETSLSERELPK----------NTQIKNE-EKEPAKQQTYTFERKKLESVN-- 2397
            LD K  ++   +S ++  +          N ++ N  EK  +K         K+ES+N  
Sbjct: 831  LDAKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNK 890

Query: 2398 --DSDISYLYYENL---EELQNQFRTLRRELKEVQ---EDLDMKTESHLKL----ENKYT 2541
              +S+     +  L   E +++Q  TLR+EL++ +    D   + E +  +    E   T
Sbjct: 891  LEESEARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESAT 950

Query: 2542 KVKNDLKQATYKLASVYTTLEQK------------------NSFLANSVSQLQGXXXXXX 2667
             +K+ L+Q+  +      TL ++                  N+ L +  SQ +       
Sbjct: 951  AIKDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYT 1010

Query: 2668 XXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTF---------KDAFKH---- 2808
                       +L   + E  +KI+     +Q  + + T++         ++  KH    
Sbjct: 1011 RNLEDLKAKQSELDNMKAEYEQKISK----IQEDLNQQTSYANTAQKNYEQELQKHADVS 1066

Query: 2809 ------------FKNSLSRLRQAINS----IQQQSLVIE---SNYNTEIDHANERLEEAE 2931
                        +K+    LR A  +    ++Q  L  E   S+Y  E+  A++R+E+  
Sbjct: 1067 KKISLLRAEAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLN 1126

Query: 2932 VKMASFDGKVTEILE----SYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRAR 3099
             +      ++  + +    S +  +  +    +L+ SL  EK +            +  R
Sbjct: 1127 AQSKILYDQIDFLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLR 1186

Query: 3100 YRNKNPREKFP-SFVKIDQ-------QSXXXXXXXXVMENTTKLLALEESNAKLIKEVEN 3255
             + K        S +++ +        S        +M    +L  L ESN  L  E + 
Sbjct: 1187 QKLKLIESDLEGSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQK 1246

Query: 3256 CTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQ 3435
              + +  L ++L  +  K++PLE ++  L+  V EK+  +++  EE ERWK RSQ IL +
Sbjct: 1247 NGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHK 1306

Query: 3436 GKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTT 3615
             + ++ E H K  +K+  L++++++   EN +L  RF RLK+QAHEKL+AAKT Q  LT+
Sbjct: 1307 YERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTS 1366

Query: 3616 QINELNETKVNLEKSLQQ-------------EIEKNNQSGNGAADESEE-----IIRLRA 3741
            Q+N+L  TK  LE  L               +IEKN  S      E  E     ++    
Sbjct: 1367 QLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETEN 1426

Query: 3742 ELEKSNNFSNELEKKV-EDAKKFKNEIESLKSELQSVK---------AYENSTVNSKIIK 3891
            +LE+  + S  LEK++ E  +   N+I+ L+ +L+  K         + E     SKI++
Sbjct: 1427 KLEQVTSSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVE 1486

Query: 3892 DLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNI---LANGQ--ESANIXXXXX 4056
            +LK  F+ EK ++I                +IL  ++  +   LA  +     NI     
Sbjct: 1487 NLKIEFEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKK 1546

Query: 4057 XXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLR------- 4215
                       +RI E+ E LKKR+RLP+EEKIN ++EK+R  LE EFE  ++       
Sbjct: 1547 KWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIA 1606

Query: 4216 --ELGLNADGNGVVTDTRAQIE---KELREKFNLELAEIKKKAFEEGKQQSMMKSTLLER 4380
              +   N++   V+   +  +E   +E+++KF+ ++A+IKK+AFEEGKQQ+ MKST LE+
Sbjct: 1607 KSKSASNSNSTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEK 1666

Query: 4381 KLSKLESQ 4404
            K++KLE+Q
Sbjct: 1667 KIAKLETQ 1674

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 160/771 (20%), Positives = 320/771 (41%), Gaps = 37/771 (4%)
 Frame = +1

Query: 10   DSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDIKHV 189
            D   +  P + D+IS+  +   N  +S  E  +        DL  + S     +D++K  
Sbjct: 975  DMFKDQVPILKDQISNLNN-ELNHQKSQFESQISDYTRNLEDLKAKQS----ELDNMKAE 1029

Query: 190  YEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYD 369
            YE KI+ I +                S    A++    E QK  D    ++ +I+L++ +
Sbjct: 1030 YEQKISKIQEDL----------NQQTSYANTAQKNYEQELQKHAD----VSKKISLLRAE 1075

Query: 370  LEAMQRDHTTLEARERKTENVLEQSKLE------------------LQDSLTENSALKEQ 495
             +  + +  TL       +  LEQS+L                   ++D   ++  L +Q
Sbjct: 1076 AQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQ 1135

Query: 496  IGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDAS 675
            I        + +++L   +TE + L T ++  RE ++ LE K + + + +K+        
Sbjct: 1136 IDFLSKGKPTSSEDLMPISTETRNLLTSLR--REKDI-LETKLEVSTREEKV-------- 1184

Query: 676  RLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEIT 855
             L+ +L+++ S++   + E++ L+      S  L+ +    +++   LN         IT
Sbjct: 1185 -LRQKLKLIESDLEGSRIELSKLQRAASGNSATLKDQ----EEIMTQLNQLNLLRESNIT 1239

Query: 856  LKQRVNELLHNEIAS--YKKQIERLTSKNLETPEKKI--IQELV---DLKEKLVNSEKEC 1014
            L+   NE   N   S   K +++ L  K ++  E K+  +Q  V   DL+  L N E E 
Sbjct: 1240 LR---NEAQKNGERSRELKAELDALYGK-VQPLESKVTLLQNSVREKDLQISLKNEEAER 1295

Query: 1015 NELKST--VDKYINID---EKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLV 1179
             + +S   + KY  ID    +KL  K       +  L++++  +    + L  + +    
Sbjct: 1296 WKQRSQDILHKYERIDPEEHQKLADK-------VSELQQEIKSKSDENEELDTRFKRLKQ 1348

Query: 1180 ELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDE 1359
            +  +KL   ++ K   S+L  +L  + ++ E+   +   +  E+ NL+ KI++ E+    
Sbjct: 1349 QAHEKL---NAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKNKSS 1405

Query: 1360 LLRQRSDLAHQV---QYLLLCIDNK-SPFTEKEATLVKKIVSNENTENDTDSHKIISKRL 1527
               +++DL  Q+   Q  LL  +NK    T   A L K++  NE  E+  +  K++ + L
Sbjct: 1406 ---EKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKEL--NERIESLMNKIKLLEEDL 1460

Query: 1528 LHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKH 1707
               +                          E E++K   I+D     ES      + EK 
Sbjct: 1461 EKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDK----ESELREQFEEEK- 1515

Query: 1708 IKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQH 1887
               LE+K   + ++  + KL                      +   +R+      +K++ 
Sbjct: 1516 ASILEAKEQELREQLATQKL----DPPVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRI 1571

Query: 1888 VKVLEELENKIKTLQKSQLTSKME--VEKHALNFDEMKD-NNNLLKEYVDKLENKIKTLE 2058
                EE  NKI   ++ +L ++ E  V+K A    + K  +N+   E ++K +  ++ L+
Sbjct: 1572 RLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVLEKHKQDLENLK 1631

Query: 2059 QDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNK 2211
            Q++ +   F++++        E+ K      A  K +FL+K+I+ L+++ K
Sbjct: 1632 QEMQKK--FDEDIAQIKKRAFEEGK----QQASMKSTFLEKKIAKLETQIK 1676

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  488 bits (1257), Expect = e-144
 Identities = 443/1673 (26%), Positives = 747/1673 (44%), Gaps = 192/1673 (11%)
 Frame = +1

Query: 4    STDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYD---LMKENSFVSAAID 174
            S D+ N+ +   + K+S+F+ +P +    +D   L  +  K  D   L  +N  ++  ID
Sbjct: 14   SGDNHNDVS---LGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTID 70

Query: 175  DIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEIT 354
            +IK V   +   +  +               S       +   +KQK  +  ++L  +++
Sbjct: 71   EIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLS 130

Query: 355  LIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQ 534
             +  + E +++D   + A   +    LE  + E + SL ++  L++Q+   E  + ++  
Sbjct: 131  DLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKS 190

Query: 535  ELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEI 714
            +     +E + +   + +L++N+ +LE +   T K ++L S+     +  D+L  ++SE 
Sbjct: 191  KELRDQSEIQTITQRLTILQKNSQWLEEEV--TSKTEQLISTRR---KNDDELDRLTSES 245

Query: 715  LSLKSEIATLKYMN-------ESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVN 873
            LS K+E+   K  N       E L+  LQ KL  +KDL D+L   KQEFA E+++KQ++ 
Sbjct: 246  LSCKNELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLI 305

Query: 874  ELLHNEIASY---------KKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELK 1026
            +LL N++ S          K  +E L S    T  +K+IQEL+ LKE    SE+E   L+
Sbjct: 306  DLLENQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITLKENFEESERERLRLE 365

Query: 1027 STVDKYINIDEKK--------LISKFGNPKKLIE--ILRRQLVKEKRHKDTLQRQVESFL 1176
            + V + I  D+ +         IS       L +  IL+++L+KE+  K+ LQRQVESF+
Sbjct: 366  ALVQELIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFI 425

Query: 1177 VELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFND 1356
            VELE K+P+I+SFKER S LE+EL  +   L+ T+ E++ ++RE   L KK+ ++E    
Sbjct: 426  VELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIH 485

Query: 1357 ELLRQRSDLAH----------------------QVQYLLLCIDNKSPFTEKEATLV--KK 1464
             L RQR+DLAH                      +V ++   ++N  P +E ++  V  ++
Sbjct: 486  TLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISER 545

Query: 1465 IVSNEN------------------TENDTDSHKIISKRLLHFQN--VKELQQKNMXXXXX 1584
            +V   N                   E      K ++K++  F+N  +KE ++  +     
Sbjct: 546  LVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDY 605

Query: 1585 XXXXXXXXXXXEQEQQKTLRITDNNKIVESA----------KSTSVDLEKHIKTLESKIN 1734
                        +E      I   N   ++           ++ S D EK ++TLE+++ 
Sbjct: 606  NANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEK-LRTLEARLT 664

Query: 1735 IISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQ---QHVKVLEE 1905
             ++ E      ++                    ELEKER +  L+  +    QH   L  
Sbjct: 665  SLTVESSQNNKMLNNEIHELYRSKTQISI----ELEKERSSKTLTEERLKLIQHTLELTR 720

Query: 1906 LENKIKTLQKSQLTS-------------------------------KMEVEKHALNFDEM 1992
             EN+    +   L S                                +E EK  L   E 
Sbjct: 721  NENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSER 780

Query: 1993 KDNNNLLK--EYVDKLENKIKTLEQDLAENELFEKNLITG---GVNNLEQSKIIELSVAE 2157
                N LK  E  + L   +  L+   +E E F K + T     +++LEQ K    +  +
Sbjct: 781  TSRENYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLD 840

Query: 2158 QK--------------ISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLS 2295
             K              I +   ++ ++ +++++L+ ++ T T     L+++V +LE  + 
Sbjct: 841  AKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVE 900

Query: 2296 EREL----------------PKNTQIKNEEKEPAK-QQTYTF--ERKKLESVNDSDISYL 2418
            E E                 P+++  K  EK       TY    + K L S  +  +S L
Sbjct: 901  ESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQL 960

Query: 2419 ---YYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASV 2589
               Y    +ELQ Q  TL+ E  ++Q+ +    ES  KLE          +     L   
Sbjct: 961  TQDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKK 1020

Query: 2590 YTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTM 2769
              TLE ++        +                    + Q    E  +K +N    +  +
Sbjct: 1021 IATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISEL 1080

Query: 2770 VEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASF 2949
             E++   + A    KNS  ++RQ +   ++     +  Y  +++ + + LE+   + +  
Sbjct: 1081 REQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLL 1140

Query: 2950 DGKVTEIL-ESYDGKILNTAAIGHLVRSLIHEK-----KMXXXXXXXXXXXXRRARYRNK 3111
              ++     ++ DG    TA +  ++ +L  E+     K+              A   N+
Sbjct: 1141 YDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENE 1200

Query: 3112 --NPREKFPSFVK-IDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLS 3282
                + +   F K I   S        ++E   +L  L ESN  L    E   K N  L 
Sbjct: 1201 LDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQ 1260

Query: 3283 SQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAH 3462
             +L  ++ ++ PLE E+N L   V EK+Q LN+ +EE  RWK RSQ IL +   ++ E H
Sbjct: 1261 EELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDH 1320

Query: 3463 MKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETK 3642
             +  EK+  LE +L+    EN +L DRF+RLKKQAHEKL+++K  Q  L+ Q+NEL E K
Sbjct: 1321 KELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAK 1380

Query: 3643 VNLEKSLQQE---IEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKV-------- 3789
              LE   + E   + +  +  N   +++E +  ++ EL  +   S ELE+ +        
Sbjct: 1381 SELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATLQQNE 1440

Query: 3790 EDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDL-------KESFKREKDELIEQMXX 3948
            E  KK  +EI+SLK EL S+K    +T   +I +DL       + SF+ EK   +++   
Sbjct: 1441 EITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINFLKEKTE 1500

Query: 3949 XXXXXXXXXXXTILAQRKNNILANG----QESANIXXXXXXXXXXXXALILKRITEAEEN 4116
                         L + K+ +  NG    Q+  N               ILKRI EAEEN
Sbjct: 1501 ELKK---------LEEEKHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEEN 1551

Query: 4117 LKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGL---NADGNGVVTDTRAQIEKELR 4287
            LKKR+RLP+EE+I  V+EK++  LE+ ++ KL E      ++DGN   +D + Q+EK+L+
Sbjct: 1552 LKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESKSSLESSDGNN--SDLKKQLEKDLQ 1609

Query: 4288 EKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQ 4446
            EKF  E+  +KKKAFEEGKQQ+ MKSTLLERK+SKLESQ      + D + ++
Sbjct: 1610 EKFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKVDSPDKSSSE 1662

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  445 bits (1144), Expect = e-129
 Identities = 404/1638 (24%), Positives = 754/1638 (46%), Gaps = 171/1638 (10%)
 Frame = +1

Query: 49   ISSFFDLPGNTWESMDEHALEKIYTKAY---DLMKENSFVSAAIDDIKHVYEGKINTISQ 219
            I SF  +P     +++   L  + TK     +L  ++     ++++++   +G+IN +  
Sbjct: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75

Query: 220  KYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEF----DSNDALNSEITLIKYDLEAMQR 387
            +               S      EK +S+++KE      + D L +E+  I+   + +Q+
Sbjct: 76   QL----EDLIEQNASASEEKKKIEKELSDEKKESFQLSSTRDNLRAELKEIQEKFDNLQK 131

Query: 388  DHT-TLEARERK-TENVLEQS-KLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTE 558
             +  T++  +RK ++N +E+   L+L +   E++A    +   E ++ S+     L  T 
Sbjct: 132  QNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDL---EDEIQSLKYNDSLTETT 188

Query: 559  NKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSS--AEDASRLQDQLQIVSSEILSLKSE 732
              KL   +K + E    LE + +  DK    Y S    +   L+ ++  + +    +KSE
Sbjct: 189  MNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSE 248

Query: 733  IATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQ 912
               LK  N  +S++L  K  ++++L +  N+ K+E  KE++LKQ + ++L  ++   +  
Sbjct: 249  NDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQDD 308

Query: 913  IERL--TSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGN 1086
              R+  T + +   +++   E+ +LK+KL+ +E + N+    +++  NI  +   S   N
Sbjct: 309  YTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNK---ELEERRNITMQTESSTLSN 365

Query: 1087 PKKL-IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITS 1263
             ++  ++ ++++L++E+  K+ LQ QVE F+VELE+K+P I+SFK+R   LE+EL   T 
Sbjct: 366  QQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATL 425

Query: 1264 SLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI----DNKSP 1431
             LE   +E++    EL  L++   + +     L +QR+DLAHQ+QY+L+      D+  P
Sbjct: 426  LLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGP 485

Query: 1432 FTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXX 1611
             + +E   ++ I+ NE+ E  +DS ++IS+RL+ FQN+ ELQQKN+              
Sbjct: 486  LSAEEVRFIQDILDNESNEESSDSQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLE 545

Query: 1612 XXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXX 1791
              E+ QQ T ++ +  + ++ AK   + L+ +   LE KI  ++ E D YK L       
Sbjct: 546  LQEEHQQSTSQVVE-QQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSL--PKPDT 602

Query: 1792 XXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKH 1971
                          +L KE L   L++ +++  K    L N+I  ++++   +  E +  
Sbjct: 603  KVETEHLRLNEENTDLIKE-LETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNE 661

Query: 1972 ALNFDEMKDNNNLLKE--YVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIEL 2145
              + +  +    L++    + K+EN+      ++ ++   +++  T        S  + L
Sbjct: 662  RASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVAL 721

Query: 2146 SVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERE------- 2304
            S ++ +++++  +++  K+  K+L+D I  ++  +N L   V QL++  +ERE       
Sbjct: 722  SNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNSTK 781

Query: 2305 LPKNTQIKNEEKE----PAKQQTYTFERKKLESVNDSDISY-------------LYYENL 2433
            L   T++   E+E      K +    E K+LES   S+I +              Y + L
Sbjct: 782  LDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDEL 841

Query: 2434 EELQNQFRTLRRELKEVQEDL---DMKTESHLKLEN------KYTKVKNDLKQATYKLAS 2586
             E  N+   L  E+K++Q+DL   + +  ++  L N      K   ++N+L+++   L+ 
Sbjct: 842  LEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLSE 901

Query: 2587 VYTTLEQ-------KNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKI-- 2739
             Y  L+Q       K  FL N  + ++                 ++L   ++  SE+I  
Sbjct: 902  AYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQITD 961

Query: 2740 -NNAI---------------VLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLV 2871
             NN +                 L  ++ +N   ++    ++  LS L+  +      + +
Sbjct: 962  LNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANI 1021

Query: 2872 IESNYNTEID-HA------NERLEEAEV---KMASFDGKVT--------------EILES 2979
             ++NY  E+  HA      ++  E+A     KM S     T              E  +S
Sbjct: 1022 AQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKS 1081

Query: 2980 YDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNK-NPREKFPSFVKIDQQ 3156
            Y+ +I    A+   +  L  + K+                 ++   P E     ++ D+ 
Sbjct: 1082 YEDQI---HALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVLSLRSDRD 1138

Query: 3157 SXXXXXXXXVMENTTKLLALEESNAKL---------IKEVENCTKV----NETLSSQLAD 3297
                       E     L L   N +L         I++    TK+    ++ + +QL  
Sbjct: 1139 ILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQ 1198

Query: 3298 MQVKLE---PLEQEINELKLKVAEKEQHLNICQE-------------------------- 3390
            + +  E    L  E N+ + K  + ++ L   +E                          
Sbjct: 1199 LNLLRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAY 1258

Query: 3391 --ELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQ 3564
              E  RWK RSQ IL + K ++   H K   +I TL++ L   + EN +L DRF+R+KKQ
Sbjct: 1259 KEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQ 1318

Query: 3565 AHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE---IEKNNQSGNGAADESEEIIRL 3735
            AHE+L+++K  Q  L  QI +L +   +++  L+ E   I+   +       +SE++  L
Sbjct: 1319 AHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTAL 1378

Query: 3736 RAELEKSNNFSNELEKKVEDAKKFKNE--------IESLKSELQSVKAYENSTVN----- 3876
            R++LE++   S E E K   + K  +E        I+SL +EL  +K  +N+        
Sbjct: 1379 RSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQP 1438

Query: 3877 --SKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXX 4050
              S +++++K+SF+ EK + ++                I AQ  +    N     +I   
Sbjct: 1439 DLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQ 1498

Query: 4051 XXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKL----RE 4218
                      ++LKRI +AEENLK+R+RLP+EEKIN+VI+K++  LE+E++ K+    +E
Sbjct: 1499 REQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKE 1558

Query: 4219 LGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLE 4398
            L  + +    + D +  I+KEL    + EL   K KAFEEGKQQ+MMK+T LE+K+SKLE
Sbjct: 1559 LLSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLE 1618

Query: 4399 SQTL-SPTKNNDSNETQV 4449
            SQ   S   N + N+ +V
Sbjct: 1619 SQLQGSNAANENKNDVEV 1636

 Score =  119 bits (297), Expect = 6e-26
 Identities = 245/1323 (18%), Positives = 539/1323 (40%), Gaps = 89/1323 (6%)
 Frame = +1

Query: 682  QDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLK 861
            +++L ++ S    L   +  L  +  S+ ++L+ K+ +  +L        Q    E++L+
Sbjct: 10   KEELTLIGS---FLSVPVEQLNAIETSILSNLKTKVEQFTELQS------QSLKNEVSLE 60

Query: 862  QRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDK 1041
            + + +     I   + Q+E L  +N    E+K       ++++L + +KE  +L ST D 
Sbjct: 61   E-LQKTSQGRINDLRTQLEDLIEQNASASEEK-----KKIEKELSDEKKESFQLSSTRDN 114

Query: 1042 YINIDEKKLISKFGNPKK----LIEILRRQLVKEKRHKDT---LQRQVESFLVELEQKLP 1200
             +  + K++  KF N +K     I++L R++ + +  K+    L  Q      +      
Sbjct: 115  -LRAELKEIQEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLED 173

Query: 1201 MIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKIS---NNEQFNDELLRQ 1371
             I S K  +S  E  + +++  L+  ++ ++  + EL N  KK+S   +N Q   + LR+
Sbjct: 174  EIQSLKYNDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRK 233

Query: 1372 RSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISK--RLLHFQNV 1545
            +          +  ++N     + E   +KK    EN    ++ H+  SK   L +  N 
Sbjct: 234  K----------ISTLENNCSIIKSENDALKK----ENRIVSSNLHEKSSKVQELTNLYNT 279

Query: 1546 KELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEK-HIKTLE 1722
            ++ + +                  + +   T  +     IV++ +  ++++E+   K +E
Sbjct: 280  EKEESQKELSLKQEMIDVLQTQVQKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIE 339

Query: 1723 SKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLE 1902
            ++  +  +  +   + +                    EL +ER   E   ++ Q    + 
Sbjct: 340  TETQLNKELEERRNITMQTESSTLSNQQQEDLDTIKKELIQERYQKE--KLQNQVEIFIV 397

Query: 1903 ELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENEL 2082
            ELE K+ T+   +  + M +EK   +   + +N   L+   +++ N++  L Q+  ++  
Sbjct: 398  ELEKKVPTINSFKQRTDM-LEKELTDATLLLEN---LRREKNQVTNELDALRQNF-KSVK 452

Query: 2083 FEKNLITGGVNNLE---QSKIIELSV--------AEQKISFLDKEISNLKSKNKNLEDKI 2229
            +E   +T   N+L    Q  +I  SV        + +++ F+   + N  ++  +   ++
Sbjct: 453  WETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQV 512

Query: 2230 LTMTLS--KNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDS 2403
            ++  L   +N+++ +   ++   S REL +  +++ E ++   Q     E++ ++   ++
Sbjct: 513  ISERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQ---VVEQQAIDEAKEA 569

Query: 2404 DISYLYYENLEELQNQFRTLRRELKEVQE----DLDMKTESHLKLENKYTKVKNDLK--- 2562
             IS   Y    +L+++ +TL  EL   +     D  ++TE HL+L  + T +  +L+   
Sbjct: 570  IISLQSYNT--KLEDKIKTLNDELDCYKSLPKPDTKVETE-HLRLNEENTDLIKELETRL 626

Query: 2563 -----QATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENEN 2727
                 ++    AS+   ++      + +V + Q                   L +++ EN
Sbjct: 627  ATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVEN 686

Query: 2728 SEKINNAIVLLQTMVEENTTFKDAFKHF---KNSLSRLRQAINSIQQQSLVIESNYN--- 2889
             +      +L    ++++   ++  K +   K +LS  +  +N IQ Q  + ++N     
Sbjct: 687  EQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLK 746

Query: 2890 ---TEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSL--IHEKKMX 3054
               T +      L+E   ++ S   +  +I  S   K+ +   +  + R L  I EK   
Sbjct: 747  DDITIVSKERNELKELVSQLQSLQTEREQIFNST--KLDSQTRLDTVERELYDISEKLKN 804

Query: 3055 XXXXXXXXXXXRRAR---YRNKNP--REKFPSFV-KIDQQSXXXXXXXXVMENTTKLLAL 3216
                       R +    Y+NK    +EK  ++  ++ +++         ++   K L  
Sbjct: 805  KDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQA 864

Query: 3217 EESNAKLIKEVENCTKVN---ETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQ 3387
             ES     K + N   V    ETL ++L   ++ L     E+++ K   +EKE+ L   Q
Sbjct: 865  SESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQ 924

Query: 3388 EELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTL----EEQLETVRTENAQLTDRFDRL 3555
              +                  EE   + + KI+TL    +E L+T    + Q+TD  + L
Sbjct: 925  NTV------------------EETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNEL 966

Query: 3556 KKQ--AH--EKLDAAKTMQINLTTQINELNETKVNLE---KSLQQEIEKNNQSGNGAADE 3714
              Q  AH  EK + +K +   L  Q + + E     E    +LQ ++E+     N A + 
Sbjct: 967  DHQNKAHLEEKSEISKKLN-ELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNN 1025

Query: 3715 SEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKD 3894
             E+ ++  AEL K+      + +  EDA  ++ +++S+++         N+T N ++++ 
Sbjct: 1026 YEQELQKHAELAKT------ISQLREDAHTYRKKMDSMQA---------NATTNEELLRK 1070

Query: 3895 LKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXX 4074
             ++ ++ ++    +Q+               L   + ++L+  + S N            
Sbjct: 1071 NEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLV 1130

Query: 4075 XAL-----ILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLE--QEFE---------- 4203
             +L     IL+      E   K +RL        +   R K+ E  Q++E          
Sbjct: 1131 LSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHD 1190

Query: 4204 ---TKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLL 4374
                +L +L L  + N +     A   +E  ++   +L  +++K      +Q+ +K  + 
Sbjct: 1191 NIMNQLNQLNLLRESN-ITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIK 1249

Query: 4375 ERK 4383
            E +
Sbjct: 1250 ENE 1252

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 151/764 (19%), Positives = 313/764 (40%), Gaps = 24/764 (3%)
 Frame = +1

Query: 112  KIYTKAYDLMKENSFVSAAIDDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVARE 291
            +I  K  +L+ +N      I+++ + YE K++T+                  S   +A+ 
Sbjct: 979  EISKKLNELLAQNH----NIEEVSNQYELKLSTLQNDL----------EQQASYANIAQN 1024

Query: 292  KLVSEKQKEFD---SNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQD 462
                E QK  +   +   L  +    +  +++MQ + TT E   RK E + E+ +   +D
Sbjct: 1025 NYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYED 1084

Query: 463  SLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKN 642
             +    ALK++I           ++L   +++NK L   + LL ++      +   T   
Sbjct: 1085 QI---HALKKRI-----------EDL---SSQNKLLFDQVDLLSKSENSYNQQSSATPNE 1127

Query: 643  KKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLN 822
              + S   D   LQ +L +   E  +L+ +++++   N  L T+ + KL  I+   +N  
Sbjct: 1128 DLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSV---NTEL-TNTRAKLTEIRQQYENTK 1183

Query: 823  SSKQEF------AKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQ---ELV 975
             S +E         ++ L +  N  L NE    +++ ++L  ++LET  +K++    E  
Sbjct: 1184 ISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQL-QEDLETLREKVLPLEAEQN 1242

Query: 976  DLKEKLVNSEKECNELKSTVDKYIN-----IDEKKLISKFGNPKKLIEI--LRRQLVKEK 1134
             LKE +  +E++ N  K   +++       + + K I    + K   EI  L++ L  +K
Sbjct: 1243 RLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKK 1302

Query: 1135 RHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELT 1314
            +  + L  +      +  ++L   +S K    +L  ++ ++    +E A  + + + E  
Sbjct: 1303 KENEELNDRFNRIKKQAHERL---NSSKATQQTLIDQIKQLE---DENAHIQSLLETERG 1356

Query: 1315 NLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTEND 1494
            N+Q    N E+   ++ +Q  D+      L   + +   F  K    VK   S+E + + 
Sbjct: 1357 NIQ----NTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKS--SDEISSHL 1410

Query: 1495 TDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNN---KI 1665
             D    ++  L H +  K  +                    E+E+ K ++        K+
Sbjct: 1411 NDVIDSLNNELTHLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKL 1470

Query: 1666 VESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEK 1845
             E  K              + +  IS +R+ ++                       E+  
Sbjct: 1471 AEEVKRIEAQATDTQNKNVTPLQDISAQREQWEKEYE-------------------EIVL 1511

Query: 1846 ERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYV 2025
            +R+     ++K++     EE  N +   +K++L  + + + +    + +    N  K ++
Sbjct: 1512 KRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEEN--KTFI 1569

Query: 2026 DKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEI--SNLK 2199
            + L+N IK   +   + EL  KN         +Q  +++ +  E+KIS L+ ++  SN  
Sbjct: 1570 EDLKNDIKKELERNIDQEL--KNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAA 1627

Query: 2200 SKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKN 2331
            ++NKN  + +L     +N + +K    E +LS+ +L K  QI N
Sbjct: 1628 NENKNDVEVLLKTPSDENNVPSK---QEETLSKPQLSK-IQIAN 1667

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  432 bits (1112), Expect = e-125
 Identities = 420/1681 (24%), Positives = 732/1681 (43%), Gaps = 215/1681 (12%)
 Frame = +1

Query: 52   SSFFDLPGNTWESMDEHALEKIYTKAYD---LMKENSFVSAAIDDIKHVYEGKINTISQK 222
            +SF  +  N   ++D   +  I  KA +   L  EN   S  +D+++   E K+     +
Sbjct: 20   ASFLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQ 79

Query: 223  YFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTL 402
                           + +   + +L SEKQ+  + ++ L      ++   +A++     +
Sbjct: 80   VHLLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDV 139

Query: 403  EARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGM 582
                 +  + L   K E  D + EN  L++Q    E +      E      E  +L   +
Sbjct: 140  ARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQEL 199

Query: 583  KLLRENNLYLEIKC--KETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMN 756
             L R N+ +LE +   K  + N   +++    + L  +L+ +  E+ +      +L+  N
Sbjct: 200  SLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLREHN 259

Query: 757  ESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSK- 933
              ++ DL+ +L  +K L DNLNS KQEF +E++LK+R+ +LL  ++ S K  +E  ++  
Sbjct: 260  ARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAG 319

Query: 934  -----NLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGN--PK 1092
                 +   P   + +EL    ++L  SE +  +L+ TV   ++ D++  +    +  P 
Sbjct: 320  EGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAHEYPA 379

Query: 1093 KL------IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLR 1254
             +      I +L+RQ++ EKR K+ LQ QVE+F+VELE K+PM+ SFK+RN  LE +L  
Sbjct: 380  SVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAE 439

Query: 1255 ITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI----DN 1422
                LE  +K+++    +L   + +I + E    EL RQRSDLA QVQYLL+      D+
Sbjct: 440  TAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVRSDS 499

Query: 1423 KSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXX 1602
            K P T +E   V++I+   +   + D+ K+IS+RL+ F+++ ELQ KN            
Sbjct: 500  KGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNLAD 559

Query: 1603 XXXXXEQEQQKTLRITDNNKIVESAKSTSV-------DLEKHIKTLESK---INIISQER 1752
                 E+EQ K    T  N  +  AK   +       +LE  I+ L  +      I    
Sbjct: 560  KLES-EEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKAIQPST 618

Query: 1753 DSYKLLVXXXXXXXXXXXXXXXXXXXCELEKER---------LTNELSSMKQQHVKVLEE 1905
            ++   +                      L  ER         L +E+  + +Q  K+  E
Sbjct: 619  NNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIE 678

Query: 1906 LEN----------KIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLE------ 2037
            +E           ++K  Q S   +K E E+    +  ++DN  LLK+     E      
Sbjct: 679  IEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDN--LLKQDTKTQETLSCLI 736

Query: 2038 ---NKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKN 2208
               +K+ TLE +L  +    ++L +    N E   I +L+     ++ L  ++  L+ + 
Sbjct: 737  ECQSKLATLESELKSSVAKIESLSSCQKKNTES--IEQLTAERNNLTILVTQLQTLQGER 794

Query: 2209 KNLEDKILTMTLSK-----NLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFE 2373
                DK+L  T        + L+ +  QL T LS ++   N  I+  +   ++ Q Y   
Sbjct: 795  ----DKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTND---SRSQWY--- 844

Query: 2374 RKKLESVNDS---DISYL--YYENLEELQNQFRTLRRELKEVQ----------------- 2487
            ++K++S+N++     S L    +   +L++Q + L   LKEV+                 
Sbjct: 845  QEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLA 904

Query: 2488 --EDLDMKTE-SHLKLENKYTKV---KNDLKQATYKLASVYTTLEQ-KNSF------LAN 2628
              E L M+ E S +KL++ Y+++   ++  K A   L+++    E+ KN        +  
Sbjct: 905  QTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKK 964

Query: 2629 SVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKH 2808
               +L G                   +   +    ++ N +V LQ+  E   + K+   H
Sbjct: 965  KEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKE---H 1021

Query: 2809 FKNSLSRLRQAINSIQQQSLVIESNYNTEID-HAN-----------------------ER 2916
            ++  L +L Q +N     +   + NY  E+  HA+                         
Sbjct: 1022 YEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSS 1081

Query: 2917 LEEAEVKMASFDGKVTEILESYDGKILN--------TAAIGHL----------------- 3021
            +E+ E  +   DGK     E Y+ ++ +        T   G L                 
Sbjct: 1082 IEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQ 1141

Query: 3022 ------VRSLIHEKKMXXXXXXXXXXXXRRAR---YRNKNPREKFPSFVKID-------- 3150
                  VR LI   +             +R+     R     E+  SF K +        
Sbjct: 1142 SEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQALS 1201

Query: 3151 -QQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQ 3327
             Q S        ++E   +L  L ESN  L  EV+  T+  + L  Q+ ++Q  L+PLE 
Sbjct: 1202 SQNSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLES 1261

Query: 3328 EINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLE 3507
            E+  LK  V  K+  +++  EE  RWK RSQ IL + + ++ E H K  E++   + +L 
Sbjct: 1262 ELASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELA 1321

Query: 3508 TVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKN- 3684
                +N++L DRF RLKKQA E+LDAAK +Q NL+ ++ +  E + N+E  L++E + N 
Sbjct: 1322 AKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNK 1381

Query: 3685 --NQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIE-SLKSELQSVKA 3855
               +S      E++     + ELE +    ++ EKK +D +  + +IE +L+SEL+ VK+
Sbjct: 1382 ALQESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKS 1441

Query: 3856 Y----------------------ENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXX 3969
            +                      + +  +S  ++ +K   +   + LI +          
Sbjct: 1442 HAEELERRLDEARREVESLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYE 1501

Query: 3970 XXXXTILAQRKNNILANGQES-ANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSE 4146
                   A  +  +  NG+ +  +I               +KRI E+ E L+KR+RLP+E
Sbjct: 1502 ELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTE 1561

Query: 4147 EKINAVIEKRRKVLEQEFETKLR--------ELGLNADGNGVVTDTRAQIEK---ELREK 4293
            EKIN ++E R+  LEQEFE KL+        E    A    V+   + ++EK   +L  +
Sbjct: 1562 EKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTRE 1621

Query: 4294 FNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQT---------LSPTKNNDSNETQ 4446
             + E+A+++KKAF+EGKQQ+ MKS  LE+K++KLE+Q           +PT  N   E  
Sbjct: 1622 MDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSPTEKP 1681

Query: 4447 V 4449
            V
Sbjct: 1682 V 1682

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  429 bits (1103), Expect = e-124
 Identities = 429/1741 (24%), Positives = 766/1741 (43%), Gaps = 196/1741 (11%)
 Frame = +1

Query: 4    STDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLM-------------- 141
            +++S N    +I+ +ISS  D+P           LEK++T  YDL+              
Sbjct: 21   NSNSENRHDSTILLQISSILDVP-----------LEKLHTTDYDLILAVKDKLDELRNSK 69

Query: 142  KENSFVSAAIDDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEF 321
             +++ VS  I++++ + + K+ ++  K               +GY     +L  +     
Sbjct: 70   DQSNVVSNDINELQTLADNKLTSLGGKLATVETEKKELIDKVNGYETQFNELKIK----- 124

Query: 322  DSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIG 501
              N+ LN +++ +  +LE  + +    E    K   V     L +++S  E   LK+++ 
Sbjct: 125  --NEGLNLKVSNLNIELENWKNNSNNFETE--KLNYVXXXXXLSIRES--EIQRLKQEV- 177

Query: 502  VFEGKLDSMTQELWLANTE--NKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDAS 675
             F  +  S   E WL   E  NK      KLL E NL           N  +        
Sbjct: 178  TFLNENKSSLSEQWLKEKEEFNKA-----KLLLEKNL----------NNSTI-------- 214

Query: 676  RLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEIT 855
                +L+  ++ + S++++++ L   N  L+   +  ++ IK+L DNL  +K +  KEI 
Sbjct: 215  ----KLEEATTTLKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIA 270

Query: 856  LKQRVNELLHNEIASYKKQIER---LTSK-----NLETPEKKIIQELVDLKEKLVNSEKE 1011
            +K ++ +LL  +++S ++++ +   L SK     +LE+  + +  ++ DL  K+   + E
Sbjct: 271  MKSKLIDLLQGQLSSTQEELRQNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNE 330

Query: 1012 CNELKSTVDKYINI-----DEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFL 1176
               L S +++  N      +   + S        I +L++Q+ +EK  K  LQ Q+ESF+
Sbjct: 331  NFNLNSMINQMSNEQNNSNNSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFI 390

Query: 1177 VELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFND 1356
            +ELE K+P+I SF+E+N +LE EL  +T  L +T+ E++    +L N   K+   +    
Sbjct: 391  IELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIK 450

Query: 1357 ELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTD--SHKIIS 1518
            EL+RQR DLA+QV++LLL +    D+  P T +E   + KI +N    N ++  S  +IS
Sbjct: 451  ELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVIS 510

Query: 1519 KRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDL 1698
            +RL+ F N++ELQ KNM                E            NK +  AK   + L
Sbjct: 511  ERLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSHK---EFQNKTIADAKEAILTL 567

Query: 1699 EKHIKTLESKINIISQERDSYKLL----VXXXXXXXXXXXXXXXXXXXCELEKERLTNEL 1866
            + H   LESK+ ++  ERDS+KLL    V                    E   E+L   +
Sbjct: 568  QYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLI 627

Query: 1867 SSMKQQHVKVLEELENKIK--TLQKSQLTSKMEVEKHALN------------FDEMKDNN 2004
              +K +  K  + LE++I   T  KS LT  +E EK +              FD +K  N
Sbjct: 628  EELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTEN 687

Query: 2005 NLLKEYVDKLENKIKTLEQDLAENELFEKNLITGG--VNNLEQSKIIELSVAEQKISFLD 2178
              L +  + L+N I  ++Q+    ++  K  ITG   ++NL+     +LS+A+ +  FL 
Sbjct: 688  KELNKRFENLQNII--IKQESKLGDIINK-YITGETEISNLKT----QLSIAKSEKDFLV 740

Query: 2179 KEISNLKS---KNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPA 2349
            K   +L S   K    ++K+  M      L N+ + L     ++ + K  +++N   +  
Sbjct: 741  KSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLI 800

Query: 2350 KQQ-TYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRREL----------------- 2475
            K   +   E +KL   N+S  ++ Y   +++L+     ++ EL                 
Sbjct: 801  KNLGSKMTEIQKLSISNESQCTW-YQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELL 859

Query: 2476 --------------------KEVQEDLDM--------------------KTESHLK-LEN 2532
                                 ++ +DLD+                     TE  LK LE+
Sbjct: 860  ESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLES 919

Query: 2533 KYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQL-------QGXXXXXXXXXXXXXX 2691
             +  VKN +     KL S   TL+         +S+L       +               
Sbjct: 920  NFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQIT 979

Query: 2692 XTEKLQMAENENSEKINNAIVLLQTMVEENTTFKD-AFKHFKN----------SLSRLRQ 2838
               K +    + + +    I  LQ+ +E    F D A + +++          S+   ++
Sbjct: 980  RLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKE 1039

Query: 2839 AINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDG---------- 2988
             I  + Q+ ++IES+   +    +E     + K  +F   + E  +  D           
Sbjct: 1040 QIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVD 1099

Query: 2989 --KILN-----------TAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKF 3129
              ++LN           ++   H+   L  ++ +            +    + ++ R++ 
Sbjct: 1100 QLELLNKDFSSMDSSQLSSETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDEL 1159

Query: 3130 PSF-VKIDQQSXXXXXXXXVMENTTKLLA-------LEESNAKLIKEVENCTKVNETLSS 3285
             +  +K+            ++EN  K+++        +ESN  L  +V    + N+TL +
Sbjct: 1160 ANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQT 1219

Query: 3286 QLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHM 3465
            +L +   KL  L  E+  +K  + +KE  + + +EE  +W+LR++ +  Q   V+ ++  
Sbjct: 1220 KLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVS 1279

Query: 3466 KSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKV 3645
            K   ++  L++  ET R +NA+L +RF+ LKKQAHE+L+A+K +Q +L  QINEL  +  
Sbjct: 1280 KLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNT 1339

Query: 3646 NLEKSLQQEIEKNNQSGNGAADE----SEEIIRLRAELEKSNNFSNELEKKVEDAK-KFK 3810
            N+E +L  E +K+    N  +D     ++++  + +EL+     +N  +   E  K +  
Sbjct: 1340 NIELALSSEQKKSMDLQNTLSDNEVKYTQKLSNIESELKALKTENNSFKLSSEKEKMELT 1399

Query: 3811 NEIESLK-------SELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXX 3969
            +E++SLK       S+L ++ +    +  + +I+ +K+ F+ EK +L+E           
Sbjct: 1400 DEVDSLKKSLVEAQSKLSAIGSDSTDSTMNAMIESMKKEFEEEKLKLLEDKTNELEAQWK 1459

Query: 3970 XXXXTILAQRKNNI----LANGQESANI---XXXXXXXXXXXXALILKRITEAEENLKKR 4128
                 +L + +  I     A   +S  I                  L+RI EA+E LKKR
Sbjct: 1460 LEKDKLLKEYEEKIEDLQSARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKR 1519

Query: 4129 MRLPSEEKINAVIEKRRKVLEQEFETKLREL--GLNADGNGVVTDTRAQIEKELRE---- 4290
            +RLPSE KIN VIEKR+  LE E+E KL+E    + A+ N + T    ++ +E++E    
Sbjct: 1520 IRLPSETKINRVIEKRKHELENEYEVKLQEKLNEIEANRNSIETIDPGKLREEIKEEVKR 1579

Query: 4291 ----KFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNN-DSNETQVXX 4455
                KF  +L E KKK+FEEGKQQS MK+TLLERK+SKLESQ     +N+  S++  +  
Sbjct: 1580 DMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQLSEAIENDKQSDKNPIIS 1639

Query: 4456 XXXXXXXXXXXXXXGEKVLQLNYGANVVAETDNDDNPFTLQSGKDETLLTKRSADNEIIQ 4635
                            K    ++G      + N +  F+  S       ++ S D EI+Q
Sbjct: 1640 DLAQTSTLASIQPPSAKKPAFSFGGFNTTNSLNANKGFSSSSNN----TSQSSKDTEIVQ 1695

Query: 4636 D 4638
            +
Sbjct: 1696 N 1696

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  427 bits (1099), Expect = e-123
 Identities = 431/1670 (25%), Positives = 733/1670 (43%), Gaps = 160/1670 (9%)
 Frame = +1

Query: 43   DKISSFFDLPGNTWESMDE---HALEKIYTKAYDLMKENSFVSAAIDDIKHVYEGKINTI 213
            DKIS +  +P  + + ++     AL K   K     +E + ++  ID+IK  Y  +I+ +
Sbjct: 3    DKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISKL 62

Query: 214  SQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDH 393
            ++                S        L +E+ K     DALN ++   K  +  +    
Sbjct: 63   NELLGESSEEKNVSKKELSRL---HNLLKNERSKCARKIDALNKQLNASKNTITKLND-- 117

Query: 394  TTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWL--ANTENKK 567
                  ER  +   E  K E Q++  E SAL  +  +   KL  M   L    +NT + K
Sbjct: 118  ------ERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLK 171

Query: 568  LQTGM-----KLLRENNLYLEIKCKETDKNKKL--YSSAEDASRLQDQLQIVSSEILSLK 726
            L+        +L+ EN  ++E +    D+   +   +       L++QL    ++  S+ 
Sbjct: 172  LKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVS 231

Query: 727  SEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYK 906
            +    L   N+ LS  +++K+  IK+L D +N  K +F+KE+TL++ +N+LL +++ S++
Sbjct: 232  TNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFE 291

Query: 907  KQIE-RLTSKNLETPEKK-----IIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKL 1068
            K        K+ + P K      ++ +L+D K +L  S+ EC  L++ V   I  DE   
Sbjct: 292  KNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDE--- 348

Query: 1069 ISKFGNPKKL----------IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFK 1218
             + F N   +          I+ L+RQL+KE+  K  LQ Q+ESF+ ELE+K P + SFK
Sbjct: 349  -AAFDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFK 407

Query: 1219 ERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQ 1398
            ER  SLE+EL   T  LE  +  +   ++ELT+L++KI+N E     L++QR DLA QV+
Sbjct: 408  ERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVK 467

Query: 1399 YLLLCID----NKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKN 1566
             LLL I       SP +  E   +KK++ + +  N+ DS  II++RL+ F N  ELQ+KN
Sbjct: 468  LLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKN 527

Query: 1567 MXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQ 1746
            M                E +Q K+L   +N  I E AK   ++LE    TLES+I+I+S+
Sbjct: 528  MELLNCVRVLADKLENHEGKQDKSLAKLENQTIKE-AKDAIIELEHVNSTLESRIDILSR 586

Query: 1747 ERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKT 1926
            ERDSYKLL                     +  KE L +ELS  K ++  V++ L  ++ T
Sbjct: 587  ERDSYKLLASANGNKIYADAANKTEAANLKKIKE-LESELSLTKVENSAVVQRLNKELLT 645

Query: 1927 LQKSQLTSKMEVEKHALNFDEMK-DNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLIT 2103
             +KSQ   ++ +++ + NF  +  +  NLL+  +D L+ K++        +       I 
Sbjct: 646  CKKSQSNGQIALQEFS-NFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSS-------IH 697

Query: 2104 GGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLE--DKILTMTLS-----KNLLD 2262
            G + + E     ELS  + K   L  EISNL  KN +L    + LT  L      K  L 
Sbjct: 698  GSIGSEET----ELSQYKNKTKSLMCEISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQ 753

Query: 2263 NKVLQLETSLSERELP---------------------------------------KNTQI 2325
             K+ + ETS +E++L                                        KN+Q+
Sbjct: 754  MKLTESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELNNRLHSKVQEIETLQTSKNSQL 813

Query: 2326 K-------NEEKEPAKQQT-----------YTFERKKLE-SVNDSDISYLYYENLEELQN 2448
            K       + EK      T            + E K LE  +  + + Y    N  +   
Sbjct: 814  KWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQYKLLNNSSDANT 873

Query: 2449 QFRTLRRELK-------------EVQEDLDMKTESHLK-LENKYTKVKNDLKQATYKLAS 2586
                L++EL+             E  E++    E+ LK L ++ TK K +LK  +  L  
Sbjct: 874  LETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDE 933

Query: 2587 VYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQ------MAENENSEKINNA 2748
                 E++ SFL   + +++G               +EKL        A NE  +K+   
Sbjct: 934  ENNAKEEEISFLRRELDEIRGLQPKLKEGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTI 993

Query: 2749 IVLLQT----------------------MVEENTTFKDAFKHFKNSLSRLRQAINSIQQQ 2862
            + L Q                       +  E   ++   K  K+SL   ++ ++  +++
Sbjct: 994  VELHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERK 1053

Query: 2863 SLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHE 3042
             +  +++Y  E+    E+ E   V+ ++   K+ +     +G       +  L  SL HE
Sbjct: 1054 WMEEKADYERELISNIEQTESLRVENSALVEKIDDGTGENNGDKEYLKLVS-LFSSLRHE 1112

Query: 3043 KKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVK--------IDQQSXXXXXXXXVMENT 3198
            +                A+ +N N  +      +        +   +        +M+  
Sbjct: 1113 RNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEI 1172

Query: 3199 TKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLN 3378
             ++  L+E+N  L K ++  T+ NE +  +   +Q ++  L+ ++ + K +V+     + 
Sbjct: 1173 AQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVL 1232

Query: 3379 ICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLK 3558
            + + E+E+WK R   + QQ K   ++   K   +I  L+ +L   +  NA L D+F+RLK
Sbjct: 1233 VYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISDLKAKLLNAQNANADLNDKFNRLK 1292

Query: 3559 KQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLR 3738
            KQAHEKLDA+K  Q  LT +++EL + K  LE+SL  E  K              ++ L 
Sbjct: 1293 KQAHEKLDASKKQQTALTNEVDELKDMKNELEESLHSEESK--------------VLELE 1338

Query: 3739 AELEKSNNFSNELEKKVED--AKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFK 3912
            A+L+K    +  + K  E+  +K    EIE LK ELQ    ++ ++ +S  I+ +KE  +
Sbjct: 1339 AKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQ---VFKETSDSSDTIEKMKEIME 1395

Query: 3913 REKDELIEQMXXXXXXXXXXXXXTILAQRK------NNILANGQESANIXXXXXXXXXXX 4074
             EK+++IE+              T   +RK       N  A  +   N+           
Sbjct: 1396 AEKNKIIEE-------------KTTEFERKLEEATGKNTGATIENGENMEELKKQWLKQY 1442

Query: 4075 XALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVT 4254
                ++RI EAEENLKKR+RLPSEE+I  +I KR++ LEQEF+ KL+        +G  T
Sbjct: 1443 EEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKA------NSGSFT 1496

Query: 4255 DTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDS 4434
             +  + E E+  + +L  +  K  +     ++  + + L+ +K   L+ Q  +P K   S
Sbjct: 1497 LSSDKKENEVNAEDDLWNSPSKGNS-----EKPSVVTNLIRQKNLILQEQLKNPKKGIIS 1551

Query: 4435 NETQVXXXXXXXXXXXXXXXXGEKVLQLNYGANVVAETDND----DNPFT 4572
            N+++                  +  L  N+G  +     +      NPFT
Sbjct: 1552 NDSRPTSSNKENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFT 1601

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  419 bits (1078), Expect = e-120
 Identities = 424/1704 (24%), Positives = 744/1704 (43%), Gaps = 237/1704 (13%)
 Frame = +1

Query: 37   IIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMK---ENSFVSAAIDDIKHVYEGKIN 207
            I  +++ F  +     + ++   L +I  K  DL K   EN  ++A +D +K   E K+ 
Sbjct: 6    IASRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLE 65

Query: 208  TISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQR 387
            +                         R     EK++  + N  +   I  ++ ++E  ++
Sbjct: 66   SFKIHISQLAKALEDGKDE-------RLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQ 118

Query: 388  -----DHTTLEARERKTENV--LEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWL 546
                 D +  +  E   E +  L  +K +L ++   N  L++++   E +L +       
Sbjct: 119  QKELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELR 178

Query: 547  ANTENKKLQTGMKLLRENNLYL--EIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILS 720
            + +E  +++  + LLRENN +L  ++  K    N+   S+  +    Q ++  + SE+  
Sbjct: 179  SKSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEI 238

Query: 721  LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS 900
             ++    LK    SL   L++KL   K++ D  N SKQE  KE++LKQR+ + L   + S
Sbjct: 239  ARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMES 298

Query: 901  YKKQIERLTSKNL------ETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKY---INI 1053
             KK+++  T  N+      E    ++I+EL  +K +L  SE  C +LK T+D+    I +
Sbjct: 299  LKKEMDA-TKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKL 357

Query: 1054 DEKKLISKFGNPKKLIEI----------LRRQLVKEKRHKDTLQRQVESFLVELEQKLPM 1203
            ++ ++ +   + +K + +          L++QLV EKR KD L+ QVE+F+VELE K+P+
Sbjct: 358  EDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPV 417

Query: 1204 IDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDL 1383
            ++SFKER+  LEREL  +T  LE T K+RD K  +L  L+  + + E     L +QR DL
Sbjct: 418  LNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDL 477

Query: 1384 AHQVQYLLLCIDNKS----PFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKE 1551
            AHQ+QYLL+    KS    P + +E   VK + +++     +D+  II+ RL+ F++V E
Sbjct: 478  AHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVE 537

Query: 1552 LQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKI 1731
            LQQKN                 E E +  +++ ++  + E AK T + L  H + LE+++
Sbjct: 538  LQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVRE-AKETILTLHDHAQNLENQL 596

Query: 1732 NIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELE 1911
             I+S+ERD+YK L                     + + + L   L++       V++E E
Sbjct: 597  VILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTA-------VIQEAE 649

Query: 1912 NKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEK 2091
            N  K         + ++ + +LNF+  K +  L ++ ++ L++ ++  ++   E +    
Sbjct: 650  NNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSS 709

Query: 2092 NL----------ITGGVNNLEQSKII------ELSVAEQKISFLDKEISNLKSKNK---- 2211
            +L              V++L ++K        ELS+ + +  F+ K    LK++N+    
Sbjct: 710  DLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSK 769

Query: 2212 -NLEDKILTMTL-------------SKNLLDNKVLQLETSLS---ER--ELPKNTQIKNE 2334
             ++E K+L   L             ++N    K+ +LE  LS   ER  E+ KNT     
Sbjct: 770  ESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIAS 829

Query: 2335 EKE---------------PAKQQTYTFERKKLE------SVNDSDI----------SYLY 2421
             KE                A QQ  T E K+ +      ++N+             SY  
Sbjct: 830  NKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTM 889

Query: 2422 YENLEELQNQFRTLRRELKEVQEDLD---MKTESHLKLENKYTKVKNDLKQATYKLAS-- 2586
              N+++ QN   TLR+EL++V   L     + E H  L  +  +  N++ QA  +     
Sbjct: 890  LSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKES 949

Query: 2587 --VYTTLEQKNSFLANSVSQL--QGXXXXXXXXXXXXXXXTE---------KLQMAE--- 2718
                 TLE + + L ++V+ L  Q                TE         KLQM +   
Sbjct: 950  QKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESV 1009

Query: 2719 NENSEKINNAIVLLQTMVEENTTFKDAF---------KH---------FKNSLSRLRQAI 2844
            +         I ++Q  +E  T + +           KH          +      +  +
Sbjct: 1010 DRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDL 1069

Query: 2845 NSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKIL--------- 2997
             +++ QS +   N        NE+  E E K++  + +V E+  S   K+L         
Sbjct: 1070 ETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQEL--STQNKLLYDQIELLNK 1127

Query: 2998 -----NTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFP------SFVK 3144
                 N+     L+ SL  E+ M               + R    + +        S VK
Sbjct: 1128 TEDRDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVK 1187

Query: 3145 --IDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEP 3318
                + +        +M+   +L  L ESN  L  E  +  K  + L SQL +   +L P
Sbjct: 1188 NSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAP 1247

Query: 3319 LEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEE 3498
            L+  I+ L+  +  KEQ L   +EE ERWK RSQ IL + + ++ E H K  E+I  ++ 
Sbjct: 1248 LQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKN 1307

Query: 3499 QLETVR-------TENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEK 3657
            +L+T +        E      +F R++ QA ++L+A+K  + +L+++IN++NE K  +E 
Sbjct: 1308 ELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEA 1367

Query: 3658 SL-----------------QQEIEKNNQSGNGAADE-SEEIIRLRAELEKSNNFSNELEK 3783
             L                  QE E   Q+ N    +  E++  ++ ++E ++        
Sbjct: 1368 DLGKCKTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASKTEQNNAD 1427

Query: 3784 KVEDAKKFKNEIESLKSELQSVKA-----------YENSTVNS---KIIKDLKESFKREK 3921
              E  K     +E L S++Q ++A           +    +N     I+ +LK  F+ EK
Sbjct: 1428 SDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEK 1487

Query: 3922 DELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQE----------------------SA 4035
            ++LI+               +    R+  +    +E                        
Sbjct: 1488 EQLIKDKEKELRSKFEAEKESAWNSREEELRKQFEEREKRIREECEKTTVQSPSQPTLDI 1547

Query: 4036 NIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLR 4215
            +I               L++I  AEE LKKR+RLP+++KI+ ++E R+ VLE+ FE K+ 
Sbjct: 1548 DIDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVN 1607

Query: 4216 ELG---LNADGNGVVT--DTRAQ---IEKELREKFNLELAEIKKKAFEEGKQQSMMKSTL 4371
            E         GN  +T    RA+   ++  +R++F  +LAEIK+K+FEEGKQQ  +K   
Sbjct: 1608 EKAQKLAGEIGNDAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKF 1667

Query: 4372 LERKLSKLESQ--TLSPTKNNDSN 4437
            LE K+  LE Q  T+ P +N+ SN
Sbjct: 1668 LESKIRNLEQQKSTIKPVENDTSN 1691

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  407 bits (1046), Expect = e-117
 Identities = 398/1539 (25%), Positives = 701/1539 (45%), Gaps = 147/1539 (9%)
 Frame = +1

Query: 43   DKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVS---AAIDDIKHVYEGKINTI 213
            DKIS F ++P  + + +    L K+Y K     +    V+     +D+IK  Y  +I+ +
Sbjct: 3    DKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKL 62

Query: 214  SQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRD- 390
             Q                     + E+  + K++     D LN E +  + +++A+++  
Sbjct: 63   KQLLDE-----------------SSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQL 105

Query: 391  HTTLEARER-------KTENVLEQSKLELQDSLT-----ENSALKEQIGVFEG-----KL 519
            H + EA          K E  + QS+ +  DSL      EN  L+ ++   E      K 
Sbjct: 106  HVSHEAMREVNDEKRVKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKS 165

Query: 520  DSMTQEL-WLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQ 696
            ++++ +L +  + + K+L    K L E  L    K   T++  K    +     L+++L 
Sbjct: 166  NAISLQLKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTK----SSHVENLEEKLY 221

Query: 697  IVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNE 876
             + S   S+ +    L   N+ LS  ++ K+  +K+L D  +  K EF+KE+TL++ +N+
Sbjct: 222  QMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMND 281

Query: 877  LLHNEIASYKKQ-----IERLTSKNLETPEKK-IIQELVDLKEKLVNSEKECNELKSTVD 1038
            LL +++ S +K      IE+    +   PE   +I EL+D K +L  S+ EC  L++ V 
Sbjct: 282  LLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVM 341

Query: 1039 KYINIDEKKLISKFGNPK--KL---IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPM 1203
                 +E  + +   +P   KL   I++L+RQL+KE+  K  LQ Q+E F++ELE K P 
Sbjct: 342  DCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPE 401

Query: 1204 IDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDL 1383
            + SFKER  SLE EL R T  LE  +  +  ++RE+T+L++KI+  E     L++QR DL
Sbjct: 402  LISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDL 461

Query: 1384 AHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKE 1551
            A QV+ LLL      +  SP ++ E   ++KI+ + N  N+ DS  II++RL+ F NV E
Sbjct: 462  ARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNE 521

Query: 1552 LQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKI 1731
            LQ+KN+                E +Q KTL+  +N  I E AK   ++LE     +E++I
Sbjct: 522  LQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKE-AKDAIIELENINAKMETRI 580

Query: 1732 NIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELE 1911
            NI+ +ERDSYKLL                     E +   L  ELSS K ++  +++ L 
Sbjct: 581  NILLRERDSYKLLASTEENKANTNSVTSMEAAR-EKKIRELEAELSSTKVENSAIIQNLR 639

Query: 1912 NKIKTLQKSQLTSKMEVEKHALNFDEM-KDNNNLLKEYVDKLENKIKT----------LE 2058
             ++   +KSQ   K  +E    NF  + K+   +L+E +D L+ +++           +E
Sbjct: 640  KELLIYKKSQCKKKTTLEDFE-NFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVE 698

Query: 2059 QDLAENELFEKNL----ITGGVNNLEQS-----------------------------KII 2139
            ++ A  EL +  +    +   ++ L++                              K  
Sbjct: 699  KERASTELSQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKES 758

Query: 2140 ELSVAEQKISFLDKE-----------------ISNLKSKNKNLED----KILTMTLSKNL 2256
            E+S  E K+ F  KE                  S+L+SK + +E     K   +  ++N 
Sbjct: 759  EISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNT 818

Query: 2257 LDNKVLQLETSLSERELPKNT------QIKNEEKEPAKQQTYTFERKKLESVND-SDISY 2415
            +D+  +++++ L+E    + T      +I+N +KE  K +   F+ K L+  +D S +  
Sbjct: 819  IDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTK---FQYKFLDQNSDASTLEP 875

Query: 2416 LYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKN-------------- 2553
               + LE++Q Q +    +++  +E +     + ++L+N+  K K               
Sbjct: 876  TLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKEKW 935

Query: 2554 --------------DLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXX 2691
                          +++    KL        Q++  L N V ++Q               
Sbjct: 936  AREEDLSRLRGELGEIRALQPKLKEGALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQL 995

Query: 2692 XTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDA-FKHFKNSLSRLRQAINSIQQQSL 2868
              +K +M++ +++ K N  +  L   +E++     A     K+SL   +  ++  +++ +
Sbjct: 996  CKKK-EMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWM 1054

Query: 2869 VIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKK 3048
              +++Y  E+    E+ E   V+ +    KV +   +   K  +   +  L  +L HE+ 
Sbjct: 1055 EEKADYERELISNIEQTESLRVENSVLIEKVDDTAANNGDK--DHLKLVSLFSNLRHERN 1112

Query: 3049 MXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVM--------ENTTK 3204
                            + +N +  +      +    S        V+        +  T+
Sbjct: 1113 SLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQ 1172

Query: 3205 LLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNIC 3384
            +  L+E+NA L K ++N T+ N  +  QL D Q ++  L++++ + K +V+     + + 
Sbjct: 1173 VNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVY 1232

Query: 3385 QEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQ 3564
            + E+E+ K R Q + QQ K  +++   K   +I  L+ +L +    NA L ++F+RLKKQ
Sbjct: 1233 ESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQ 1292

Query: 3565 AHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAE 3744
            AHEKLDA+K  Q  LT ++NEL   K  LE+ L  E  K                +L+A 
Sbjct: 1293 AHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKVIDLDT----------KLKAH 1342

Query: 3745 LEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKD 3924
              +S + S + EK  +  +    EIESLK ELQ  K   +S   S   + LK + ++EKD
Sbjct: 1343 ELQSEDVSRDHEK--DTYRTLMEEIESLKKELQIFKTANSS---SDAFEKLKVNMEKEKD 1397

Query: 3925 ELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQE-SANIXXXXXXXXXXXXALILKRIT 4101
             +I++                L +  N   ++  E S +I               L+RI 
Sbjct: 1398 RIIDERTKEFEKK--------LQETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIK 1449

Query: 4102 EAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE 4218
            EAEENLKKR+RLPSEE+I  +I KR++ LE+EF  KL+E
Sbjct: 1450 EAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKE 1488

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  387 bits (994), Expect = e-110
 Identities = 402/1552 (25%), Positives = 674/1552 (43%), Gaps = 160/1552 (10%)
 Frame = +1

Query: 43   DKISSFFDLPGNTWESMDEHALEKIYTKAYDLM---KENSFVSAAIDDIKHVYEGKINTI 213
            DKIS F  +P  +   +   AL+++Y K  +     KE + ++  +D+IK  Y  +I+ +
Sbjct: 3    DKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKL 62

Query: 214  SQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDH 393
            + K                  L  +++L  E+ +     DALN ++      ++ ++ + 
Sbjct: 63   T-KLLNESSEEKVINSKVMNRL--QDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEE 119

Query: 394  TTLEA---------RERKTENVLEQSKLELQDSLTENSAL----KEQIGVFEGKLDSMTQ 534
               E           +  T++VL++    LQ  L E   +    K      + K D+ +Q
Sbjct: 120  GAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQ 179

Query: 535  E--LWLAN---TENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQI 699
            E  LWL N   TE +      K L +          E  K   L +  E  ++ Q + + 
Sbjct: 180  EKELWLQNKKWTEERLSSCNQKALVD----------EVTKTSYLQNLEEKLNQTQTENES 229

Query: 700  VSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNEL 879
            VS+    L  +       N+ LS  ++ KL  IK+L D  N+ K EF+KE+TL++++N+L
Sbjct: 230  VSTYNKFLLDQ-------NKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDL 282

Query: 880  LHNEIASYKK-----QIERLTSKNLETPEK-KIIQELVDLKEKLVNSEKECNELKSTVDK 1041
            L +++ S+++       E+   K  + PE   + +EL+D K KL  S++EC  LK+ V  
Sbjct: 283  LRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSD 342

Query: 1042 YIN-----IDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMI 1206
             I      ++        G     I+ L+RQLVKE+  K  +Q Q++ F++ELE K P +
Sbjct: 343  CIEENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPAL 402

Query: 1207 DSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLA 1386
             SFKER   LE EL   T  LE  +  +   +++LT+L++KI++ E     L+RQR DLA
Sbjct: 403  VSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLA 462

Query: 1387 HQVQYLLLCID----NKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKEL 1554
             QV+ LL  I       SP +  E   ++K++ +ENT N+ DS  II+++L+ F+N+ EL
Sbjct: 463  RQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDEL 522

Query: 1555 QQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKIN 1734
            Q+KNM                E E  KT+   +N  I E AK   +++E     L  ++N
Sbjct: 523  QEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKE-AKEAIIEMESINSKLALRVN 581

Query: 1735 IISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELEN 1914
            I+++ERDSYKLL                     E +   L ++LSS + +   +++ L  
Sbjct: 582  ILTRERDSYKLLASANDNKTHADTEGITEATY-EKKIRELQSKLSSTRVESSAIIQNLNG 640

Query: 1915 KIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKN 2094
            ++ T +KSQ   K+ ++       E ++   L+ E    L+ +I  L+  L +  L    
Sbjct: 641  QLLTYKKSQTDGKIALQ-------EFENFKVLVAEKEAMLQERINHLKTQLEKQRL---- 689

Query: 2095 LITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVL 2274
                 V + + S + +LS +E KI  L  EISNLK +N  L     ++T        + +
Sbjct: 690  SAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKM 749

Query: 2275 QLETSLSE--------------RELPKNTQIKNEEKE----PAKQQTYTFERKKLESVND 2400
            QL   LSE              +EL  +T+IK  EK       + ++   E K L+S  +
Sbjct: 750  QLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKN 809

Query: 2401 SDISYLY------YENLE----ELQNQFRTLRR---ELKEVQEDLDMKTESHLKLENK-- 2535
            S + +         +NL+    EL N+  T+ R   E++ +  +L M    +  L N   
Sbjct: 810  SQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQYKFLSNTSD 869

Query: 2536 ----YTKVKNDLKQATYKLASVYTTLEQKNSFLA---NSVSQLQGXXXXXXXXXXXXXXX 2694
                   ++ +LKQ   +L   ++ ++     ++   N + +L G               
Sbjct: 870  TNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKIQL 929

Query: 2695 TEKLQMAENENSEKIN---NAIVLLQTMVEENTTF-----------KDAFKHFKNSLSRL 2832
              K + A+ E    +    + I  LQ  + E  ++               +  KN + ++
Sbjct: 930  ENKEKGAKEEELSHLRKELDEIRCLQPKLREGASYLVLQSEKVGDQAQRIQEMKNKIDKM 989

Query: 2833 RQAINSIQQQSLVIESNYNTEIDHANERLEE--AEVKMASFDGKVTEILESYDGKILNTA 3006
               I + Q++     S Y +E+   N+ L E    ++  +FD + TE+ ++         
Sbjct: 990  AAIIEAYQKEE---SSQYQSEL-KTNKDLSEWVMRLEKEAFDYQ-TELKKTKKSLYSTQE 1044

Query: 3007 AIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRN-------------KNPREKFPSFVKI 3147
             +    +  + EK                 R  N              N  EK+   V +
Sbjct: 1045 LLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIDGATEGSNSNEKYLELVSL 1104

Query: 3148 DQQSXXXXXXXXVMENTTK--LLALEESNAKLIKEVENCTKVN----------------- 3270
                            T K  L  L + NA L K + +  + N                 
Sbjct: 1105 FSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNKVQCPAVIIDEY 1164

Query: 3271 ETLSSQLADMQV-----------------KLEPLEQEINELKLKVAEKEQHLNICQE--- 3390
            E +  ++A + +                 K E + +E+  ++ +++  + HL   +E   
Sbjct: 1165 EKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVS 1224

Query: 3391 -----------ELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLT 3537
                       E+E+ K R Q + QQ K+  +    K    I  LE +L  V+  NA L 
Sbjct: 1225 INANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLE 1284

Query: 3538 DRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADES 3717
            ++F+RLKKQAHEKLDA+K  Q  LT ++NEL ETK  LE++L               +E 
Sbjct: 1285 NKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLH--------------NEE 1330

Query: 3718 EEIIRLRAELEKSNNFSNELEKKVEDA--KKFKNEIESLKSELQSVKAYENSTVNSKIIK 3891
             +++ L  +L++      E+ K  +    K F  EIESLK ELQ    + N+   S   +
Sbjct: 1331 SKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQ---VFRNANDASDAFE 1387

Query: 3892 DLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQE---SANIXXXXXXX 4062
             +K + + EK+++I++                L    N   +N  E   S +I       
Sbjct: 1388 KIKNNMEEEKNKIIDEKTKDFEKK--------LQDAVNKSKSNESEVENSEHIEALKKEW 1439

Query: 4063 XXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE 4218
                    +KRI EAEENLKKR+RLPSEE+I  +I KR+  LEQEFE KL+E
Sbjct: 1440 LKEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKE 1491

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 82/377 (21%), Positives = 164/377 (43%), Gaps = 50/377 (13%)
 Frame = +1

Query: 580  MKLLRENNLYLEIKCKE-TDKNKKLYSSA----EDASRLQ-------DQLQIVSSEILSL 723
            + +LRENN  L    K  T+KN+ +Y       E+ SRLQ       +Q+ I ++++L+ 
Sbjct: 1174 VNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAY 1233

Query: 724  KSEIATLKYMNESLST------------------DLQRKLFRIK----DLDDNLNSSKQE 837
            +SEI   K   + LS                   DL+ KL  ++    DL++  N  K++
Sbjct: 1234 ESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQ 1293

Query: 838  FAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECN 1017
              +++   ++    L NE+   K+  ++L  +NL   E K+    VDL+ KL     +  
Sbjct: 1294 AHEKLDASKKQQTALTNELNELKETKDKL-EENLHNEESKV----VDLELKLKEHGLQVG 1348

Query: 1018 ELKSTVDKYINIDEKKLISKFGNPKKLIEILR------------RQLVKEKRHK--DTLQ 1155
            E+    D   +I  K  + +  + KK +++ R            +  ++E+++K  D   
Sbjct: 1349 EVSKDHD---SIAFKPFVEEIESLKKELQVFRNANDASDAFEKIKNNMEEEKNKIIDEKT 1405

Query: 1156 RQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKI- 1332
            +  E  L +   K    +S  E +  +E          EE   +R IK+ E  NL+K+I 
Sbjct: 1406 KDFEKKLQDAVNKSKSNESEVENSEHIEALKKEWLKEYEEETVKR-IKEAE-ENLKKRIR 1463

Query: 1333 -SNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHK 1509
              + E+    + +++ +L  + +  L   +    F+       +  + N  ++  ++   
Sbjct: 1464 LPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSGSNEEEAEDELWNSPSKGSSEKPS 1523

Query: 1510 IISKRLLHFQNVKELQQ 1560
            +++  L+  +N+K  +Q
Sbjct: 1524 VVTD-LIKQKNIKLQEQ 1539

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  387 bits (994), Expect = e-110
 Identities = 396/1575 (25%), Positives = 691/1575 (43%), Gaps = 218/1575 (13%)
 Frame = +1

Query: 358  IKYDLEAMQRDHTTLEARERKTENVLEQ-------SKLELQDSLTENSALKEQIGVFEGK 516
            ++  LE  +R     ++  R    +LE+       S+ EL+  L  N  L+      E  
Sbjct: 114  VQQQLEETERRVAAGDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFT 173

Query: 517  LDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAE----DASRLQ 684
            + S   +      E ++LQ  + L+R N  +   +  E  KN++L S  E    +    Q
Sbjct: 174  VQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNE--KNQQLNSYREKTNGEIQSTQ 231

Query: 685  DQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQ 864
             +L IV +E+    + +A L+  N  LS  LQ  L   K L D+L+S KQEFA+E+ LKQ
Sbjct: 232  VELNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQ 291

Query: 865  RVNELLHNEIASYKKQIERL--TSKN---LETPEKKIIQELVDLKEKLVNSEKECNELKS 1029
            R+ ELL+ ++A+ K+ +E+    +KN    ++  ++++ +L D K+KL  S+   + L+ 
Sbjct: 292  RLIELLNGQVATMKQDLEKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLED 351

Query: 1030 TVDKYINIDEKKLISK-------FGNPKKLIEI---------LRRQLVKEKRHKDTLQRQ 1161
            T+ + +  D  +   +        G+P     I         LR+QLV+E+RHK+ LQ Q
Sbjct: 352  TIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQ 411

Query: 1162 VESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNN 1341
            VESF+VELE K+P+++SFK+R   LE++L  +T  LE TA+ERD K  ++   + K+ + 
Sbjct: 412  VESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDY 471

Query: 1342 EQFNDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTD--- 1500
            E     L++QRSDLA QVQ LL+ I    D+  P T +E   VKK+ S  ++   +D   
Sbjct: 472  ETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQA 531

Query: 1501 --SHKIIS-KRLLHFQN--------------------------VKELQQKNMXXXXXXXX 1593
              S++++  K ++  Q                           VK L+Q  +        
Sbjct: 532  IISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAIL 591

Query: 1594 XXXXXXXXEQEQQKTLRITDNN--KIVESAKSTSV------------DLEKHIKTLESKI 1731
                     ++Q +T+    ++   +V   K+ S+            ++   I  LE+++
Sbjct: 592  SLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHLEARL 651

Query: 1732 NIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHV-KVLE-- 1902
              +++E + +  ++                    ELE+ER + EL+  K   + K LE  
Sbjct: 652  KAMAEESEQHAKMLNEEIKALYKSNSQLAI----ELERERSSRELADEKLSLIQKSLELV 707

Query: 1903 -----ELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENK---IKTLE 2058
                 +L+N+  +LQ   L      +     F   K     +   +  L+++   ++ +E
Sbjct: 708  KGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVE 767

Query: 2059 QDLA-ENELFEKNLITGGVNNLEQSKIIELSVA---------------EQKISFLDKEIS 2190
             DL  ENE   K+      NN  Q  I++L  A               E +I  LD E+S
Sbjct: 768  ADLKKENESLNKD------NNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELS 821

Query: 2191 NLKSK--NKNLEDKILTMTLS-------------KNLLDNKVLQLETSLSERELPKNTQI 2325
              K +   K  E   L+ + S             K  L +  L L+   SE +  K    
Sbjct: 822  ATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLN 881

Query: 2326 KNEEK-EPA----KQQTYTFER----------KKLESVNDS-DISYLYYENLEELQNQFR 2457
             +  K EPA    +Q +   E           K L+  N     +Y   E  +   N   
Sbjct: 882  SSTSKLEPASMDHQQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATE 941

Query: 2458 TLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLA----------SVYTT--- 2598
                    VQ++ D   ++ + LE + TK+ +D+  A  ++           + Y+T   
Sbjct: 942  RPSLSYNAVQDNKDGSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERS 1001

Query: 2599 -LEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVL------ 2757
             L++K + L     +++                 EK   + NE   K   A+        
Sbjct: 1002 ELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISE 1061

Query: 2758 -LQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEV 2934
             ++++ + + ++K     FK++    R+ +   +Q     +++    +D A++R+EE   
Sbjct: 1062 NIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELST 1121

Query: 2935 KMASFDGKVTEILESYDGKILNTAAIGHLVRSLI----HEKKMXXXXXXXXXXXXRRARY 3102
            +      ++  +  S    +     I    R LI     E+ +            +  R 
Sbjct: 1122 QNRLLYDQIELLSRSPSSSLEPDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQ 1181

Query: 3103 RNKNPREKFPSFVK--------IDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENC 3258
            R +  + +  +           + + +        + E   +L  L E N  L  E E  
Sbjct: 1182 RLELTKSELDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKV 1241

Query: 3259 TKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQG 3438
            ++ NE L +++  +Q K++P+E++I  L   + EKEQ L + +EE +RWK RSQ IL + 
Sbjct: 1242 SEHNEFLQNEILSLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKY 1301

Query: 3439 KIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQ 3618
            + ++ E + K   +I+ L+ +LE    E+    +RF +L+KQA+E+LD  K  +  + ++
Sbjct: 1302 ERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESE 1361

Query: 3619 INELNETKVNLEKSLQQEIEK----NNQSGNGAADE-----SEEIIRLRAELEKSNNFSN 3771
            +      K  LE  L +  EK      Q     A E     S E+   + +L+ + N  N
Sbjct: 1362 LELALSGKSQLEAKLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTIN 1421

Query: 3772 ELEKKVE-DAKKFKNEIESLKSELQSVKAYENSTVNS-------------KIIKDLKESF 3909
             L+ +     + FK +++ L  +L++++  +NS  +S              +++D K+  
Sbjct: 1422 MLKSEWSISEESFKKQLDELNKQLETIQ--KNSAPSSGHSDPSSYHEQPTAVLEDFKKQV 1479

Query: 3910 KREKDELIEQMXXXXXXXXXXXXXTILAQRKNNI---------LANGQESANIXXXXXXX 4062
            + E+  LIE                 LA+++  +         ++    S N+       
Sbjct: 1480 EEERRTLIESHQQELTARLEASRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKW 1539

Query: 4063 XXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGL----- 4227
                    L+RI EAEE LKKR+RLPSEE+IN VIE+++K LEQEF TK+    L     
Sbjct: 1540 EEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKE 1599

Query: 4228 -----NADGNGVVTDTR---AQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERK 4383
                  +D   ++ D +    Q++K+L +KF  +L ++KKKAFEEG+QQ +MK  LLE K
Sbjct: 1600 NPDSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESK 1659

Query: 4384 LSKLESQTLSPTKNN 4428
            +SKLESQ  +P   N
Sbjct: 1660 ISKLESQAKAPLGTN 1674

 Score = 38.1 bits (87), Expect = 0.26
 Identities = 44/234 (18%), Positives = 101/234 (43%), Gaps = 17/234 (7%)
 Frame = +1

Query: 3265 VNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELER-----WKLRSQTIL 3429
            V E +  QL + + ++   +    +L   + EK   L+  Q+ELER      +LR   + 
Sbjct: 110  VPERVQQQLEETERRVAAGDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEME 169

Query: 3430 QQGKIVEEEAH-MKSLEKIKTLEEQLETVRTE----NAQLTDRFDRLKKQAHEKLDAAKT 3594
             +  +  + +  ++   +I+ L+++L  VR+       QL ++  +L     +     ++
Sbjct: 170  LEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQS 229

Query: 3595 MQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNE 3774
             Q+ L    NEL     N+     +  E + Q  +   +       L +E ++   F+ E
Sbjct: 230  TQVELNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQE---FARE 286

Query: 3775 LEKKVEDAKKFKNEIESLKSELQSVKAYE-------NSTVNSKIIKDLKESFKR 3915
            +  K    +    ++ ++K +L+  KAY+       + +   +++ DL ++ K+
Sbjct: 287  MALKQRLIELLNGQVATMKQDLE--KAYDVAKNGGMSDSERERLLNDLFDTKKK 338

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  385 bits (989), Expect = e-109
 Identities = 439/1787 (24%), Positives = 783/1787 (43%), Gaps = 248/1787 (13%)
 Frame = +1

Query: 46   KISSFFDLPGNTWESMDEHALEKIYTKAYDLMK---ENSFVSAAIDDIKHVYEGKINTIS 216
            K+++F ++     + +DE  +   + KA +  K   +N  +S +ID +K  +E KINT  
Sbjct: 17   KVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFK 76

Query: 217  QKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHT 396
            ++               +     +++   EK K  +    L+ E+  ++  +E  ++   
Sbjct: 77   EQV-------EKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGME 129

Query: 397  TLEARERKTENVLEQ-------SKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANT 555
             + + ++    +LE+       SK E    L  N  L++     E  +     +     +
Sbjct: 130  IIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKS 189

Query: 556  ENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDA-SRLQ---DQLQIVSSEILSL 723
            E ++L   + L++ N  +L  + +   KN++L S  E   S LQ   +Q+  + S++   
Sbjct: 190  EIQRLHQELNLVKSNADWLSKELES--KNEQLNSFREKTNSELQNGYEQVNSLKSQLEFA 247

Query: 724  KSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASY 903
            ++  +TLK     LS  LQ KL   K L D LN+ K+EF +E++LKQR+ +LL ++++S 
Sbjct: 248  RANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSM 307

Query: 904  KKQIERL----TSKNLETPEK-KIIQELVDLKEKLVNSEKECNELKSTVDKYI------- 1047
            K  +E          + TPEK +++ EL+D K+ L  ++ E  +L++TV++ +       
Sbjct: 308  KSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNG 367

Query: 1048 ------NIDEKKLISKFGNPKKL---IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLP 1200
                  N+ +  L SK     KL   I IL++QLV+E+R K+ LQ QVESF+VELE K+P
Sbjct: 368  VAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIP 427

Query: 1201 MIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSD 1380
            +++SFKER   LEREL  +T  LE TAK+RD K  EL   + KI+N E     L+ QRSD
Sbjct: 428  ILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSD 487

Query: 1381 LAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVK 1548
            LAHQVQYLL+ +    D   P TE+E   VK+I+S+E+    +D+  IIS+RL+ F++V 
Sbjct: 488  LAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVI 547

Query: 1549 ELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESK 1728
            ELQ KN                 E++ +  L+  +  + V+ AK   + L++H++ LE +
Sbjct: 548  ELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVE-TQTVKEAKEAILSLQEHVQRLEDQ 606

Query: 1729 INIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCE--LEKERLTNELSSMKQQHVKVLE 1902
            + I+S+ERD++KL                      E  +E E+    L+   Q ++K+L 
Sbjct: 607  LKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIKLLN 666

Query: 1903 ELENKIKTLQKSQLTSKMEVEKHALNFDE-----MKDNNNLLKEYVDKLENKIKTLEQDL 2067
            + E K     KS++T  +E E+ +    E     ++   +L KE   +L  +   L++ L
Sbjct: 667  D-EIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVL 725

Query: 2068 AENELFEKNLITGGVNNLEQSKII--ELSVAEQKISFLDKEISNLKSKN-----KNLEDK 2226
             + +   ++ I   +    Q   +  +L++   +  FL K  + LK++N     +N   K
Sbjct: 726  LKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSK 785

Query: 2227 ILTMTLSKNLLDNKVLQLETSLSERE-LPKNTQIKNEEKEPAKQQTYTFERKKLESVNDS 2403
            IL   L     +  +L  E   + R+ + K     +E +E   ++T  +E +++   +  
Sbjct: 786  ILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQY 845

Query: 2404 DISYLYYENL-EELQNQFRTLRRELKEVQ-------------EDLDMKTESHLKLEN--- 2532
                   ++L E+L N  +TL+ +   ++             E+ +++T+S+  L N   
Sbjct: 846  KWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADD 905

Query: 2533 ---KYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEK 2703
               K   ++ +L++A   LA  Y+ +EQ  S     VS+ Q                 + 
Sbjct: 906  ITDKIETLRKNLEKANINLADAYSQIEQYKSMA--KVSE-QSAVEISKALEESQANYRKN 962

Query: 2704 LQMAENENSEKINNAIVLLQTMVEE-NTTFKDAFKHFKNSLSRLRQAINSIQ--QQSL-V 2871
            + + E E  + + + I LL   +++ N+         ++  S L + ++ +Q  Q+SL  
Sbjct: 963  IALLEQER-KSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDE 1021

Query: 2872 IESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKM 3051
            ++S Y  +I     +L+E   + AS+  +  +  E    K  +      L+R    + K 
Sbjct: 1022 LKSEYEEKI----SKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKS 1077

Query: 3052 XXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNA 3231
                        + A  RN+             QQ         + +  T+   L   N 
Sbjct: 1078 EMEGFKRSASEAKSALERNEQ---------SWCQQVADLESQLSLAQQRTE--ELNTQNR 1126

Query: 3232 KLIKEVENCTKVNETLSSQLADMQVKLEPL------EQEINELKLKVAEKE-----QHLN 3378
             L  +VE  +K   + S   A M  +   L      E++I E KL V+ +E     Q L 
Sbjct: 1127 LLYDQVELLSKATSSDSEAAASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLG 1186

Query: 3379 ICQEELER--------------------------WKLRSQTILQQG---------KIVEE 3453
            + + ELE                            KL    +L++          K +E+
Sbjct: 1187 LAKTELENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQ 1246

Query: 3454 EAHM-----KSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQA-------------HEKL 3579
              H      K  E+++ LE QL+++    ++   +   LK+++             +E++
Sbjct: 1247 SQHFQNEIAKLQEQLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERI 1306

Query: 3580 DAAKTMQI--NLTTQINELNETKV-NLEKSLQQEIEKNNQSGNGAADE------------ 3714
            D  +  ++   +T   NEL +  + NLE   Q+   K  +  N   DE            
Sbjct: 1307 DPVEHQKLADEVTELKNELEKKSLENLES--QERFRKLRKQANERLDEFKAAKAKVESEF 1364

Query: 3715 ---SEEIIRLRAELEKSNNFSNELEKKVEDAKKFKN-EIESLKSELQSVKA--------- 3855
               S    +L AEL ++ +  +ELE K+  +   KN E +SLK EL+ ++A         
Sbjct: 1365 EAVSIAKAQLEAELAQTLDKVSELESKLSSSANEKNGEADSLKEELEELRANFIEANEAV 1424

Query: 3856 -------------------------------YENSTVNSK----------IIKDLKESFK 3912
                                            E+S + +K          I++++K+ F+
Sbjct: 1425 ADIKAEAASSEKDLKNQIQELTEKIKTLESEIEHSELEAKNSNDSPDFAPIVENMKKKFE 1484

Query: 3913 REKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILK 4092
             EK  LI++                  +R+  +  +  +++ +             L  K
Sbjct: 1485 EEKQVLIQEKDEELRMKLEEIQKQYEEEREREL--SELKASLVESTPNAPLIDEETLKSK 1542

Query: 4093 RITEAEENLKKRMR-----------LPSEEKINAVIEKRRKVLEQEFETKLRELGL---N 4230
               E E+   +R+R           LPSEE+IN VIE+R++ L+QEFE ++R   L    
Sbjct: 1543 LEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFK 1602

Query: 4231 ADGNGVVTDTRAQIEK------ELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSK 4392
             +    V DT   I++      +L  KF+ +LA ++KKAFEEGKQQ +MK  LLE K++K
Sbjct: 1603 ENPESFVGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAK 1662

Query: 4393 LESQ-------TLSPTK---NNDSNETQVXXXXXXXXXXXXXXXXGEKVLQLNYGANVVA 4542
            LE Q          P+K   +N++N +                  G+ +   ++G+   +
Sbjct: 1663 LEGQPNKINLNNSVPSKIPIDNNNNSSPQGAQPIAIKPSPFQVAFGKAMENTSFGSFKGS 1722

Query: 4543 ETDND-------DNPFTLQSGKDETLLTKRSADNEIIQDIIKRPKEE 4662
              D+        D   +  +G   T   KR +++E+ Q   KRPK++
Sbjct: 1723 LLDSKQFIANTADTSTSTLTGNVGTNTNKRQSEDELAQSPEKRPKDD 1769

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  338 bits (867), Expect = 7e-94
 Identities = 393/1696 (23%), Positives = 702/1696 (41%), Gaps = 233/1696 (13%)
 Frame = +1

Query: 43   DKISSFFDLPGNTWESMDEHALEKIYTKAYD---LMKENSFVSAAIDDIKHVYEGKINTI 213
            D ++SF +L      ++      +I  K  +   L  EN   S  ID+++     K+   
Sbjct: 19   DAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGAC 78

Query: 214  SQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDH 393
              +                     R +  +E+Q+  + +D L +         EA+++  
Sbjct: 79   KDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARN-------EALEQQK 131

Query: 394  TTLEARERKTENVLEQS-------KLELQDSLTENSALKEQIGVFEGKLDSMTQELWLAN 552
              LEA +     +L +        + E +  L E   L++Q    EG+      E     
Sbjct: 132  QVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHK 191

Query: 553  TENKKLQTGMKLLRENNLYLE--IKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILSLK 726
             +  +L   + LL  NN +LE  +  K ++ N     +  + + +  +L+    ++ +  
Sbjct: 192  ADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAAT 251

Query: 727  SEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYK 906
              I TL+  N    ++L+ +   +K L D L S+KQEF +E++LKQR+ ELL  ++++ K
Sbjct: 252  KTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALK 311

Query: 907  KQIERLTSKNLETP------EKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKL 1068
             ++E   S    T       + +I  ELV   ++L  SE +  +L+ TV++ ++ DEK +
Sbjct: 312  SELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKTI 371

Query: 1069 ISKFGNPKKL--IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLER 1242
                  P     I IL++Q++ E+R K+ LQ QVE+F+VELE K+PM+ SFK+RN  LE+
Sbjct: 372  SGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEK 431

Query: 1243 ELLR-------ITSSLEETAKE--------RDIKDR------------------------ 1305
            EL         I+   +ETA +        RD++ +                        
Sbjct: 432  ELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTV 491

Query: 1306 ----------ELTNLQKKISNNE-----------------QFND--ELLRQRSDLAHQVQ 1398
                      E T   KK+ N E                 +F +  EL  + +DL H V+
Sbjct: 492  RGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVR 551

Query: 1399 YLLL--------------CIDNKSPFTEKEA--TLVKKIVSNENT----ENDTDSHKIIS 1518
             L                 I+N +    KEA  TL   I   E        + D++K I 
Sbjct: 552  NLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKAIQ 611

Query: 1519 KRLLH------FQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKI----- 1665
             +  H       ++V     +N                 E E    L +T+N ++     
Sbjct: 612  SQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQELARSKS 671

Query: 1666 -----VESAKSTSVDLEKHIKTLESKINIISQERDSYK----LLVXXXXXXXXXXXXXXX 1818
                 VE  KS+ +  E+ +K  +S + +  QE +       +L                
Sbjct: 672  ELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLAKQDTRTQETIS 731

Query: 1819 XXXXCELEKERLTNELSS-------MKQQHVKVLEELENKIKTLQKSQLT------SKME 1959
                C+ +   L+ EL +       +   H K+ E   N+  T ++++LT        ++
Sbjct: 732  ELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKET--NEQLTKERNELTILVTQLQTLQ 789

Query: 1960 VEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLIT------------ 2103
             E+  L    +KD+++  K  +D LE +I  L   L++      + ++            
Sbjct: 790  KERDTL----LKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEK 845

Query: 2104 -GGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLE------------DKILTMTL 2244
               +N   +S   +L+   Q I  L  + S L SK ++ E            D +LT T 
Sbjct: 846  IDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVLTQTD 905

Query: 2245 S-KNLLDNKVLQLETSLSERELPKNTQIKNEEKEPA-------KQQTYTFERKKLESVND 2400
            + ++ L+   + L+ + S+ +  K      +E   A        +Q +T E + L+   D
Sbjct: 906  ALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERD 965

Query: 2401 SDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKL 2580
            +            L N    L+ +L  +  +LD +      L++++ K + ++K     L
Sbjct: 966  A------------LSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTAL 1013

Query: 2581 ASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLL 2760
            AS+    + + S L   ++Q                    K Q    +  ++  +    +
Sbjct: 1014 ASMKDQYQLELSKLTEDLNQ--------------QAMYANKAQENYEQELQRHADVSKTI 1059

Query: 2761 QTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKM 2940
              + EE    K+     + S++ L++++   +      +  Y T+   +++R+E+   + 
Sbjct: 1060 SQLREEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQN 1119

Query: 2941 ASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPR 3120
                 +++  L+  D   +N        R LI   K             +R     K   
Sbjct: 1120 RLLFDQIS--LKDTDSIPINDELKSE-ARELISTLKRECDILQTKLELAKRDESNLKQKL 1176

Query: 3121 EKFP------------SFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTK 3264
            E               S V  D +S        ++E   ++  L ESN  L  E++  ++
Sbjct: 1177 EFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQ 1236

Query: 3265 VNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKI 3444
             N+ L   + ++Q  L+PLE +I  L+  V  K++ +++  EE+ RWK RSQ IL + + 
Sbjct: 1237 RNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYER 1296

Query: 3445 VEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQIN 3624
            V+ E H K  E++     +      + ++L DRF RLKKQA E+LD A+T Q  L  ++ 
Sbjct: 1297 VDPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELT 1356

Query: 3625 ELNETKVNLEKSLQQEIEKNN--QSGNGAADESEEIIRLRAELEKSNNFSNELE---KKV 3789
            E  E++  LE +L +E EK    Q    A +E+        E+E S+   ++L+   +K+
Sbjct: 1357 EARESQKALEDALDKEREKTRSLQESIKATEEN--------EIENSSATRDQLQDALQKL 1408

Query: 3790 EDAKKFKNEI--------ESLKSEL----QSVKAYENSTVNS----KIIKDLKE------ 3903
            EDA+   NE+        ++L+ EL    Q VK  E     +    +++++ K       
Sbjct: 1409 EDAQARINEMSTAPSQEEQTLREELERTRQHVKQLEEHLAKTQNEVRVLEEAKNQVSGTE 1468

Query: 3904 -SFKREKDELIEQMXXXXXXXXXXXXXTILAQR--------KNNILANGQESANIXXXXX 4056
                R K ELI+                   QR        K+   +   +S++I     
Sbjct: 1469 AEIARVKTELIDHSNKLLAEKEAEIKEKYEKQRLEDKAELEKSLASSESLKSSDIENLKK 1528

Query: 4057 XXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLR------- 4215
                      +KRI EA E L+KR+RLP+EEKIN +IE R++ L++EFE KL+       
Sbjct: 1529 EWEEEYEQRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELA 1588

Query: 4216 -ELGLNADGNGVVTDTRAQIEK---ELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERK 4383
             E  L A    V+   + ++EK   +++ + + E+A+ KKKAF+EGKQQ+ MKS  LE+K
Sbjct: 1589 GEKPLPATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLEKK 1648

Query: 4384 LSKLESQTLSPTKNND 4431
            ++KLE+Q  +  +  D
Sbjct: 1649 IAKLEAQAKAAAEKPD 1664

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 178/947 (18%), Positives = 371/947 (39%), Gaps = 82/947 (8%)
 Frame = +1

Query: 1855 TNELSSMKQQHVKVLEELEN-KIKTLQKSQLTSKMEVEKHAL--NFDEMKDNNNLLKEYV 2025
            +++L + K Q   +L+E+E  + + LQ  Q  ++ + E+     + D ++  N  L++  
Sbjct: 72   SHKLGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQK 131

Query: 2026 DKLE-NK-------------IKTLEQDLAENELFEKNLITGGVNNLE---QSKIIELSVA 2154
              LE NK             I TL+Q   E E   +   T    NLE   Q+++ +    
Sbjct: 132  QVLEANKNDVAQLLNEKIGDIATLQQ---ETERLLQEARTLRQQNLELEGQARVYKSEEL 188

Query: 2155 EQKISF--LDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSER--------- 2301
            + K  F  L +++S L + N+ LE ++       N    +      S+S+R         
Sbjct: 189  KHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQ 248

Query: 2302 ---ELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEE-----LQNQFR 2457
               +  K  + +N +KE   +  +   +K  + +  +   +    +L++     L+ Q  
Sbjct: 249  AATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVS 308

Query: 2458 TLRRELK---EVQEDLDMKT-ESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLA 2625
             L+ EL+     Q   D  T ES  ++E++       L+++  K+  +  T+EQ  S   
Sbjct: 309  ALKSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADE 368

Query: 2626 NSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAI----VLLQTMVEENTTFK 2793
             ++S  Q                 +K  + E    E + N +    V L+  V   ++FK
Sbjct: 369  KTISGSQSLPDLYADIGIL-----KKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFK 423

Query: 2794 DAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEIL 2973
            D     +  L+     ++SI +     +     ++     ++ + E ++++   + +++ 
Sbjct: 424  DRNDVLEKELAETAYMLDSISKD----KDETAADLKRTKSQIRDLESQISALTQQRSDLA 479

Query: 2974 ESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNP--------REKF 3129
                  ++     G     L  E+              +     N  P         E+ 
Sbjct: 480  RQVQYLLIQVTVRGDSHGPLSAEETAFVK---------KVVNMENTQPDGDAQGIISERL 530

Query: 3130 PSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKE-VEN--CTKVNE---TLSSQL 3291
              F  I +           + N    L  EE   K   E +EN   T+  E   TL   +
Sbjct: 531  VEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHI 590

Query: 3292 ADMQVKLEPLEQEINELKLKVAEKEQH--------LNICQEELERWKLRSQTILQQGKIV 3447
             +++ +++ + +E +  K   ++            +N    E    K+R    L      
Sbjct: 591  QELETRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKR 650

Query: 3448 EEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINE 3627
            E EA++K L    T  ++L   ++E     ++    +  A E+L  +K+  +    +  E
Sbjct: 651  EAEANVKLL---MTENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEE 707

Query: 3628 LNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKS-------NNFSNELEKK 3786
            LN+  + LE +L ++  +  ++ +   D   ++  L AEL+ S       N    +L++ 
Sbjct: 708  LNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKET 767

Query: 3787 VEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXX 3966
             E   K +NE+  L ++LQ+++   ++     ++KD  ++FK + D L  ++        
Sbjct: 768  NEQLTKERNELTILVTQLQTLQKERDT-----LLKDSDDNFKGKIDSLEAEI-------- 814

Query: 3967 XXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSE 4146
                 T+L+Q+    L++   +++                LK  T ++ N K +M    +
Sbjct: 815  -SQLRTLLSQKATE-LSDFMSTSDSRSRWYQEKIDALNECLKS-TTSDLNSKTQMIQELQ 871

Query: 4147 EKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDT---RAQIEK-ELREKFNLELAE 4314
             + + +  K R     + ETK +   +    + V+T T   R+++EK  +  K      +
Sbjct: 872  SQQSLLTSKLR-----DAETKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVD 926

Query: 4315 IKKKAFEEGKQQSMMKSTLLE--RKLSKLESQTLSPTKNNDSNETQV 4449
              K  +   K+     +T LE  ++   +E +TL   ++  SN+  V
Sbjct: 927  EYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALSNDAAV 973

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  335 bits (859), Expect = 4e-93
 Identities = 368/1512 (24%), Positives = 657/1512 (43%), Gaps = 139/1512 (9%)
 Frame = +1

Query: 286  REKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDS 465
            REKL   +Q E DSN  L     L+   LE       T+++        +  +  EL+ +
Sbjct: 44   REKL---RQAE-DSNRLLRERNELLSRSLEEKTGILDTVQSS-------VSTANAELRSA 92

Query: 466  LTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNK 645
              +   L++++G  E +      EL   +  +++L+ G + +   N  L       +  K
Sbjct: 93   REQVVELRQRLG--ESETQRFQSELQ-RDRLSEQLKQGERYINATNGRL------LESTK 143

Query: 646  KLYSSAEDASR---LQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDN 816
            KL     D  +   ++ +L    SEI +L+   + L    E ++ +L  K    K L D 
Sbjct: 144  KLLDFQRDDRQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQ 203

Query: 817  LNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLV 996
            L+S + +F +E+  + ++N +L  ++ S   ++        ETP      +     ++  
Sbjct: 204  LSSQRHDFERELATRDKLNAVLKKQVNSLHSEL----GNGGETPAHAEPND--QFAKQSS 257

Query: 997  NSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFL 1176
              E+E +  K  V++ + I         G     I  LR+ L+KE++   +L++Q+ESF+
Sbjct: 258  QHEEEISNYKEQVEELLGI--------LGQGAPSIAHLRKLLLKERKENVSLKKQMESFV 309

Query: 1177 VELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFND 1356
            +ELE +LP +   +++N  ++++L   T+ + E +K +    REL++ ++K+ +  Q   
Sbjct: 310  IELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFH 369

Query: 1357 ELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHF 1536
            +L  QRSDLAHQ+Q+LL    + +     E + +K I+ NEN +   DS +I+S RLL F
Sbjct: 370  KLRVQRSDLAHQIQFLLTVNSSDTVLPPSELSFIKTIIENENWDAYKDSQRIVSDRLLRF 429

Query: 1537 QNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRIT---------------------- 1650
             N+ ELQ++NM                E +    L +                       
Sbjct: 430  DNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGLTLEAAKLQISKLEQSNAQLESEVKN 489

Query: 1651 ---------DNNKIVESAKSTSVDLEKHIKTLESK-----------INIISQERD----S 1758
                     D + +      T V+ +K I+ LESK           IN++++  D    +
Sbjct: 490  WEALMETLKDGDSLDSKINVTMVEQQKKIEELESKLTDVGESHVQKINVLNKTIDRNQST 549

Query: 1759 YKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMK-----------------QQH 1887
              +L                    C+ E   LT ++S+ +                 Q  
Sbjct: 550  INMLNEQIKNTVKSDMNAKSELIACKRENLSLTQQISTKQNELDELNSKSAQKERDYQLK 609

Query: 1888 VKVLEELENKIKTLQKS-----QLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKT 2052
            +  L    NK K+ + S     +  ++ME ++ +L FD+++  +  L +    LE + K 
Sbjct: 610  IAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSL-FDKIQQESKKLLQ----LETRNKE 664

Query: 2053 LEQDLAENELFEKN---LITGGVNNL-EQSKIIELSVA-------------EQKISFLDK 2181
            LE  ++  EL  K     ++  +  L E++K +   +A             E++I +  +
Sbjct: 665  LEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQ 724

Query: 2182 EISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQT 2361
             I  L  +NKN  +KI+ +     LL  K      SLS +  P  T++K  + E      
Sbjct: 725  NIDELSEQNKNKSNKIIELNDKLRLLSEK------SLSNKPYPVGTELKELQNELNGM-- 776

Query: 2362 YTFERKKLESVNDSDISYLYYENLEELQNQFR----TLRRELKEVQEDLDMKTESHLKLE 2529
                 K    V++S  + LY + LE  QN +     + +  + E+Q   +  ++ H  L+
Sbjct: 777  -----KAALEVSESQAT-LYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQ 830

Query: 2530 NKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQ 2709
            N+ T+ +N  K    +  ++   L  + + L   ++ L                  +K++
Sbjct: 831  NQITETENQSKGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIE 890

Query: 2710 MAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQ-----QSLVI 2874
                  S+   N    L +  +E T++    +     +++L   I ++ +     ++L+ 
Sbjct: 891  SNLKIQSDTRLNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTLIK 950

Query: 2875 E-SNYNTEIDHANERLEEAEVKMA----SFDGKVTEILESYDGKILNTAAIGHLVRSLIH 3039
            E  +   E+  AN+R+E    + +    +F G     +   D        + +LV +L  
Sbjct: 951  ERDSLGQELKLANQRIESLAAQNSILYDTFSG-----MRHVDADAEPNEDLRNLVINLRI 1005

Query: 3040 EKKMXXXXXXXXXXXXRRARYRNKNPREKFP-SFVKIDQQSXXXXXXXXVMENTTKL-LA 3213
            E+ M            +  +   K   EK   +  +ID+ +           NT K   +
Sbjct: 1006 ERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPT-----------NTEKDDFS 1054

Query: 3214 LEESNAKLIKEVENCTKVNET---LSSQLADMQVKLEPLEQEINELK------------L 3348
            L  ++ K+++E+E  T   E    L   +  +      L++E++ L+            +
Sbjct: 1055 LTVTHEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQEEVSRLRESEELAKKNSSAI 1114

Query: 3349 KVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRT--- 3519
               E +Q +   Q+E E+WKL  Q + +            +  +I+ L++QLET +    
Sbjct: 1115 SEQEWQQKIETYQQESEKWKLMCQQMSEN-----------TATEIQNLQQQLETFKADIQ 1163

Query: 3520 ----ENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNN 3687
                EN  L DRF RLKKQAHEKL+A+K    +L  +++EL      L++ L      NN
Sbjct: 1164 LKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKL------NN 1217

Query: 3688 QSGNGAADESEE--IIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYE 3861
            Q  N    ES    I++L+ E +++ +   EL   V+ ++K    I  +  EL ++K  E
Sbjct: 1218 QETNSVDSESNAALILQLKEENKQAKSLELELRHSVDSSEKL---IADMTKELTTLK--E 1272

Query: 3862 NSTVNSKIIKD-------LKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILAN 4020
            N    S  ++D       LK  F+ EK  LIE+              T   +R+   L N
Sbjct: 1273 NPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSEL---------TERFEREKKELMN 1323

Query: 4021 GQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEF 4200
               +AN+               L+RI EA+ENLKK +RLP+EEKI  VI KR+  LE++F
Sbjct: 1324 N--NANLEELRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQF 1381

Query: 4201 ETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAE----IKKKAFEEGKQQSMMKST 4368
            +TK+ E       + +   T  ++EKE+RE+    L E    +KKKAFEEG+QQ+ MK+T
Sbjct: 1382 QTKVAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTT 1441

Query: 4369 LLERKLSKLESQ 4404
            LLERK++KLE++
Sbjct: 1442 LLERKIAKLEAR 1453

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 183/865 (21%), Positives = 349/865 (40%), Gaps = 90/865 (10%)
 Frame = +1

Query: 325  SNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQ------DSLTENSAL 486
            S + L+S+IT +  + +++   H  L  +E + +  +E+S+ +++      D L+E +  
Sbjct: 679  SEETLSSKITFLSEENKSL---HNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKN 735

Query: 487  KE-QIGVFEGKL-----DSMTQELWLANTENKKLQT---GMKLLRENNLYLEIKCKET-D 636
            K  +I     KL      S++ + +   TE K+LQ    GMK   E +       K+T +
Sbjct: 736  KSNKIIELNDKLRLLSEKSLSNKPYPVGTELKELQNELNGMKAALEVSESQATLYKDTLE 795

Query: 637  KNKKLYSSA-----EDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIK 801
            +N+  Y+++        S LQ + + +S +  +L+++I   +  ++ +  + Q  + R+ 
Sbjct: 796  RNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLT 855

Query: 802  D----LDDNLNS---SKQEFA-----------------------------------KEIT 855
                 L++ LNS   S+++ A                                   KE+T
Sbjct: 856  SEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELT 915

Query: 856  LKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKE--KLVNSEKECNELKS 1029
                  E L+ EIA     I  LT        K +I+E   L +  KL N   E    ++
Sbjct: 916  SYAVQIEQLNTEIAKLNSDIAALTEP--AEARKTLIKERDSLGQELKLANQRIESLAAQN 973

Query: 1030 TVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMID 1209
            ++  Y      + +     P    E LR  ++  +  +D  Q Q  +   + + KL    
Sbjct: 974  SI-LYDTFSGMRHVDADAEPN---EDLRNLVINLRIERDMHQSQETT--AQRDVKL---- 1023

Query: 1210 SFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAH 1389
                    L++ L  IT  L  T  E D    E TN +K   +    +++++R+   L +
Sbjct: 1024 --------LKKNLKEITEKLAITCPEID----EPTNTEKDDFSLTVTHEKIMRELEGLTN 1071

Query: 1390 QVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNM 1569
              +  L   ++     E + TL +++     +E        ++K+     + +E QQK  
Sbjct: 1072 TKEENLYLDESIKSLNEDKRTLQEEVSRLRESEE-------LAKKNSSAISEQEWQQK-- 1122

Query: 1570 XXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQE 1749
                            +QE +K   +    ++ E+  +   +L++ ++T ++ I + +QE
Sbjct: 1123 ------------IETYQQESEKWKLMC--QQMSENTATEIQNLQQQLETFKADIQLKTQE 1168

Query: 1750 RDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTL 1929
             D                          +   + L  ELS +K  +  + E+L N     
Sbjct: 1169 NDDLN------DRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNN----- 1217

Query: 1930 QKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLA----ENELFEKNL 2097
               Q T+ ++ E +A    ++K+ N   K    +L + + + E+ +A    E    ++N 
Sbjct: 1218 ---QETNSVDSESNAALILQLKEENKQAKSLELELRHSVDSSEKLIADMTKELTTLKENP 1274

Query: 2098 ITGGVN------NLEQSK---------IIELSVAEQKISFLDKEISNLKSKNKNLEDKIL 2232
            I G VN       LEQ K         +IE + +E    F ++E   L + N NLE+  L
Sbjct: 1275 IQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERF-EREKKELMNNNANLEE--L 1331

Query: 2233 TMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEK------EPAKQQTYTFERKKLESV 2394
               L +   + K LQ     ++  L K+ ++  EEK      +   Q    F+ K  E  
Sbjct: 1332 RKPLEEE-WERKTLQ-RIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQA 1389

Query: 2395 NDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATY 2574
            N   +S L  +  +EL+          KEV+E++  KT    +LE  +  +K    +   
Sbjct: 1390 NLLKLSELSNKTADELE----------KEVREEI--KT----RLEEDFELLKKKAFEEGR 1433

Query: 2575 KLASVYTTLEQKNSFLANSVSQLQG 2649
            + AS+ TTL ++   +A   ++LQG
Sbjct: 1434 QQASMKTTLLERK--IAKLEARLQG 1456

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 176/929 (18%), Positives = 344/929 (37%), Gaps = 76/929 (8%)
 Frame = +1

Query: 1849 RLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVD 2028
            R  NEL S      + LEE    + T+Q S  T+  E+        E++      +    
Sbjct: 58   RERNELLS------RSLEEKTGILDTVQSSVSTANAELRSAREQVVELRQRLGESETQRF 111

Query: 2029 KLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKN 2208
            + E +   L + L + E +     T G       K+++    ++++  +  ++    S+ 
Sbjct: 112  QSELQRDRLSEQLKQGERYIN--ATNGRLLESTKKLLDFQRDDRQVGVIRGKLDQSLSEI 169

Query: 2209 KNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERK--- 2379
            K L D             N  L        REL     +     +    Q + FER+   
Sbjct: 170  KALRDS------------NSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELAT 217

Query: 2380 --KLESVNDSDISYLYYE--------NLEELQNQFRTLRRELKEVQEDLDMKTESHLKLE 2529
              KL +V    ++ L+ E           E  +QF     + +E   +   + E  L + 
Sbjct: 218  RDKLNAVLKKQVNSLHSELGNGGETPAHAEPNDQFAKQSSQHEEEISNYKEQVEELLGIL 277

Query: 2530 NKYTKVKNDLKQATYKLASVYTTLE-QKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKL 2706
             +       L++   K      +L+ Q  SF+     +L G                  L
Sbjct: 278  GQGAPSIAHLRKLLLKERKENVSLKKQMESFVIELEHRLPG------------------L 319

Query: 2707 QMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNY 2886
            Q+ E +N E           M+EE+            +  R ++ ++S +Q+        
Sbjct: 320  QILEKQNKEVQQKLHAATNKMIEES-----------KAKIRTQRELSSSRQK-------- 360

Query: 2887 NTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXX 3066
               +DH N+   +  V+ +    ++  +L       +   +    ++++I  +       
Sbjct: 361  ---VDHLNQIFHKLRVQRSDLAHQIQFLLTVNSSDTVLPPSELSFIKTIIENENWDAYKD 417

Query: 3067 XXXXXXXRRARYRN----KNPREKFPSFV-----KIDQQSXXXXXXXXVMENTTKLLALE 3219
                   R  R+ N    +    K  S V     K++           +     ++  LE
Sbjct: 418  SQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGLTLEAAKLQISKLE 477

Query: 3220 ESNAKLIKEVENCTKVNETLSS----------QLADMQVKLEPLE-----------QEIN 3336
            +SNA+L  EV+N   + ETL             + + Q K+E LE           Q+IN
Sbjct: 478  QSNAQLESEVKNWEALMETLKDGDSLDSKINVTMVEQQKKIEELESKLTDVGESHVQKIN 537

Query: 3337 ELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVR 3516
             L   +   +  +N+  E+++   ++S    +   I  +  ++   ++I T + +L+ + 
Sbjct: 538  VLNKTIDRNQSTINMLNEQIKN-TVKSDMNAKSELIACKRENLSLTQQISTKQNELDELN 596

Query: 3517 TENAQLTDRFDRLK----KQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKN 3684
            +++AQ  +R  +LK      A  K  + +     LT +  ++ + + +L   +QQE +K 
Sbjct: 597  SKSAQ-KERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQQESKKL 655

Query: 3685 NQSGNGAAD-----ESEEIIRLRAE----------LEKSNNFSNELEKKVEDAKKFKNEI 3819
             Q      +       +E+ R R+E           E++ +  N+L  K E+ K+F   I
Sbjct: 656  LQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQF---I 712

Query: 3820 ESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIE------QMXXXXXXXXXXXXX 3981
            E  KSE Q +K Y+ +      I +L E  K + +++IE       +             
Sbjct: 713  E--KSEKQ-IKWYQQN------IDELSEQNKNKSNKIIELNDKLRLLSEKSLSNKPYPVG 763

Query: 3982 TILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKI-- 4155
            T L + +N +  NG ++A              A + K   E  +N      L  +  I  
Sbjct: 764  TELKELQNEL--NGMKAA-------LEVSESQATLYKDTLERNQNFYNNSTLSFQNTISE 814

Query: 4156 ----NAVIEKRRKVLEQEF-ETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIK 4320
                N  + K+ + L+ +  ET+ +  G+  +   ++ D     +  L EK N      +
Sbjct: 815  LQSKNEALSKQHETLQNQITETENQSKGIQLEHQTII-DRLTSEKTALEEKLNSLSHSEE 873

Query: 4321 KKAFEEGKQQSMMKSTLLERKLSKLESQT 4407
            K A  +G+  + ++   +E  L K++S T
Sbjct: 874  KIAEMKGEYDAQIQK--IESNL-KIQSDT 899

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  332 bits (850), Expect = 1e-91
 Identities = 406/1657 (24%), Positives = 683/1657 (41%), Gaps = 287/1657 (17%)
 Frame = +1

Query: 337  LNSEITLIKYDLEAMQRDHTTLEARERKTENVL------EQSKL-ELQDSLTENSALKEQ 495
            L+S+   +K +L+ +  D+T + A  +     +      + SKL E+    T N  L+  
Sbjct: 59   LSSKYEKLKEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNN 118

Query: 496  IG-------VFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCK-----ETDK 639
            I           G  D    EL     E K+LQT +K L +  L LE+KC+     E ++
Sbjct: 119  IDRANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNR 178

Query: 640  NKKLYSSAEDASRLQDQLQIVSSEILS-------------------------LKSEIATL 744
              +L  +A++   L+   + +  E+ +                         LKS++   
Sbjct: 179  KSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIE 238

Query: 745  KYMNESLS-------TDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASY 903
            K   E LS         LQ  L   KDL D L   KQEF KE+++K ++ +L  N+I S 
Sbjct: 239  KSSKEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSL 298

Query: 904  KKQIER------LTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYIN----- 1050
            +  +++         +N     K + +EL   + KL + E++C  L+S +D   N     
Sbjct: 299  ESTLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQ 358

Query: 1051 -IDEKKLISKFGNPKKL-------------------IEILRRQLVKEKRHKDTLQRQVES 1170
                K+  S   N                       I+IL+RQLV+EKR K+ LQ QVES
Sbjct: 359  TKGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVES 418

Query: 1171 FLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQF 1350
            F++ELE K+P+I+SF+ER S LE+EL      LE   KE ++K  EL +L+KKIS++   
Sbjct: 419  FVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQ 478

Query: 1351 NDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTDSHKIIS 1518
             + LLRQR+DLAHQ+QYLL+ I    DN     E E   +K +VSN+N  +  DS K+IS
Sbjct: 479  LEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVIS 538

Query: 1519 KRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLR--ITDNNKIVESAKSTSV 1692
            + L+ F+++++LQ+KNM                E++++ T    + ++N+I   AK   +
Sbjct: 539  EHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAIL 598

Query: 1693 DLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSS 1872
             LEK  + LE  + I+++ERD++KLLV                    +   E +  +L +
Sbjct: 599  TLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLEN 658

Query: 1873 MKQQ-------HVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDE-----MKDNNNLLK 2016
               Q       H K L E E  +   + SQL  ++E  + A +  E      +++  LL 
Sbjct: 659  RLTQLTNDSNAHSKALTE-ELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLS 717

Query: 2017 EYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNL 2196
            +  ++L  +   LE  L + +   +   +  V  + ++  +E SV       L+ E++ L
Sbjct: 718  KENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRN-----LETEVTLL 772

Query: 2197 KSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFER 2376
            K +  +L+ ++   T  K  L   V QL++  SERE     +++++ K+   +  Y  E+
Sbjct: 773  KDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLE-RVQSDFKKRISEVNYINEK 831

Query: 2377 --KKL-ESVNDSD-------ISYLYY----------------------ENLEELQNQFRT 2460
              K+L E V++ D         Y +Y                      + LE L  Q +T
Sbjct: 832  LDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKT 891

Query: 2461 LRRELKEVQEDLDMKTESHLKLENKYTKVKND----LKQATYKLASVYTTLEQKNSFLAN 2628
            L +EL+  Q  + + T   +   N   + +ND    L++   +LA  Y+ LE+  +   N
Sbjct: 892  LEKELEGAQ--IRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQN 949

Query: 2629 SVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKH 2808
            S   L                  ++L  + N       +AI   +T+ EE T  +  F+ 
Sbjct: 950  SEDAL------------------KELNASFNAKDRDYRDAI---KTLTEEKTEIEGRFEI 988

Query: 2809 FKNSLSRLRQAINSIQQQSLVIESNYN------TEIDHANERLEEA----EVKMASFDGK 2958
             K  L  ++   N +  QS   ES          E+  A + +EE     E K+   +  
Sbjct: 989  LKQQLENIK---NELTVQSEEAESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLEND 1045

Query: 2959 VTE-------ILESYDGKILNTAAIGHLV-------RSLIHEKKMXXXXXXXXXXXXRRA 3096
            + E         ++Y+ ++   A +   +       + L ++ K              + 
Sbjct: 1046 LEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQN 1105

Query: 3097 RYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNET 3276
                K+ R+++   + + QQ          +++ TK   L  +   L+   E+   VNE 
Sbjct: 1106 EKHLKSERDEYRIQIDLAQQR---------IDDITKQNQLLYNQIDLLNRAES---VNEN 1153

Query: 3277 LSSQLADMQVKL--------EPLEQEINELKLKVAEKEQHLNICQEELERWK-----LRS 3417
             S   A+    L        + L+ +IN ++ +    +Q L+  Q ELE  K     L S
Sbjct: 1154 SSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKRSAALLES 1213

Query: 3418 QTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTM 3597
            +       I   +     LE++  L E   T+R E  Q  D  D++ K      +    +
Sbjct: 1214 EYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICRNELLPL 1273

Query: 3598 QINLTTQINELNE--------------------------TKVNLE--KSLQQEIEKNNQS 3693
            Q NL +  N + E                           KVN++    L++ + +  Q 
Sbjct: 1274 QSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETKQL 1333

Query: 3694 GNGAADESEEI----IRLRAELEKSNNFSNELEKKV-EDAKKFKNEIESLKSELQSVKAY 3858
             +    E+ E+     RL+ +  +  N S EL+  + E      +E + ++ +L  VK  
Sbjct: 1334 LDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQL-DVKTE 1392

Query: 3859 ENSTVNSKI---------IKDLKESFKRE--KDELIE----------QMXXXXXXXXXXX 3975
            ENS + S++         ++ L+E   +E  K E +E           +           
Sbjct: 1393 ENSELLSELNNFREKQNDLETLREELNKEISKSEELEVKLQNEIESSSLASRNTNKEIEE 1452

Query: 3976 XXTILAQRKNNILANG-----QESANIXXXXXXXXXXXXALILKRITE-----AEENLKK 4125
               ++   K  + AN      Q + N+              I ++  E      EE  K 
Sbjct: 1453 LQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKI 1512

Query: 4126 RMRLPSEEK----INAVIEKRRKVLEQEFETKLRELGLNADG--------------NGVV 4251
            R      EK    +N  +E  RK  E++ E  +++    A+               N ++
Sbjct: 1513 RNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKII 1572

Query: 4252 TDTRAQIEKELREK----------------FNLELAE----------------IKKKAFE 4335
               R+++E E  +K                FN EL E                 +KKAFE
Sbjct: 1573 EKRRSELESEFDQKIRDKARDLLMNDHSNEFNNELKEALEKELKERFEDELQAARKKAFE 1632

Query: 4336 EGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQ 4446
            EGKQQ+ MK+TLLERK+ KLESQ     K  DS ETQ
Sbjct: 1633 EGKQQATMKTTLLERKIQKLESQI--QEKEKDSEETQ 1667

 Score =  128 bits (322), Expect = 7e-29
 Identities = 273/1320 (20%), Positives = 531/1320 (40%), Gaps = 110/1320 (8%)
 Frame = +1

Query: 277  LVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLEL 456
            LV+ + + S      DS   ++  +   K D++ +Q  +  L    R     LE++  E 
Sbjct: 521  LVSNDNMASTN----DSQKVISEHLIKFK-DIQQLQEKNMELVKTVRTLAQQLEEN--EE 573

Query: 457  QDSLTENSALKEQIGVF-EGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKET 633
            +   T N+ + E   +F E K   +T E    N E                 L+I  KE 
Sbjct: 574  KKKSTSNNTVDEDNEIFAEAKEAILTLEKVNENLEKN---------------LQIVTKER 618

Query: 634  DKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDD 813
            D  K L S  ED  R        SS  +    E   LK  NE++  DL+ +L ++ + D 
Sbjct: 619  DAFKLLVS--EDRER-----NFKSSNSVHKYHE---LKSYNETVVKDLENRLTQLTN-DS 667

Query: 814  NLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTS-KNLETPEKKIIQELVDLKEK 990
            N +S          L + +N LLH EI+    QIE+  S K+L     KI Q  ++L  K
Sbjct: 668  NAHSK--------ALTEELN-LLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSK 718

Query: 991  LVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVES 1170
                E E   ++S+      +++  L       K     +  + + +    +T  R +E+
Sbjct: 719  ----ENEQLRIRSS-----RLEDSLLQQDKETQKTFSSYV--EAISKNSSLETSVRNLET 767

Query: 1171 FLVELEQKLPMIDSFKERNSSLERELLRI-TSSLEETAKERD-IKDRELTNLQKKISNNE 1344
             +  L+ +   + S +  N++ E+  LRI  + L+    ER+ + +R  ++ +K+IS   
Sbjct: 768  EVTLLKDREISLKS-ELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVN 826

Query: 1345 QFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEK---EATLVKKIVSNE-NTENDTDSHKI 1512
              N++L +Q S+  H++  +    + +  + +K   EA+  ++ +  +  T+ND      
Sbjct: 827  YINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKND------ 880

Query: 1513 ISKRLLHFQNV---KELQQKNMXXXXXXXXXXXXXXXXEQ-----EQQKT-LRITDNNKI 1665
                 LH QN    KEL+   +                E+     E +KT + + D    
Sbjct: 881  -ELERLHLQNKTLEKELEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQ 939

Query: 1666 VESAKSTSVDLEKHIKTLESKINIISQE-RDSYKLLVXXXXXXXXXXXXXXXXXXX---- 1830
            +E  K+ S + E  +K L +  N   ++ RD+ K L                        
Sbjct: 940  LEEFKNLSQNSEDALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNE 999

Query: 1831 -------CELEKERLTNELSSM----------KQQHVKVLEELENKIKT----LQKSQLT 1947
                    E E++RLT  ++ +          K+   + L++LEN ++        +Q  
Sbjct: 1000 LTVQSEEAESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKN 1059

Query: 1948 SKMEVEKHA---LNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNN 2118
             + E+++HA       E+++ N  LK     L  ++++L+  +++NE   K+        
Sbjct: 1060 YEQELQRHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKS-------- 1111

Query: 2119 LEQSKI-IELSVAEQKISFLDKE----------ISNLKSKNKNLEDK--------ILTMT 2241
             E+ +  I++ +A+Q+I  + K+          ++  +S N+N  D         +L++ 
Sbjct: 1112 -ERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLR 1170

Query: 2242 LSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLY 2421
              +++LD K+  +ET  +  +  K   I+NE  E  K+     E +              
Sbjct: 1171 RERDILDTKINVIETEKNSLQ-QKLDDIQNE-LENTKRSAALLESE-------------- 1214

Query: 2422 YENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYT-------KVKNDLKQATYKL 2580
            Y    +L N ++T+R +L    E L++  ES++ L N+         K+  DL+    +L
Sbjct: 1215 YSEHSDLINNYQTIRGDL----EQLNLLRESNVTLRNELKQALDEKDKIAKDLQICRNEL 1270

Query: 2581 ASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLL 2760
              + + LE  N+ +     ++                       + N+ S++       L
Sbjct: 1271 LPLQSNLESANNLIKEKDLKIA----------------------SANDESQRWKTR---L 1305

Query: 2761 QTMVEENTTFK-DAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVK 2937
            + M+E++     D +   + +L+  +Q +++  Q++  +   +N     A+E+L  ++  
Sbjct: 1306 EEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKEL 1365

Query: 2938 MASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNP 3117
             +S   +++ ++   D            +R  +  K              R  +   +  
Sbjct: 1366 QSSLQEQISNLISEKDD-----------IRKQLDVKTEENSELLSELNNFREKQNDLETL 1414

Query: 3118 REKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLA- 3294
            RE+    +   ++          ++N  +  +L   N    KE+E   KV + L +QLA 
Sbjct: 1415 REELNKEISKSEELEVK------LQNEIESSSLASRNTN--KEIEELQKVIDDLKTQLAA 1466

Query: 3295 -----DMQVK--LEPLEQEINELKLK-VAEKEQH-------------------------L 3375
                 D Q    +E +++E    K K +AEK +                          L
Sbjct: 1467 NSTDADEQTNRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTEL 1526

Query: 3376 NICQEELER-WKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFD- 3549
            N+  E L + W+  S+ ++Q+ +I E E ++K   ++ + E+  + +    ++L   FD 
Sbjct: 1527 NVDVEALRKQWEEDSEELIQK-RIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQ 1585

Query: 3550 RLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAA-DESEEI 3726
            +++ +A + L    + + N        NE K  LEK L++  E   Q+    A +E ++ 
Sbjct: 1586 KIRDKARDLLMNDHSNEFN--------NELKEALEKELKERFEDELQAARKKAFEEGKQQ 1637

Query: 3727 IRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKES 3906
              ++  L         LE+K++  +    E E    E Q VK  ENST + K I +   S
Sbjct: 1638 ATMKTTL---------LERKIQKLESQIQEKEKDSEETQDVKPEENSTPSVKKIPETLNS 1688

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  328 bits (841), Expect = 9e-91
 Identities = 364/1534 (23%), Positives = 663/1534 (43%), Gaps = 139/1534 (9%)
 Frame = +1

Query: 388  DHTTLEARERKTENVLEQSKLELQ--DSLTENSALKEQIGVFEGKLDSMTQELWLANTEN 561
            D   + A+ R     +  + +E Q  ++ T  S + ++I   + +L+    E  ++ +E 
Sbjct: 65   DEINILAKTRDISGPIRITGVEAQAPNNATSISNINDEILTLQRELERAKSEHLISQSEA 124

Query: 562  KKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSS---EILSLKSE 732
            ++     +L+RE+N +LE    +T   ++L +  +   +++++ Q + +   E+  LK  
Sbjct: 125  ERSLKQSELVREHNQWLEEHLVKT--TEELMTQKQSILKMEEKDQEIDNLRHEVSILKKN 182

Query: 733  IATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQ 912
               L   N+ LS ++Q KL  IK   D+ ++ +QEF  EI LK R+N  L  ++   +++
Sbjct: 183  NDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQE 242

Query: 913  IERLTSKNLETPE-KKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNP 1089
                   N    E +KI+++L+D +++L +S  EC  LKS V+++IN          G  
Sbjct: 243  KSIQNEDNTSRAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFIN-------DVNGEY 295

Query: 1090 KKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSL 1269
                 +L+++L+K K  KD L+ QVE+F+ ELE K+P+IDS +++N  LE+EL  +TS +
Sbjct: 296  SSSSSLLKKELLKVKEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLV 355

Query: 1270 EETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSP----FT 1437
            +  + ER+  ++E  + ++K  +N+     L  QRSDLAHQ+Q+LLL +  ++      +
Sbjct: 356  DRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLS 415

Query: 1438 EKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXX 1617
            + E   ++++  N+    + DS  IIS+RLL F ++ ELQ++NM                
Sbjct: 416  KDETDFIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNM-----DILATVRHLAG 470

Query: 1618 EQEQQKTLRITDNN----KIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXX 1785
            + E+Q+ LR  D++    K +E AK   +DL+++  +LE K+    +ERD YKLL     
Sbjct: 471  QLEEQEKLRQADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKS 530

Query: 1786 XXXXXXXXXXXXXXXCELEKE---RLTNELSSMKQQHVKVLEELE-------NKIKTLQK 1935
                            +++K    +L NEL   ++   K +E+L        NK K L+ 
Sbjct: 531  PSSNKPSECN------DIDKHTTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEY 584

Query: 1936 SQLTSKME-VEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQ-DLAENELFEKNLITGG 2109
            S    KME  +++A    E+ +NN L+ +     EN+   LEQ D  +  L +K      
Sbjct: 585  SM--KKMESAKEYAEGKAELIENNLLMLQ-----ENRKSVLEQNDHLQQLLSQKEAKLAE 637

Query: 2110 VNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETS 2289
            +         + ++ + + +    + ++L+++++  + ++  +   KN L  K+ +LE S
Sbjct: 638  LTQDLHELTSQYNLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEIS 697

Query: 2290 LSE-RELPKNTQIKNEEK----EPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQF 2454
             +E + +    ++K  E+    +  +Q       K+ + + D ++     E L   Q  F
Sbjct: 698  RNECKGIQATVELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRA--EELNWYQKNF 755

Query: 2455 RTLRRELKEVQEDLDMKTESHLKLENK-------------YTKVKND---LKQATYKLAS 2586
             T  +   E+   +DMK E     ++              +T +  D    K  +  +  
Sbjct: 756  PT--QTETEIGLPVDMKKEGETGRQSNRDTLESQKSGSPGFTDLGTDSSVRKSTSLPVMQ 813

Query: 2587 VYTTLEQ----KNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIV 2754
            V  T E+    K        SQ+ G                E+L   + E    +     
Sbjct: 814  VGRTEEESKEAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQAIRA 873

Query: 2755 LLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEV 2934
              Q + ++    K++F   K SL+     I      + V + +   ++     +LEE   
Sbjct: 874  EYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEMKLEEERQ 933

Query: 2935 KMASFDGKVTE-------ILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRR 3093
            K    +  ++E       ++E   G     +    +   + H +++              
Sbjct: 934  KHEETNATLSEKELLCEKMIEEISGYREELSKSAEMQVDIQHTRELEDLLDLANKRIDDL 993

Query: 3094 ARYRNKNPREKFPSFVKIDQQSXXXXXXXXV-----MENTTKLLALEESNAKLIKEVENC 3258
                N    +   +    D Q+        V      +   K LA+ E   ++++  E C
Sbjct: 994  CTQNNLLHEQLNATLDLEDTQNKDDIKDIIVCMKRERDTLQKKLAIVEREGEVLR--ERC 1051

Query: 3259 TKVNETLSSQLADMQVKLEPL-------EQEINELK------------LKVAEKEQHLN- 3378
              +   L +     Q    PL       E+ ++ELK            L    + +H N 
Sbjct: 1052 AGLKSELDAVSKGQQWHNLPLSNLLTGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNC 1111

Query: 3379 ICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFD--- 3549
            I  +EL + +  S   LQ  K   E    +  ++I   ++++E  +    Q+  R D   
Sbjct: 1112 ILNDELSQVRKLSGP-LQDQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMVHRQDDTL 1170

Query: 3550 RLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEII 3729
             L+     ++D+ K +    T +  +L+E    L+K   ++++ N        ++  EI 
Sbjct: 1171 GLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIK 1230

Query: 3730 RLRAELE-----------------KSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAY 3858
                +LE                 K N    + ++K+   K FK     L   +  ++  
Sbjct: 1231 ASNLQLEEVMKEKDKKIREIELTLKENLEKFDKDEKLVSEKTFKENEAKLNKTITMLQKL 1290

Query: 3859 ENSTVNSKIIKDLKE-SFKREKDE-------------------LIEQMXXXXXXXXXXXX 3978
             N T+N +++   +E +  R+KD+                   LIE+             
Sbjct: 1291 -NETLNQEVVSLREEINVLRKKDDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGR 1349

Query: 3979 XTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKIN 4158
              +L+++  N+  N    +N+               L+RI EA+ENLK+ +RLPSEEKI 
Sbjct: 1350 NEVLSKQSENV-TNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQ 1408

Query: 4159 AVIEKRRKVLEQEFETKLRE---LGLNADGNGVVTD-----TRAQIEKELREKFNLELAE 4314
             +IEKRR  LE +F+ ++ E   L   AD   +  D      R ++E  + +    +L  
Sbjct: 1409 RIIEKRRAELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDLQAKLET 1468

Query: 4315 IKKKAFEEGKQQSMMKSTLLERKLSKLESQTL------SPTKNNDSNETQVXXXXXXXXX 4476
            I+ KAFEEGK+Q+ MK+TLLERKLSKLESQ        S  + + S  T++         
Sbjct: 1469 IRTKAFEEGKRQAEMKTTLLERKLSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYK 1528

Query: 4477 XXXXXXXGEKVLQLNYGANVVAETD--NDDNPFT 4572
                    E VL+L   A V +  D  ND NPFT
Sbjct: 1529 DNTGTRT-EAVLKLRPTAKVDSGKDVSNDSNPFT 1561

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 108/530 (20%), Positives = 208/530 (39%), Gaps = 46/530 (8%)
 Frame = +1

Query: 292  KLVSEKQKEFDSNDALNSEITLIKYDLEAMQ--RDHTTLEAR-------ERKTENVLEQS 444
            KL  E+QK  ++N  L+ +  L +  +E +   R+  +  A         R+ E++L+ +
Sbjct: 927  KLEEERQKHEETNATLSEKELLCEKMIEEISGYREELSKSAEMQVDIQHTRELEDLLDLA 986

Query: 445  KLELQDSLTENSALKEQIGVFEGKLDSMTQE-----LWLANTENKKLQTGMKLLRENNLY 609
               + D  T+N+ L EQ+       D+  ++     +     E   LQ  + ++      
Sbjct: 987  NKRIDDLCTQNNLLHEQLNATLDLEDTQNKDDIKDIIVCMKRERDTLQKKLAIVEREGEV 1046

Query: 610  LEIKCKETDKNKKLYSSAEDASRLQ-DQLQIVSSEILSLKSEIATLKYMNESLSTD---- 774
            L  +C          S  +    L    L     +IL    E+  L+  N SL T+    
Sbjct: 1047 LRERCAGLKSELDAVSKGQQWHNLPLSNLLTGHEKILDELKEVHLLRENNVSLLTEVNQL 1106

Query: 775  ------LQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSK- 933
                  L  +L +++ L   L   K    +    K +   L  +EI  +KK+ +++  + 
Sbjct: 1107 KHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMVHRQ 1166

Query: 934  ----NLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDK--YINIDEKKL-ISKFGNPK 1092
                 LE   K  I  L  L E+    +++ +E    + K  +  +D  K+ I    N  
Sbjct: 1167 DDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDL 1226

Query: 1093 KLIEILRRQLVKEKRHKDTLQRQVESFLVE------LEQKLPMIDSFKERNSSLERELLR 1254
              I+    QL +  + KD   R++E  L E       ++KL    +FKE  + L + +  
Sbjct: 1227 SEIKASNLQLEEVMKEKDKKIREIELTLKENLEKFDKDEKLVSEKTFKENEAKLNKTITM 1286

Query: 1255 ITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPF 1434
            +   L ET  +  +  RE  N              +LR++ D  +Q     L    K  F
Sbjct: 1287 L-QKLNETLNQEVVSLREEIN--------------VLRKKDDETNQ-----LISTMKLDF 1326

Query: 1435 TEKEATLVKKIVSNENTENDTDSHKIISKRLLHF------QNVKELQQKNMXXXXXXXXX 1596
              ++  L+++ V   N + ++  ++++SK+  +        NV +L+Q+           
Sbjct: 1327 EREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTNDNTGSNVDKLKQE--LRKDWEEQT 1384

Query: 1597 XXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHI-KTLESKINIIS 1743
                   ++  ++ +R+    KI    +    +LE    K +E K N+I+
Sbjct: 1385 LQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIA 1434

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 95/496 (19%), Positives = 209/496 (42%), Gaps = 85/496 (17%)
 Frame = +1

Query: 268  SGYLVAREKLVSEKQKEF---DSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLE 438
            S  L   EK++ E ++     ++N +L +E+  +K+D   +  D  +   + RK    L+
Sbjct: 1073 SNLLTGHEKILDELKEVHLLRENNVSLLTEVNQLKHD-NCILNDELS---QVRKLSGPLQ 1128

Query: 439  QSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNL---- 606
              K   +    E     ++I +++ +++   +  W      +    G++   +N +    
Sbjct: 1129 DQKNNTERYFKEKD---QEISLYKDEIERWKKR-WQQMVHRQDDTLGLEANFKNEIDSLK 1184

Query: 607  -YLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQR 783
              +E + KE +K  + +   +   +  ++L      I +L ++++ +K  N  L   ++ 
Sbjct: 1185 GLIEERTKEKEKLSEKFQLLK--KQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKE 1242

Query: 784  KLFRIKDLDDNLNSSKQEFAKE-------------------ITLKQRVNELLHNEIASYK 906
            K  +I++++  L  + ++F K+                   IT+ Q++NE L+ E+ S +
Sbjct: 1243 KDKKIREIELTLKENLEKFDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEVVSLR 1302

Query: 907  KQIERLTSKNLET-------------PEKKIIQELV-DLKEKLVNSEKEC----NELKST 1032
            ++I  L  K+ ET              + ++I+E V +L EK  +   E     +E  + 
Sbjct: 1303 EEINVLRKKDDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTN 1362

Query: 1033 VDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRH-----KDTLQRQVESFLVEL---- 1185
             +   N+D+ K   +    ++ ++ +       KRH     ++ +QR +E    EL    
Sbjct: 1363 DNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDF 1422

Query: 1186 ----EQKLPMI----------DSFKER---------NSSLERELLRI-TSSLEETAKERD 1293
                E+K  +I          D  K++            L+ +L  I T + EE  ++ +
Sbjct: 1423 DKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAE 1482

Query: 1294 IK----DRELTNLQKKISNNEQFNDELLRQRSDLAH-QVQYLLLCIDNKSPFTEKEATL- 1455
            +K    +R+L+ L+ +++ + +   ++ +  S L    V    L  DN    TE    L 
Sbjct: 1483 MKTTLLERKLSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLR 1542

Query: 1456 -VKKIVSNENTENDTD 1500
               K+ S ++  ND++
Sbjct: 1543 PTAKVDSGKDVSNDSN 1558

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 122/632 (19%), Positives = 242/632 (38%), Gaps = 43/632 (6%)
 Frame = +1

Query: 2107 GVNNLEQSKI-IEL-SVAEQKISFLDKEISNLKS-----------KNKNLEDKILTMTLS 2247
            G++++E S I  EL S  E  +  L KE  NLKS           K KNLED+I  +  +
Sbjct: 14   GISDIELSNINTELRSKLESSVDNLIKEKLNLKSTIEETESTYKNKIKNLEDEINILAKT 73

Query: 2248 KNLLDNKVLQLETSLSERELPKN-TQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYY 2424
            +++       +  +  E + P N T I N   E    Q    ER K E +     +    
Sbjct: 74   RDISG----PIRITGVEAQAPNNATSISNINDEILTLQR-ELERAKSEHLISQSEAERSL 128

Query: 2425 ENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLE 2604
            +  E ++   + L   L +  E+L  + +S LK+E K  ++ N L+     L      L 
Sbjct: 129  KQSELVREHNQWLEEHLVKTTEELMTQKQSILKMEEKDQEIDN-LRHEVSILKKNNDLLL 187

Query: 2605 QKNSFLANSVSQLQ---------------------GXXXXXXXXXXXXXXXTEKLQMAEN 2721
             KN  L+ +V +                       G                ++ +  +N
Sbjct: 188  GKNQELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKSIQN 247

Query: 2722 ENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEID 2901
            E++     +  +++ +++     KD+        S + + IN +  +     S    E+ 
Sbjct: 248  EDNTSRAESQKIMEQLIDTRKQLKDSRNECTRLKSYVNEFINDVNGEYSSSSSLLKKELL 307

Query: 2902 HANERLEEAEVKMASFDGKV---TEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXX 3072
               E+ +  E ++ +F  ++     +++S + K  +       V SL+    +       
Sbjct: 308  KVKEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEK 367

Query: 3073 XXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEV- 3249
                 +R    N    +   +  + D           + E  T    L +     I+ + 
Sbjct: 368  EFQSFKRKSEHNDGMIQTLTT-QRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLT 426

Query: 3250 ENCTKV-NETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTI 3426
            EN T   N    S +++  +K   +  E+ +  + +    +HL    EE E+ +      
Sbjct: 427  ENDTYARNNDSQSIISERLLKFADI-TELQKQNMDILATVRHLAGQLEEQEKLRQADHHT 485

Query: 3427 LQQGKIVEEEAHMKSL-EKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQI 3603
            +++  + E +  +  L E   +LE +LET R E            +  ++ L   K+   
Sbjct: 486  IERKTLEEAKKALLDLQEYTNSLERKLETFRKE------------RDVYKLLSKGKSPSS 533

Query: 3604 NLTTQINELNE-TKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELE 3780
            N  ++ N++++ T   L+  LQQ  E   +        +++I+  + ELE S        
Sbjct: 534  NKPSECNDIDKHTTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYS-------M 586

Query: 3781 KKVEDAKKF-KNEIESLKSELQSVKAYENSTV 3873
            KK+E AK++ + + E +++ L  ++    S +
Sbjct: 587  KKMESAKEYAEGKAELIENNLLMLQENRKSVL 618

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  325 bits (834), Expect = 9e-90
 Identities = 357/1533 (23%), Positives = 680/1533 (44%), Gaps = 103/1533 (6%)
 Frame = +1

Query: 133  DLMKENSFVSAAIDDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQ 312
            +L   N  + A +D++K +   K++++ ++                      E+L+ E  
Sbjct: 53   NLQSNNLRLHATVDELKALCTSKVDSLKKE---------------------TERLIREND 91

Query: 313  KEFDSNDALNSEITL--------------IKYDLEAMQRDHTTLEARERKTENVLEQ--- 441
             E    + L  +++               +K++L+        L++ +++   +LE+   
Sbjct: 92   TEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKIS 151

Query: 442  ----SKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLY 609
                SK+E Q+ + +N  L++Q+   + ++ ++        +E + ++  + +L ++N +
Sbjct: 152  ELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEW 211

Query: 610  LEIKCKETDKNKKLYS-SAEDASRLQDQLQIVS---SEILSLKSEIATLKYMNESLSTDL 777
            LE +   T K ++L     E+ + LQ  LQ V+   ++    KS    L   N+ +S DL
Sbjct: 212  LEKEV--TSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDL 269

Query: 778  QRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSK-------- 933
            Q KL+ IK L D LN+ KQEF++E++LKQ++ +L   ++ S+K+++ RLT +        
Sbjct: 270  QNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEEL-RLTEEKHNSTEAD 328

Query: 934  NLE-TPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGN---PKKL- 1098
            NL+ T + + + +L  ++++L  S  E   L++ V++ +   E+  +    N   PK   
Sbjct: 329  NLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMGDSEEFDLDSTANVSIPKLYG 388

Query: 1099 -IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEE 1275
             I +L++QL+KE+  K+ LQRQ+ESF+VELE K+P+I+S KER+ +LE+EL  I   LE 
Sbjct: 389  DIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEH 448

Query: 1276 TAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLL----LCIDNKSPFTEK 1443
            T+ E++ K REL +   KI   E     L+RQRSDLA QVQ+LL    L  D++ P T  
Sbjct: 449  TSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTAD 508

Query: 1444 EATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQ 1623
            E   +KKI+ NEN  N++DS  II++RL+ F+++  LQ++N                 E+
Sbjct: 509  EVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERN--TELLKTARTLADRLEEE 566

Query: 1624 EQQKTLRITD-NNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXX 1800
            E+   +RI     K ++ AK   + L++    +ESK++ I +ERD+YK ++         
Sbjct: 567  EKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDN 626

Query: 1801 XXXXXXXXXXCELEK--ERLTNELSSMKQQHVKVLEELENKIKTL--QKSQLTSKMEVEK 1968
                       E ++  + L ++LS++  +  K  E L  +I+ L   K+QLT   E E+
Sbjct: 627  LGDADRMKDSQENQELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKER 686

Query: 1969 HALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENE--LFEKNLITGGVNNLEQSKIIE 2142
             +    E  D   LL+  ++  +N+   L +   E +  L ++    G   N   S   +
Sbjct: 687  SSRTLAE--DRLKLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQSK 744

Query: 2143 LSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQ 2322
            LSV E + + LD E S L+S + +L  +I  +++ +N L+  V QL+T  SERE      
Sbjct: 745  LSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERNSLNLMVTQLQTLQSERENLLKES 804

Query: 2323 IKNEEKEPAKQQTYTFERKKLESVNDSDISY---LYYENLEELQNQFRTLRRELKEVQED 2493
              + +   A+ +  T E K   S  D++I           +  Q +   +  +  +++++
Sbjct: 805  QASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMSSDAGKIRDE 864

Query: 2494 LDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXX 2673
            L  KT +  +LE +   +K  ++++  ++AS  T  +  N     +  QL+         
Sbjct: 865  LATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNG--ETTQGQLRKDLEKTMIE 922

Query: 2674 XXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSI 2853
                    E+ +   +   E + N   L     E     K   + +     +L Q ++++
Sbjct: 923  LKHAYSQNEEFKQISSTAEETLKN---LSNEFEERTEALKSNAEKYLAEKVQLEQCVSNL 979

Query: 2854 QQQSLVIESNYNTEIDHANERLEEAEVKMASFDG---KVTEILESYDGKIL-------NT 3003
            ++    + + Y  + + + E   E   K+ S +     + ++ + YD K+          
Sbjct: 980  KKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQ 1039

Query: 3004 AAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXX 3183
             A  ++ +    E+               + R   ++ R +       +QQ+        
Sbjct: 1040 TAYANIAQKNYEEE---LQKHAEVSKIISQLRSEVQSGRSEIQQLKASEQQA------KE 1090

Query: 3184 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 3363
            V+EN  K  +      +L   +++  +  + +SSQ   +  ++E L +   E + K+   
Sbjct: 1091 VLENGEK--SWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPG 1148

Query: 3364 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 3543
               L I    L R +   +T L   K  E+  H K +     LE++L   R +  +L + 
Sbjct: 1149 SSELLI---SLRRERDILETKLTVSKREEKLLHQKQV----ALEDELAEARKKLFKLQEN 1201

Query: 3544 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEE 3723
                   A +  D  +  Q+N   Q+N L E+ V L  ++    EKN+   +       +
Sbjct: 1202 DSNHSDIAKQHEDIME--QLN---QMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSK 1256

Query: 3724 IIRLRAELEKSNNFSNELEKKV--------------------------EDAKKFKNEIES 3825
            I+ L +EL +      E ++++                          E+ +K + EI +
Sbjct: 1257 ILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISN 1316

Query: 3826 LKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKN 4005
            LK EL++ K+ EN+ +N +  +  K++ ++     I Q                L+   N
Sbjct: 1317 LKKELEA-KSKENTDLNDRFTRLKKQAHEKLNASKIAQAN--------------LSAEVN 1361

Query: 4006 NILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKV 4185
             +     +   I             L+ +R +E+  N   R       +++  +E+ +++
Sbjct: 1362 ELQGTKTKMEEILKETQTKVLNLEKLLTERDSESANNEDLR------HELDDALERCKEI 1415

Query: 4186 LEQEFETKLRELGLNADGNGVVTDTRAQIE--KELREKFNLE-------LAEIKKKAFEE 4338
              +  ET     GL +  N  +   + Q+   KE      LE       + E  KKAFEE
Sbjct: 1416 EVKLGETVGSSEGLTSQLNEEINSLKEQVRIFKEKENDSTLEGSQGLSNVVESMKKAFEE 1475

Query: 4339 GKQQSMMKST-----LLERKLSKLESQTLSPTK 4422
             K + + + T       E + +KL S+  SP +
Sbjct: 1476 EKIKFIQEKTEEYNKKFEEEKAKLSSENGSPAE 1508

 Score =  296 bits (758), Expect = 2e-80
 Identities = 364/1534 (23%), Positives = 662/1534 (43%), Gaps = 109/1534 (7%)
 Frame = +1

Query: 298  VSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEA------RERKTENVLEQSKLELQ 459
            +S KQK  D  D    ++   K +L   +  H + EA      ++ +  + L Q + +L+
Sbjct: 294  MSLKQKLLDLQD---EQLQSFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLE 350

Query: 460  DSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDK 639
            +S  E   L+  +    G     ++E  L +T N  +    KL  +  +  +   KE  +
Sbjct: 351  ESNHERLRLQAVVNEVMGD----SEEFDLDSTANVSIP---KLYGDIGVLKKQLIKERHQ 403

Query: 640  NKKLYSSAED-ASRLQDQLQIVSS---EILSLKSEIATLKYMNESLSTDLQRKLF----- 792
             + L    E     L+ ++ +++S      +L+ E++ +  + E  S + +RK       
Sbjct: 404  KENLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESA 463

Query: 793  --RIKDLDDNLNS---SKQEFAKEITL--------KQRVNELLHNEIASYKKQIERLTSK 933
              +IK L+ N ++    + + A+++                L  +E+A  KK IE     
Sbjct: 464  TGKIKQLEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPS 523

Query: 934  NLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILR 1113
            N    +  I + LV+ K+     E+    LK+       ++E++      N    I+ L 
Sbjct: 524  NESDSQSIITERLVEFKDIATLQERNTELLKTARTLADRLEEEEK-----NSNIRIDSLE 578

Query: 1114 RQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERD 1293
            R+ + E +      ++  S   E+E K+  I+  ++   ++  +  +   +L +  + +D
Sbjct: 579  RKTIDEAKEAIITLQERNS---EIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKD 635

Query: 1294 IKDRE--LTNLQKKISN---NEQFNDELLRQRSDLAHQVQYLLLCIDNKS----PFTEKE 1446
             ++ +  + +L+ K+S        N+ELL Q     +Q +  L     K        E  
Sbjct: 636  SQENQELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDR 695

Query: 1447 ATLVK---KIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXX 1617
              L++   ++  NEN E    SH++ S  +L  Q  +  +  N                 
Sbjct: 696  LKLLQSTLEMTKNENAELIRRSHELQS--ILSKQEARNGETVN----------------- 736

Query: 1618 EQEQQKTLRITDNNKIVESAKSTSVDLEKHI-----KTLESKINIISQERDSYKLLVXXX 1782
                 K +       ++E A++ ++D EK +      +L  +I  IS ER+S  L+V   
Sbjct: 737  -----KYISCQSKLSVLE-ARAANLDAEKSLLQSSSDSLRREIQKISVERNSLNLMVTQL 790

Query: 1783 XXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEV 1962
                              L+ ER  N L   +  H   + +LE +   L K++++SK   
Sbjct: 791  QT----------------LQSER-ENLLKESQASHKAAIAQLEVQTSEL-KTEISSKDNE 832

Query: 1963 EKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIE 2142
             K   + D  +      +E +D++ +    +  +LA          T  V  LE    +E
Sbjct: 833  IK--ASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATK--------TATVAQLE----LE 878

Query: 2143 LSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQ 2322
            ++  ++KI   D  I++ K+ N     +     L K+L +  +++L+ + S+ E  K  Q
Sbjct: 879  VNDLKKKIEESDSRIASYKTLNDAGNGETTQGQLRKDL-EKTMIELKHAYSQNEEFK--Q 935

Query: 2323 IKNEEKEPAKQQTYTFERKKLESVNDSDISYL------------YYENLEELQNQFRTLR 2466
            I +  +E  K  +  FE ++ E++  +   YL              +N++ L N++   +
Sbjct: 936  ISSTAEETLKNLSNEFE-ERTEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQK 994

Query: 2467 RELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLA------SVYTTLEQKN----- 2613
               +E + ++  K  S    E+   +VK +  Q  Y+L       + Y  + QKN     
Sbjct: 995  NRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEEL 1054

Query: 2614 ---SFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENT 2784
               + ++  +SQL+                 ++L+ +E +  E + N     +       
Sbjct: 1055 QKHAEVSKIISQLRSEVQSGRSEI-------QQLKASEQQAKEVLENG----EKSWYNQK 1103

Query: 2785 TFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVT 2964
            T  DA       +  L++ +++I  Q+ ++ S    E+   +ER  E E K+     ++ 
Sbjct: 1104 TELDAH------IDDLKRQVDNISSQNKLLFSQ--VELLSKSER--EFENKLLPGSSELL 1153

Query: 2965 EILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVK 3144
              L      +     +      L+H+K++              AR +    +E   +   
Sbjct: 1154 ISLRRERDILETKLTVSKREEKLLHQKQVALEDELA------EARKKLFKLQENDSNHSD 1207

Query: 3145 IDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLE 3324
            I +Q         +ME   ++  L ESN  L   V    + N  L S+L  +Q K+ PL 
Sbjct: 1208 IAKQHED------IMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLN 1261

Query: 3325 QEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQL 3504
             E++E +  + EK+Q + +  +E +RWK RS  IL++ + ++ E + K  E+I  L+++L
Sbjct: 1262 SELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKEL 1321

Query: 3505 ETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQ----- 3669
            E    EN  L DRF RLKKQAHEKL+A+K  Q NL+ ++NEL  TK  +E+ L++     
Sbjct: 1322 EAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKV 1381

Query: 3670 -EIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVED--------AKKFKNEIE 3822
              +EK     +  +  +E+   LR EL+ +     E+E K+ +          +   EI 
Sbjct: 1382 LNLEKLLTERDSESANNED---LRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEIN 1438

Query: 3823 SLKSELQSVKAYEN-STVN-----SKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXT 3984
            SLK +++  K  EN ST+      S +++ +K++F+ EK + I++               
Sbjct: 1439 SLKEQVRIFKEKENDSTLEGSQGLSNVVESMKKAFEEEKIKFIQEKTEEYNKKFEEEKAK 1498

Query: 3985 ILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAV 4164
            + ++  N   A    + ++            A+  +RI EAEENLKKR+R+P+EE+I  V
Sbjct: 1499 LSSE--NGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKV 1556

Query: 4165 IEKRRKVLEQEFETKLRELGLNADGNGVV--TDTRAQIEKELREKFNLELAEIKKKAFEE 4338
            ++KR+  LE+EF+ +L+E  L  +G       + + Q+E E   K+   LA  KKKAFEE
Sbjct: 1557 LDKRKTELEEEFQRRLKENNLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEE 1616

Query: 4339 GKQQSMMKSTLLERKLSKLESQTLS----------------PTKNNDSNETQVXXXXXXX 4470
            GKQQ+ MKSTLLERK+SKLESQ  S                PTK ++S    +       
Sbjct: 1617 GKQQAAMKSTLLERKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENM------- 1669

Query: 4471 XXXXXXXXXGEKVLQLNYGANVVAETDNDDNPFT 4572
                     GEKVL+L+       +  +  NPFT
Sbjct: 1670 --ATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFT 1701

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 207/1029 (20%), Positives = 406/1029 (39%), Gaps = 95/1029 (9%)
 Frame = +1

Query: 1861 ELSSMKQQHVKVLEELENKIKTLQKSQLTS-KMEVEKHALNFDEMKDNNNLLKEYVDKLE 2037
            E ++++  +++ L    +++K L  S++ S K E E+     D  K   N L+E V +L 
Sbjct: 50   EFNNLQSNNLR-LHATVDELKALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQL- 107

Query: 2038 NKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDK---EISNLKSKN 2208
             K KTL     EN  FE        N L+ +K   + + E+KIS L+    E   L + N
Sbjct: 108  TKEKTLALGQMENVKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDN 167

Query: 2209 KNLEDKIL-----TMTLSKNLLDNK----VLQLETSL---SERELPKNTQIKNEEKEPAK 2352
            KNL  +++       TL  N L +K    +++ +  +   S   L K    K E+    +
Sbjct: 168  KNLRQQLMETQNEVQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYR 227

Query: 2353 QQTYTFERKKLESV----ND-----SDISYLYYENLEELQNQFRTLRRELKEVQEDLDMK 2505
            Q+  T  +K L+ V    ND     S   +L  +N +E+    +    E+K++ ++L+ +
Sbjct: 228  QENDTELQKSLQEVARLKNDYQLEKSSREFLLKKN-QEISQDLQNKLYEIKKLSDELNTE 286

Query: 2506 TES---HLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXX 2676
             +     + L+ K   ++++  Q+  +   +  T E+ NS  A+++   Q          
Sbjct: 287  KQEFSREMSLKQKLLDLQDEQLQSFKE--ELRLTEEKHNSTEADNLQSTQ--------QA 336

Query: 2677 XXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQ 2856
                   +  Q  E  N E++    V+ + M +      D+  +   S+ +L   I  ++
Sbjct: 337  RFMDDLAQVRQQLEESNHERLRLQAVVNEVMGDSEEFDLDSTANV--SIPKLYGDIGVLK 394

Query: 2857 QQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLI 3036
            +Q  +I+  +  E  +   ++E   V++      +  + E         + I  L+    
Sbjct: 395  KQ--LIKERHQKE--NLQRQIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTS 450

Query: 3037 HEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTT----- 3201
            HEK+             ++             +   I Q+S        ++ N T     
Sbjct: 451  HEKERKTRELESATGKIKQLEIN---------THTLIRQRSDLARQVQFLLFNGTLQNDS 501

Query: 3202 --KLLALEESNAKLIKEVENCTKVNETLS---------SQLADMQVKLEPLEQEINELKL 3348
               L A E +  K I E EN +  +++ S           +A +Q +   L +    L  
Sbjct: 502  RGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERNTELLKTARTLAD 561

Query: 3349 KVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENA 3528
            ++ E+E++ NI  + LER  +      ++  I  +E + +   K+ T+E++ +  +   +
Sbjct: 562  RLEEEEKNSNIRIDSLERKTIDEA---KEAIITLQERNSEIESKVSTIEKERDAYKAILS 618

Query: 3529 QLTDRFDRL-----KKQAHEKLDAAKTMQINLTTQINE-------LNETKVNLEKSLQQE 3672
            Q +  FD L      K + E  +  K+++  L+T   E       LN+   NL +S  Q 
Sbjct: 619  QTSQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQL 678

Query: 3673 IEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIE---------- 3822
               + +  +      + +  L++ LE + N + EL ++  + +   ++ E          
Sbjct: 679  TISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSKQEARNGETVNKY 738

Query: 3823 -SLKSELQSVKA-YENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQ 3996
             S +S+L  ++A   N      +++   +S +RE  ++   +             T+ ++
Sbjct: 739  ISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKI--SVERNSLNLMVTQLQTLQSE 796

Query: 3997 RKNNILANGQES--ANIXXXXXXXXXXXXALILK-RITEAEENLKKRMRLPSEEKINAVI 4167
            R+ N+L   Q S  A I             +  K    +A E+ K+      +EKI+ + 
Sbjct: 797  RE-NLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMS 855

Query: 4168 EKRRKVLEQ---------EFETKLREL---------------GLNADGNGVVTDTRAQIE 4275
                K+ ++         + E ++ +L                LN  GNG    T+ Q+ 
Sbjct: 856  SDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNG--ETTQGQLR 913

Query: 4276 KELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVXX 4455
            K+L EK  +EL    K A+ + ++   + ST  E  L  L ++    T+   SN  +   
Sbjct: 914  KDL-EKTMIEL----KHAYSQNEEFKQISST-AEETLKNLSNEFEERTEALKSNAEK--- 964

Query: 4456 XXXXXXXXXXXXXXGEKVLQLNYGANVVAETDNDDNPFTLQSGKDETLLTKRSADNEIIQ 4635
                           EKV      +N+    D  +N + LQ  + E         NEI++
Sbjct: 965  ------------YLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSE------EEKNEILK 1006

Query: 4636 DIIKRPKEE 4662
             ++     E
Sbjct: 1007 KLVSLESSE 1015

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  316 bits (810), Expect = 8e-87
 Identities = 350/1553 (22%), Positives = 672/1553 (43%), Gaps = 89/1553 (5%)
 Frame = +1

Query: 1    MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAY---DLMKENSFVSAAI 171
            M +    E +   ++ I+SFF       +S D   ++ +  K     +L  EN  V+ + 
Sbjct: 8    MESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSF 67

Query: 172  DDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEI 351
            D++K     KI+ +  +               +   V  E + +EK K       L+SE+
Sbjct: 68   DELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMK-------LSSEL 120

Query: 352  TLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSA-------LKEQIGVFE 510
              +K  L+ +  +    ++ +++T  +L++   E++    EN+        L+  I   E
Sbjct: 121  EFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLE 180

Query: 511  GKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRL--Q 684
             K          + TE ++    + LL+ NN +LE + +  ++    Y    D   L  +
Sbjct: 181  TKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR 240

Query: 685  DQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQ 864
            ++L  + ++    ++    LK  N  LS  LQ KL  IK L D+LNS KQEF+ E++LKQ
Sbjct: 241  NELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQ 300

Query: 865  RVNELLHNEIASYKKQIERLTSKNL----------ETPEKK-IIQELVDLKEKLVNSEKE 1011
            R+ +LL +++ + K+++  +   N           +TPE + +++EL   KEKL   EKE
Sbjct: 301  RLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKE 360

Query: 1012 CNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQ 1191
            C  L S  D+  + D + L +K  +       L++QL+KE+R K+ LQ Q+E+F+VELE 
Sbjct: 361  CLRLSSITDE-ADEDNENLSAKSSSD---FIFLKKQLIKERRTKEHLQNQIETFIVELEH 416

Query: 1192 KLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQ 1371
            K+P+I+SFKER   LE EL      LE T+ E++ K +EL    +K+   E     L +Q
Sbjct: 417  KVPIINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQ 476

Query: 1372 RSDLAHQVQYLLL----CIDNKSPFTEKEATLVKKIV-SNENTENDTDSHKIISKRLLHF 1536
            R DL  Q+QYLL+      D+K P  ++E   ++ I+  +++T  ++DS K++++RL+ F
Sbjct: 477  RLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEF 536

Query: 1537 QNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKT 1716
            +N+ +LQ+KN                 E++ +++L+  + ++ V  AK   + L+     
Sbjct: 537  KNIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIE-SETVNEAKEAIITLKSEKMD 595

Query: 1717 LESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEK--ERLTNELSSMKQQHV 1890
            LES+I  + +E +  K  V                    +LE   + L   +S + ++  
Sbjct: 596  LESRIEELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITREST 655

Query: 1891 KVLEELENKIKTL--QKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVD--KLENKIKTLE 2058
            + +  L  +I+ L   KS ++ K+  EK +    E  +   LL   +D  K EN      
Sbjct: 656  ENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAE--ERFKLLSNTLDLTKAENDQLRKR 713

Query: 2059 QDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTM 2238
             D  +N + +++  T    N   S   +LS+ E ++  L +E        KNL+ ++  +
Sbjct: 714  FDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKL 773

Query: 2239 TLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYL 2418
            +  K+ L   V QL+T   ERE       K+ +K+  + +    E KK  S  D  I  L
Sbjct: 774  SPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQL 833

Query: 2419 YYE---NLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKL--- 2580
              +   N+E  QN+   L+++ + V   +D K     KL+ K   ++ ++++   +L   
Sbjct: 834  EEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTY 893

Query: 2581 ---------ASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSE 2733
                      S+   LE+    L ++ SQ++                ++ LQ   ++  E
Sbjct: 894  NVMDETINDDSLRKELEKSKINLTDAYSQIK-------EYKDLYETTSQSLQQTNSKLDE 946

Query: 2734 KINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANE 2913
               +    ++ + +E T+ +D     K  +  L   ++  ++     ++++   I     
Sbjct: 947  SFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQN 1006

Query: 2914 RLEEAEVKMASFDGKVTEILESYDGKIL--NTAAIGHLVRSLIHEKKMXXXXXXXXXXXX 3087
              +E E   + ++ K+++I    D + +  NTA   +      H                
Sbjct: 1007 NNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHT 1066

Query: 3088 RRARYRNKN-PREKFPSFVKIDQQSXXXXXXXXVME---NTTKLLALEESNAKLIKEVEN 3255
             + + +  N  R++  + +K +++S        + +   + +++  L   N  L  +++ 
Sbjct: 1067 YKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQI 1126

Query: 3256 CTKV-----NETLSSQLADMQVKLEPLEQEINELKLKVAEKE-----QHLNICQEELE-- 3399
             T       N T    L ++ + L   E++I + K+ VAE++     Q +++   EL+  
Sbjct: 1127 YTAADKEVNNSTNGPGLNNILITLR-RERDILDTKVTVAERDAKMLRQKISLMDVELQDA 1185

Query: 3400 RWKL--------RSQTILQQGKIVEEEAHMKSL--EKIKTLEEQLETVRTENAQLTDRFD 3549
            R KL           +I+QQ   + E+ +  +L  E   TL  +LE    +  +L    D
Sbjct: 1186 RTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELD 1245

Query: 3550 RLKKQA---HEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESE 3720
            +LK+       +L A K        ++    E     +K  Q  +EK+ Q  +   ++ E
Sbjct: 1246 KLKQNVAPIESELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLE 1305

Query: 3721 -EIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDL 3897
             EI  L+ ELE       E E+K    +  +   E LK+   S  +      + +  K++
Sbjct: 1306 SEIENLKEELENKERQGAEAEEKFNRLR--RQAQERLKTSKLSQDSLTEQVNSLRDAKNV 1363

Query: 3898 KESFKREKDELIEQMXXXXXXXXXXXXXTIL-----AQRKNNILANGQESANIXXXXXXX 4062
             E+   E +  IE++              I      A++ +  L    E +         
Sbjct: 1364 LENSLSEANARIEELQNAKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTIN 1423

Query: 4063 XXXXXALILKRITEAEENLKKRMRLPS---EEKINAVIEKRRKVLEQEFETKLRELGLNA 4233
                    LK   E +  ++++++  S   +  ++ ++E  +K  E++      ++    
Sbjct: 1424 GLNEEITTLKEEIEKQRQIQQQLQATSANEQNDLSNIVESMKKSFEED------KIKFIK 1477

Query: 4234 DGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSK 4392
            +    V +   + ++ L +  N+ + EIKKK   E +Q+   K    E  L K
Sbjct: 1478 EKTQEVNEKILEAQERLNQPSNINMEEIKKKWESEHEQEVSQKIREAEEALKK 1530

 Score =  283 bits (725), Expect = 2e-76
 Identities = 363/1499 (24%), Positives = 640/1499 (42%), Gaps = 119/1499 (7%)
 Frame = +1

Query: 289  EKLVSEKQKEFDSNDALNSEIT-LIKYDLEAMQRDHTTLEARERKTENVL----EQSKLE 453
            + L SEKQ EF +  +L   +  L++  L A++ +  ++  RE  T  V+    ++   E
Sbjct: 283  DSLNSEKQ-EFSAEMSLKQRLVDLLESQLNAVKEELNSI--RELNTAKVIADDSKKQTPE 339

Query: 454  LQDSLTENSALKEQIGVFEG---KLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKC 624
             +D L E    KE++   E    +L S+T E   A+ +N+ L       + ++ ++ +K 
Sbjct: 340  NEDLLKELQLTKEKLAQCEKECLRLSSITDE---ADEDNENLSA-----KSSSDFIFLK- 390

Query: 625  KETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKD 804
                  K+L         LQ+Q++    E+      I + K   + L  +L      ++ 
Sbjct: 391  ------KQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMLENELNNAALLLEH 444

Query: 805  LDDNLNSSKQEF-AKEITLKQRVNEL--LHNEIASYKKQIERLTSKNLETPE------KK 957
              +  N+  +E  AK   L +  N+L  L  +     +QI+ L   N  + +      K+
Sbjct: 445  TSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKE 504

Query: 958  IIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQL----V 1125
             IQ + ++ ++  ++  E +  K   ++ +    K +I       +L++++R        
Sbjct: 505  EIQFIQNIMQEDDSTITESDSQKVVTERLVEF--KNIIQLQEKNAELLKVVRNLADKLES 562

Query: 1126 KEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDR 1305
            KEK+ K +LQ+      +E E     ++  KE   +L+ E + + S +EE  KE +    
Sbjct: 563  KEKKSKQSLQK------IESET----VNEAKEAIITLKSEKMDLESRIEELQKELEELKT 612

Query: 1306 ELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKS-PFTEKEATLVKKIVSNEN 1482
             + N     SN      +L   + DL  QVQ L   I   +   TE  + L K+I    +
Sbjct: 613  SVPNEDASYSNVTI--KQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQDLYD 670

Query: 1483 TENDTDSH--KIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDN 1656
            +++D      K  S R+L  +  K L                     E +Q +       
Sbjct: 671  SKSDISIKLGKEKSSRILAEERFKLLSNT------------LDLTKAENDQLRKRFDYLQ 718

Query: 1657 NKIVESAKSTSVDLEKHIKTLESKINIISQE----RDSYKLLVXXXXXXXXXXXXXXXXX 1824
            N I++    T   L +++ + +SK++I+  E    ++  KL V                 
Sbjct: 719  NTILKQDSKTHETLNEYV-SCKSKLSIVETELLNLKEEQKLRV----------------- 760

Query: 1825 XXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALN-FDEMKDN 2001
                LEK  L  EL+ +  +    L  +  +++TLQK +     E  K      DE++D 
Sbjct: 761  ---HLEKN-LKQELNKLSPEKDS-LRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDA 815

Query: 2002 NNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQ------SKIIELSVAEQK 2163
             + LK+   + ++ IK LE+D   N  + +N I     + E       SK  ++   + K
Sbjct: 816  LSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYK 875

Query: 2164 ISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKN----TQIKN 2331
            +  L+KEI          EDKI   T   N++D  +   + SL  +EL K+    T   +
Sbjct: 876  VKSLEKEIE---------EDKIRLHTY--NVMDETIN--DDSL-RKELEKSKINLTDAYS 921

Query: 2332 EEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTE 2511
            + KE   +  Y    + L+  N         E+ ++  NQ + L  E   +++ + +  E
Sbjct: 922  QIKE--YKDLYETTSQSLQQTNSK-----LDESFKDFTNQIKNLTDEKTSLEDKISLLKE 974

Query: 2512 SHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXX 2691
                L N+    K  +++         + L+  N  +    S+ +               
Sbjct: 975  QMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTI 1034

Query: 2692 XTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLV 2871
                 Q    +  +K  +    +  + E+  T+K   K    S  +L  A+   ++    
Sbjct: 1035 YANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSS 1094

Query: 2872 IESNYNTEIDHANERLEEAEVK-------MASFDGKVTEILESYDGKILNTAAIG-HLVR 3027
             + +   ++D +N R+E+   +       +  +     E+  S +G  LN   I     R
Sbjct: 1095 QKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNGPGLNNILITLRRER 1154

Query: 3028 SLIHEK--------KMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXX 3183
             ++  K        KM            + AR +  N R +  +   I QQ         
Sbjct: 1155 DILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQHDD------ 1208

Query: 3184 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 3363
            +ME   +L  L ESN  L  E+EN     + L S+L  ++  + P+E E+  LK  + EK
Sbjct: 1209 IMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTALKYSMQEK 1268

Query: 3364 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 3543
            EQ L + +EE+ RWK RSQ IL++ + +    + K   +I+ L+E+LE    + A+  ++
Sbjct: 1269 EQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKERQGAEAEEK 1328

Query: 3544 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNG-AADESE 3720
            F+RL++QA E+L  +K  Q +LT Q+N L + K  LE SL +   +  +  N   A  + 
Sbjct: 1329 FNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVAQGNN 1388

Query: 3721 EIIRLRAELEKSNNFSNELEKKVEDAKK---------------FKNEIES---LKSELQS 3846
            ++  +R   E +   S EL+ K+E++                  K EIE    ++ +LQ+
Sbjct: 1389 QLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQRQIQQQLQA 1448

Query: 3847 VKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQ 4026
              A E + + S I++ +K+SF+ +K + I++               + AQ + N  +N  
Sbjct: 1449 TSANEQNDL-SNIVESMKKSFEEDKIKFIKEKTQEVNEKI------LEAQERLNQPSN-- 1499

Query: 4027 ESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFET 4206
               N+              + ++I EAEE LKKR+RLP+EEKIN +IE++++ LE+EFE 
Sbjct: 1500 --INMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEE 1557

Query: 4207 KLRELGLNADGNGVVT-------------------------------------------- 4254
            K+ E   + + +G +                                             
Sbjct: 1558 KVEERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDER 1617

Query: 4255 -DTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNN 4428
               RA+IE  LRE+FN EL  IKKK+F+EGKQQ+MMK+TLLERKL+K+ESQ LS TK +
Sbjct: 1618 DKLRAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQ-LSETKQS 1675

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 117/499 (23%), Positives = 207/499 (41%), Gaps = 86/499 (17%)
 Frame = +1

Query: 286  REKLVSEKQKEFDSND--ALNSEITLIKYDLEAMQRDHTTLEAR----ERKTENVLEQSK 447
            R + + EK ++  S+D   L SEI  +K +LE  +R     E +     R+ +  L+ SK
Sbjct: 1285 RSQDILEKHEQLSSSDYEKLESEIENLKEELENKERQGAEAEEKFNRLRRQAQERLKTSK 1344

Query: 448  LELQDSLTEN-SALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKC 624
            L  QDSLTE  ++L++   V E  L         AN   ++LQ   K+ + NN    I+ 
Sbjct: 1345 LS-QDSLTEQVNSLRDAKNVLENSLSE-------ANARIEELQNA-KVAQGNNQLEAIRK 1395

Query: 625  KETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNE----------SLSTD 774
             + D  K   +S E  ++L++      S I  L  EI TLK   E          + S +
Sbjct: 1396 LQEDAEK---ASRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQRQIQQQLQATSAN 1452

Query: 775  LQRKLFRI-KDLDDNLNSSKQEFAKEITLKQRVNELL----------------------- 882
             Q  L  I + +  +    K +F KE T  Q VNE +                       
Sbjct: 1453 EQNDLSNIVESMKKSFEEDKIKFIKEKT--QEVNEKILEAQERLNQPSNINMEEIKKKWE 1510

Query: 883  ---HNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKE--CNELKSTVDKYI 1047
                 E++   ++ E    K +  P ++ I ++++ K++ +  E E    E   ++++  
Sbjct: 1511 SEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEERIKSMEQSG 1570

Query: 1048 NID---EKKLISKFGNPKKLIEILRRQLVKEKR------------HKDTLQRQVESFL-V 1179
             ID    K+L +K    +K +E    + ++E+              +D L+ ++ES L  
Sbjct: 1571 EIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLRE 1630

Query: 1180 ELEQKLPMID--SFKE-------RNSSLERELLRITSSLEETAKERDIKDRELTNLQKKI 1332
            E   +L  I   SF E       + + LER+L ++ S L ET +  +   + + N+Q  +
Sbjct: 1631 EFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESPPKSVNNVQNPL 1690

Query: 1333 ---------SNNEQFNDELLRQRSDLAHQVQYLLLCIDNKS------PFTEKEATLVKKI 1467
                     ++N  FN  L  ++          LL +++KS      PFT          
Sbjct: 1691 LGLPRKIEENSNSPFNPLLSGEK----------LLKLNSKSSSGGFNPFTSPS------- 1733

Query: 1468 VSNENTENDTDSHKIISKR 1524
              N++ +ND D  + ++ +
Sbjct: 1734 -PNKHLQNDNDKRESLANK 1751

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  305 bits (782), Expect = 2e-83
 Identities = 355/1556 (22%), Positives = 667/1556 (42%), Gaps = 87/1556 (5%)
 Frame = +1

Query: 1    MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAY---DLMKENSFVSAAI 171
            M +   +E T   ++ I+SFFD      +S+D   +  +  K     +L  EN  ++  +
Sbjct: 8    MRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTL 67

Query: 172  DDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEI 351
            D++K     KIN++  +               +      E +  EK         L++E+
Sbjct: 68   DELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTH-------LSNEL 120

Query: 352  TLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQ-------DSLTENSALKEQIGVFE 510
              IK  L  +  +   +++ +++T  +L++   EL+        S +E   L+  I   E
Sbjct: 121  ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180

Query: 511  GKLDSMTQELWLANTENKKLQTG-----MKLLRENNLYLEIKCKETDKNKKLYSSAEDA- 672
             K     Q+ +++N  N K Q       + LL+ N  +LE +    ++    Y    +  
Sbjct: 181  TK-----QQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTI 235

Query: 673  -SRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKE 849
             S +++ L  + ++    K+    L+  N  LS DLQ KL +IK L D+ NS K++F+ E
Sbjct: 236  ISEIRNDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAE 295

Query: 850  ITLKQRVNELLHNEIASYKKQIERL-----------TSKNLETPEKKIIQELVDLKEKLV 996
            ITLKQR+ +LL +++ + K+++               SK L +  +K++++L   K KLV
Sbjct: 296  ITLKQRLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLV 355

Query: 997  NSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFL 1176
              E EC  L S++ +    ++  L SK         +L++QL+KEKR K+ LQ Q+ESF+
Sbjct: 356  QCENECLRL-SSITEEAGKEDGILTSKSNGD---FILLKKQLIKEKRAKEHLQNQIESFI 411

Query: 1177 VELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFND 1356
            VELE K+P+I+SFKER  +LE EL      LE T+ E++ K +EL    +K++  +    
Sbjct: 412  VELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIH 471

Query: 1357 ELLRQRSDLAHQVQYLL----LCIDNKSPFTEKEATLVKKIVSNENT-ENDTDSHKIISK 1521
             L +QR DL  Q+QYLL    +  D+K P  ++E   ++ I+ N+++   ++DS KI+++
Sbjct: 472  ILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTE 531

Query: 1522 RLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLE 1701
            RL+ F+++ +LQ+KN                 E + +  L+  +N  I E AK   + L+
Sbjct: 532  RLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINE-AKEAILTLQ 590

Query: 1702 KHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKER--LTNELSSM 1875
                 LESKI+ + +ER+ +K                       ELE +   L   +S +
Sbjct: 591  SQKVQLESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQV 650

Query: 1876 KQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTL 2055
             ++  + +  L  +++ L  S+ +  +E+ +        K +  L +E    L N   TL
Sbjct: 651  TRESTENMSLLNKELQDLYDSKSSLSIELGRE-------KSSRILAEERFKLLSN---TL 700

Query: 2056 EQDLAENELFEKNLIT-----GGVNNLEQSKIIELSVAEQKISFLDKEISNLKSK----- 2205
            +   AEN+   K  I         ++  Q  + +    + K+S ++ E+SNLK +     
Sbjct: 701  DLAKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKI 760

Query: 2206 --NKNLEDKILTMTLSKNLLDNKVLQLETSLSER-----ELPKNTQIKNEEKEPAKQQTY 2364
               KNL+ ++  ++  K  L   V QL+T   ER     E  K+ Q K +  + A+ +  
Sbjct: 761  ELEKNLKQELSELSSEKTSLHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELK 820

Query: 2365 TFERKK------LESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKL 2526
            T   +K      LE  NDS I + Y   +E L+    ++   L E Q +++        L
Sbjct: 821  TEAIRKDQYIKQLEEDNDSKIEW-YQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSL 879

Query: 2527 ENKYTKVKNDLKQATYKLA-------SVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXX 2685
            E +    +N ++  TY +        S+   LE+    L ++ SQ+Q             
Sbjct: 880  EKEIE--ENKIRLHTYNVLDESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSL 937

Query: 2686 XXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQS 2865
               + +L    +E+++  +N I   Q + +E T+ +D     +  +S L   ++   Q  
Sbjct: 938  QEMSSQL----DESNKAFSNQI---QNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAM 990

Query: 2866 LVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKIL--NTAAIGHLVRSLIH 3039
               ++ +  +I       +E E     ++ K+++I +  D + +  NTA   +      H
Sbjct: 991  EKEKAEFKKKISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKH 1050

Query: 3040 EKKMXXXXXXXXXXXXRRARYRNKN-PREKFPSFVKIDQQSXXXXXXXXVME---NTTKL 3207
                             + +    N  R +F   +K ++ +        + +   + +++
Sbjct: 1051 ADVSKTISELREQLHTYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRI 1110

Query: 3208 LALEESNAKLIKEVENCT----KVNETLSSQLADMQVKLE-PLEQEINELKLKVAEKE-- 3366
              L   N  L  ++E  T    K  +  S  + +  + +    E++I + K+ VAE++  
Sbjct: 1111 EDLSSQNKLLYDQIELYTTTGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAK 1170

Query: 3367 ---QHLNICQEELE--RWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQ 3531
               Q +++   EL+  R KL +  +  + +    + H + +EK+     QL  +R  N  
Sbjct: 1171 MLRQKISLIDVELQEARTKLCNSKVENEKRSFIIQQHDEVMEKL----NQLNLLRESNTT 1226

Query: 3532 LTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAAD 3711
            L +  D    +  E     + ++ N+    +EL   K ++++  +QEI    +  +    
Sbjct: 1227 LRNELDSSNSKNKELQSELERLRGNIAPIESELAALKFSIQEK-EQEIRLTKEEVHRWKK 1285

Query: 3712 ESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIK 3891
             S++I+    +L  +            D +K + EIESLK++L+  K  + +    K  +
Sbjct: 1286 RSQDIMEKHQQLSST------------DYEKLETEIESLKAQLED-KTQQGADSEEKFNR 1332

Query: 3892 DLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXX 4071
              +++ ++ K   + Q                L +  NN  A  QE  +           
Sbjct: 1333 LRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELED----------- 1381

Query: 4072 XXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVV 4251
                   ++ E    L    +L  + + N+          +E ETKL E  ++ D     
Sbjct: 1382 ------AKVAENRNQLSMIKKLQEDTEENS----------KELETKLEENAISYDSTVKK 1425

Query: 4252 TDTRAQIEKELREKFNLELAEIKKKAFEE----GKQQSMMKSTLLERKLSKLESQT 4407
             +    I KE  EK      + +  A  E     K    MK +  E K+  +E +T
Sbjct: 1426 LNEEIGILKEELEKQRQIQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKT 1481

 Score =  285 bits (730), Expect = 4e-77
 Identities = 343/1543 (22%), Positives = 639/1543 (41%), Gaps = 163/1543 (10%)
 Frame = +1

Query: 289  EKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSL 468
            ++L S+ Q+        N+ I+ I+ DL  ++ D       E+   +VL Q   EL   L
Sbjct: 216  KELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQL----EKTNNDVLRQKNNELSKDL 271

Query: 469  TE--------NSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKC 624
             E        + +   +   F  ++    + + L  ++   ++  +   RE+N Y ++  
Sbjct: 272  QEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNNTRESN-YSDVN- 329

Query: 625  KETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTD---------- 774
              +D +K+L S  E   +L   LQ+   +++  ++E   L  + E    +          
Sbjct: 330  --SDDSKQLISENE---KLLKDLQLTKHKLVQCENECLRLSSITEEAGKEDGILTSKSNG 384

Query: 775  ----LQRKLFRIKDLDDNLNSSKQEFAKEITLKQRV-------NELLHNEIASYKKQIER 921
                L+++L + K   ++L +  + F  E+  K  +        + L NE+ +    +E 
Sbjct: 385  DFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDTLENELNNAALLLEH 444

Query: 922  LTS-KNLETPEKKIIQE-LVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKK 1095
             ++ KN +  E K+  E L + K+++    K+  +L   +   +  +     SK   P +
Sbjct: 445  TSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSNDSK--GPLR 502

Query: 1096 LIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEE 1275
              EI   Q + +     T +   +  + E   +   I   +E+NS    ELLR+T +L +
Sbjct: 503  KEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQEKNS----ELLRVTRNLAD 558

Query: 1276 TAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATL 1455
              +  + K +   N  K I N      E + +  +    +Q   + +++K    EKE   
Sbjct: 559  KLESNENKSK---NYLKNIEN------ETINEAKEAILTLQSQKVQLESKIHELEKEREK 609

Query: 1456 VKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQK 1635
             K    N   + +T  +  + ++L   +   E Q +++                E  +  
Sbjct: 610  FK----NWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTR-------ESTENM 658

Query: 1636 TLRITDNNKIVESAKSTSVDL----------EKHIKTLESKINIISQERDSYKL----LV 1773
            +L   +   + +S  S S++L          E+  K L + +++   E D  +     L 
Sbjct: 659  SLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQ 718

Query: 1774 XXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSK 1953
                               C+ +   +  ELS++K +    +E LE  +K     Q  S+
Sbjct: 719  NAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIE-LEKNLK-----QELSE 772

Query: 1954 MEVEKHALNF------DEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGG-V 2112
            +  EK +L+          K+  NLL E     +NKI  L+   A+NEL  + +     +
Sbjct: 773  LSSEKTSLHIMVTQLQTLQKERENLLDETKKSCQNKIDALQN--AQNELKTEAIRKDQYI 830

Query: 2113 NNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSL 2292
              LE+         + KI +   +I  L+  ++++   +    +       ++  LE  +
Sbjct: 831  KQLEEDN-------DSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEI 883

Query: 2293 SERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRE 2472
             E ++  +T    +E           E+ K+ ++ D+      Y  ++E +  + T  + 
Sbjct: 884  EENKIRLHTYNVLDESINDDSLRRELEKSKI-NLTDA------YSQIQEYKKLYETTDKS 936

Query: 2473 LKEVQEDLDMK-----------TESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSF 2619
            L+E+   LD             T+    LE+K + ++  +     +L      +E++ + 
Sbjct: 937  LQEMSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAE 996

Query: 2620 LANSVSQLQGXXXXXXXXXXXXXXXTEKLQM-----------AENENSEKINNAIVLLQT 2766
                +S LQ                  K+Q            A+N   +++     + +T
Sbjct: 997  FKKKISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKT 1056

Query: 2767 MVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTE-------IDHANERLEE 2925
            + E     ++    +K  +  L  A    ++     E+N+N++       +D +N R+E+
Sbjct: 1057 ISE----LREQLHTYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIED 1112

Query: 2926 A---------EVKMASFDGKVTEILESYDGKILNTAAIGHLVRS----------LIHEKK 3048
                      ++++ +  G   +  ++  G +LN   +  L R              + K
Sbjct: 1113 LSSQNKLLYDQIELYTTTGN--KPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAK 1170

Query: 3049 MXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESN 3228
            M            + AR +  N +      V+ +++S        VME   +L  L ESN
Sbjct: 1171 MLRQKISLIDVELQEARTKLCNSK------VENEKRSFIIQQHDEVMEKLNQLNLLRESN 1224

Query: 3229 AKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWK 3408
              L  E+++    N+ L S+L  ++  + P+E E+  LK  + EKEQ + + +EE+ RWK
Sbjct: 1225 TTLRNELDSSNSKNKELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWK 1284

Query: 3409 LRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAA 3588
             RSQ I+++ + +    + K   +I++L+ QLE    + A   ++F+RL++QA EKL A+
Sbjct: 1285 KRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKAS 1344

Query: 3589 KTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAEL-EKSNNF 3765
            K  Q +   Q+NEL + K+ LEKSL     +  +  +    E+   + +  +L E +   
Sbjct: 1345 KLSQDSFIEQLNELKDAKLALEKSLNNANARIQELEDAKVAENRNQLSMIKKLQEDTEEN 1404

Query: 3766 SNELEKKVED--------AKKFKNEIESLKSELQSVKAYENSTVN---------SKIIKD 3894
            S ELE K+E+         KK   EI  LK EL+  +  +              SK+++ 
Sbjct: 1405 SKELETKLEENAISYDSTVKKLNEEIGILKEELEKQRQIQQQFQAAAGTEQDDLSKVVES 1464

Query: 3895 LKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXX 4074
            +K SF+ +K + IE+                 A+      +N     NI           
Sbjct: 1465 MKRSFEEDKIKFIEEKTREVNQKIREFQEAQEAEETGLKPSN----INIDEIKKQWEAEH 1520

Query: 4075 XALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVT 4254
               + K+I EAEE LKKR+RLP+EEKI+ +IE++++ LE+EF+ K+ E   +   +G + 
Sbjct: 1521 NEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVEERLKSISQSGKME 1580

Query: 4255 DT---------------------------------------------RAQIEKELREKFN 4299
            D                                              RA IE +LRE+FN
Sbjct: 1581 DIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSSDIISSDDKDKLRADIEAQLREEFN 1640

Query: 4300 LELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNN 4428
             EL  IKKK+FEEGKQQ+MMK+TLLERKL+K+ESQ LS TK +
Sbjct: 1641 HELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQ-LSETKQS 1682

 Score = 41.2 bits (95), Expect = 0.030
 Identities = 88/446 (19%), Positives = 174/446 (39%), Gaps = 34/446 (7%)
 Frame = +1

Query: 3190 ENTTKLLALEESNAKLIKEVEN-----CTKVNETLSSQLADMQV----------KLEPLE 3324
            + T K+L       +++K   N     C K+  T+       Q           +LE   
Sbjct: 142  QRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRT 201

Query: 3325 QEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQL 3504
            QE+N L+      E+ L+   ++   ++ ++ TI+ + +          L +I+  + QL
Sbjct: 202  QELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR--------NDLNRIRN-DFQL 252

Query: 3505 ETVRTENAQLTDRFDRLKKQAHEKLDAAKTM-------------QINLTTQINELNETKV 3645
            E  +T N  L  + + L K   EKL   KT+             +I L  ++ +L E+++
Sbjct: 253  E--KTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQL 310

Query: 3646 NLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIES 3825
            N  K       ++N S +  +D+S+++I             +E EK ++D +  K+++  
Sbjct: 311  NAVKEELNNTRESNYS-DVNSDDSKQLI-------------SENEKLLKDLQLTKHKLVQ 356

Query: 3826 LKSELQSVKAYENSTVNSKIIKDLKES--FKREKDELIEQMXXXXXXXXXXXXXTILAQR 3999
             ++E   + +          I   K +  F   K +LI++               +  + 
Sbjct: 357  CENECLRLSSITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEH 416

Query: 4000 KNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRR 4179
            K  I+ + +E  +             A +L   T  E+N K +      EK+ A  +   
Sbjct: 417  KVPIINSFKERTD-----TLENELNNAALLLEHTSNEKNAKIKELKVKNEKL-AEYKDEI 470

Query: 4180 KVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMM 4359
             +L ++     R++      N V  D++  + KE   KF   + +    A  E   Q ++
Sbjct: 471  HILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKE-EIKFIQNILQNDDSATTESDSQKIV 529

Query: 4360 KSTLLERK----LSKLESQTLSPTKN 4425
               L+E +    L +  S+ L  T+N
Sbjct: 530  TERLVEFRDIIQLQEKNSELLRVTRN 555

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  305 bits (781), Expect = 3e-83
 Identities = 360/1535 (23%), Positives = 656/1535 (42%), Gaps = 163/1535 (10%)
 Frame = +1

Query: 289  EKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQ--- 459
            E+ +S +Q+   +   + SE+  +K D +  + ++  L+ +  +  N L++  L+L+   
Sbjct: 223  EQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLS 282

Query: 460  DSLTENS-------ALKEQ-IGVFEGKLDSMTQELWLAN----------------TENKK 567
            DSL           ALK++ I + E +L+++ +EL                    +EN+ 
Sbjct: 283  DSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENES 342

Query: 568  LQTGMKLLRENNLYLEIKCKETDK--NKKLYSSAEDASRLQDQLQIVSSEILSLKSEIAT 741
            L   ++L +E     E +C        +    S    SR      ++  + +  K     
Sbjct: 343  LLKDLRLTKEKLAQCESECLRLSSITEETGEESGTLTSRSSTDFILLKKQYIKEKRAKEQ 402

Query: 742  LKYMNESLSTDLQRKLFRIKD-------LDDNLNSSK---QEFAKEITLKQRVNELLHNE 891
            L+   ES   +L+ K+  I         L++ LN+S    +  + E   K R   + + +
Sbjct: 403  LQNQIESFIVELEHKVPVINSFKERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEK 462

Query: 892  IASYKKQIERLTSKNLETPEKKIIQELV-------DLKEKLVNSEKEC--NELKSTVDKY 1044
            IA  +  I  LT + L+   +  +Q L+       D K  L   E +   N L++     
Sbjct: 463  IAKCENDIHILTRQRLDLCRQ--VQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGT 520

Query: 1045 INIDEKKLIS----KFGN----PKKLIEILR--RQLVKEKRHKDTLQRQVESFLVELEQK 1194
               D +K+++    +F N     +K  E+LR  R L  +    +   +Q    L+++E K
Sbjct: 521  TESDSQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQN---LLKIENK 577

Query: 1195 LPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQR 1374
               I+  KE   SL+ E + + S +EE  +ER+     ++  ++  S N     +L + +
Sbjct: 578  T--INEAKEAILSLQSEKMSLESKVEELERERETLKSSIS--KQASSFNNSVIQQLTKTK 633

Query: 1375 SDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSN---ENTENDTDSHKIISKRLLHFQNV 1545
             +L  QVQ L   I   +  + +  +L+ K + +     ++   +  K  S R+L  +  
Sbjct: 634  RELESQVQDLQARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERF 693

Query: 1546 KELQQ-------KNMXXXXXXXXXXXXXXXXEQEQQKTLR--ITDNNKI-VESAKSTSVD 1695
            K L         +N                 + +  +TL   I+  +K+ V     +++ 
Sbjct: 694  KLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALSNLK 753

Query: 1696 LEKHIK-----TLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTN 1860
            LE+ +K     +L+ +++ +S E+ S +++V                    + E+E L +
Sbjct: 754  LEQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTL--------------QKEREDLLD 799

Query: 1861 ELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLEN 2040
            E     Q  +  +EE  N++K     +       ++H +  +E  DN + ++ Y    +N
Sbjct: 800  EARKSCQNKINEVEEAYNELKVETSHK-------DQHIMQLEE--DNTSKIEWY----QN 846

Query: 2041 KIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLE 2220
            KI+TL++D               V NL   K  E+   + K+  L+KEI   K +     
Sbjct: 847  KIETLKKD------------NDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIR----- 889

Query: 2221 DKILTMTLSKNLLDNKVLQLETSLSERELPKN-TQIKNEEKEPAKQQTYTFERKKLESVN 2397
              + T  +    +++  L+ E  +S+  L +  +QI+  +K       Y    + L  +N
Sbjct: 890  --LHTYNVMDETINDDSLRKELEMSKINLTEAYSQIQEYKK------LYESTAQSLREMN 941

Query: 2398 DSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYK 2577
                     E+ E   NQ ++L  E   +++ + +  E    L N+    KN++++   +
Sbjct: 942  SK-----LDESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVE 996

Query: 2578 LASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVL 2757
               +   L+  N  +    S+ +                    Q    +  +K  +    
Sbjct: 997  FKKIIAILQNNNKEIETVKSEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKT 1056

Query: 2758 LQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVK 2937
            +  + E+  T++   K    S S L   +   ++     + +   ++D +N R+E+   +
Sbjct: 1057 ISELREQLHTYRGQVKTLTLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQ 1116

Query: 2938 MASFDGKV-------TEILESYDGKILNTAAIGHLVRS----------LIHEKKMXXXXX 3066
                  ++         + ++ +G  LN   +  L R              + KM     
Sbjct: 1117 NKLLYNQIELYTAAGNGVGDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKI 1176

Query: 3067 XXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKE 3246
                   + AR +  N R      V+ D++S        +ME   +L  L ESN  L  E
Sbjct: 1177 TLMDVELQDARTKLNNSR------VENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNE 1230

Query: 3247 VENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTI 3426
            +ENC+K N+ L S+L  ++  + P+E E++ LK  + EKEQ + + +EE+ RWK RSQ I
Sbjct: 1231 LENCSKKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDI 1290

Query: 3427 LQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQIN 3606
            L++ + +    + K   ++++L+ QLE    +  +  +RF+RL++QA EKL  +K  Q  
Sbjct: 1291 LEKHQQLSSNDYEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQET 1350

Query: 3607 LTTQINELNETKVNLEKSLQ------QEIEKNNQSGNGAADESEEIIRLRAELEKSNNFS 3768
            LT Q+NEL + KV LE+SL       QE+E    + +   + SE I R + + EKS   S
Sbjct: 1351 LTEQLNELKDAKVALERSLNDANTRIQELEGEKVAEDN--NRSEMIKRSQEDAEKS---S 1405

Query: 3769 NELEKKVED--------AKKFKNEIESLKSE----------LQSVKAYENSTVNSKIIKD 3894
             ELE+K+E+         +K   EI +LK E          LQ+   + +  + S I++ 
Sbjct: 1406 RELEEKLEENAISYSSTVRKLNEEIATLKEEIEKQGQIQKQLQTAAGHRDEDL-SNIVES 1464

Query: 3895 LKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXX 4074
            +K+SF+ +K + IE+                 AQ +     N   S NI           
Sbjct: 1465 MKKSFEEDKIKFIEEKTREVNKKIQE------AQER----LNQPSSVNIDEMKKQWEAEH 1514

Query: 4075 XALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVV- 4251
               + +R+ EAEE LKKR+RLP+EEKI+ +IE++++ LE+EF  KL E   +  G+  + 
Sbjct: 1515 EEEVAERVREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFNEKLEEKVKSISGSEQME 1574

Query: 4252 --------------------------------------------TDTRAQIEKELREKFN 4299
                                                         + RA+IE +LRE+ N
Sbjct: 1575 AMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELN 1634

Query: 4300 LELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ 4404
             EL  +KKK+FEEGKQQ+ MK+TLLERKL+K+ESQ
Sbjct: 1635 DELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQ 1669

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 228/1193 (19%), Positives = 445/1193 (37%), Gaps = 107/1193 (8%)
 Frame = +1

Query: 1174 LVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFN 1353
            +  L +KL   +  K  N       L+IT S +E  K   +K  ++  L+ ++ N  + N
Sbjct: 43   ITRLNEKLIQFNELKSEN-------LQITVSFDEL-KTNSLK--KIDGLKTEMENVLRQN 92

Query: 1354 DELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLH 1533
            DE+ ++R+D + + ++L            ++  L  ++ S +   ND    K        
Sbjct: 93   DEIRKERNDTSAKFEFL----------QNEKIQLSNELESVKRKLNDLTEEK-------- 134

Query: 1534 FQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNN-KIVESAKSTSVDLEKHI 1710
                KE+Q                       QQ+TL+I D   K VE AK  +       
Sbjct: 135  ----KEIQ---------------------SNQQRTLKILDERLKEVEMAKVENNRTNNEC 169

Query: 1711 KTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHV 1890
            + L S +  +  ++ +Y   +                    +  K+ L  ELSS  +Q++
Sbjct: 170  RNLRSTVVELETKQQTY---ITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYL 226

Query: 1891 KVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLA 2070
               +  +  I  +       + E+ +   +F   K NN++LK+  ++L N ++    DL 
Sbjct: 227  SYRQRTDATISEI-------RSELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDL- 278

Query: 2071 ENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLK----------SKNKNLE 2220
                  KNL +  +N  +Q    E+++ ++ I  L+ +++ +K          S N   +
Sbjct: 279  ------KNL-SDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSIRKSDSSNVTSD 331

Query: 2221 DKILTMTLSKNLL-DNKVLQLETSLSERELPKNTQIKNEEKEPAKQQT------------ 2361
            D    ++ +++LL D ++ + + +  E E  + + I  E  E +   T            
Sbjct: 332  DSRKLISENESLLKDLRLTKEKLAQCESECLRLSSITEETGEESGTLTSRSSTDFILLKK 391

Query: 2362 -YTFERKKLESVNDSDISYL------------YYENLEELQNQFRTLRRELKEVQ----- 2487
             Y  E++  E + +   S++            + E  + L+N+       L+        
Sbjct: 392  QYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERTDMLENELNNSALLLEHTSNEKNA 451

Query: 2488 --EDLDMKTESHLKLENK---YTKVKNDL-KQATYKLAS------------------VYT 2595
               +L++K E   K EN     T+ + DL +Q  Y L +                  +  
Sbjct: 452  KIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQN 511

Query: 2596 TLEQKNSFLANSVSQ--LQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTM 2769
             L+  NS    S SQ  L G               TE L++  N   +  +N I   Q +
Sbjct: 512  ILQNDNSGTTESDSQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQNL 571

Query: 2770 VE-ENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMA- 2943
            ++ EN T  +A           ++AI S+Q + + +ES    E++   E L+ +  K A 
Sbjct: 572  LKIENKTINEA-----------KEAILSLQSEKMSLESKVE-ELERERETLKSSISKQAS 619

Query: 2944 SFDGKVTEILESYDGKILN-----TAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRN 3108
            SF+  V + L     ++ +      A I  + R       +                  N
Sbjct: 620  SFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLL-----------------N 662

Query: 3109 KNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKV-NETLSS 3285
            K  ++ + S   I  +           E ++++LA  E   KL+    + TK  N+ L  
Sbjct: 663  KEIQDIYDSKSDISIELG--------KEKSSRILA--EERFKLLSNTLDLTKAENDQLRK 712

Query: 3286 QLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHM 3465
            +   +Q  +   + + +E   +    +  L++ +  L   KL  +  +   K +++E   
Sbjct: 713  RSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDK 772

Query: 3466 KSLEK--IKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNET 3639
             S EK  ++ +  QL+T++ E     D  D  +K    K++  +     L  + +  ++ 
Sbjct: 773  LSSEKTSLRIMVTQLQTLQKER---EDLLDEARKSCQNKINEVEEAYNELKVETSHKDQH 829

Query: 3640 KVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEI 3819
             + LE+    +IE           +++ ++ L       N    E+EK     K  + EI
Sbjct: 830  IMQLEEDNTSKIEWYQNKIETLKKDNDSVMNL------VNEKQTEIEKLQYKVKSLEKEI 883

Query: 3820 ESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQR 3999
            E  K  L +    + +  +  + K+L+ S    K  L E                   + 
Sbjct: 884  EENKIRLHTYNVMDETINDDSLRKELEMS----KINLTEAYSQIQEYKKLYESTAQSLRE 939

Query: 4000 KNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEE---------K 4152
             N+ L    E+ +                +  + E   NL   + L   E         K
Sbjct: 940  MNSKLDESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKK 999

Query: 4153 INAVIEKRRKVLE---QEFETKLRELGLNADGNGVVTDT-----------RAQIEK---E 4281
            I A+++   K +E    E+E+KL ++  + D   +  +T            A + K   E
Sbjct: 1000 IIAILQNNNKEIETVKSEYESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISE 1059

Query: 4282 LREKFNLELAEIKKKAFEEGKQQSMMK---STLLERKLSKLESQTLSPTKNND 4431
            LRE+ +    ++K       + ++++K    +   +K S LE   LS ++  D
Sbjct: 1060 LREQLHTYRGQVKTLTLSRSELENILKENEKSWTSQKQSLLEQLDLSNSRIED 1112

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 71/381 (18%), Positives = 156/381 (40%), Gaps = 7/381 (1%)
 Frame = +1

Query: 3247 VENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTI 3426
            +E    ++  + ++L +  ++   L+ E   L++ V+  E   N  ++ ++  K   + +
Sbjct: 32   LEQVKSIDTDIITRLNEKLIQFNELKSE--NLQITVSFDELKTNSLKK-IDGLKTEMENV 88

Query: 3427 LQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQIN 3606
            L+Q   + +E +  S +         E ++ E  QL++  + +K++ ++  +  K +Q N
Sbjct: 89   LRQNDEIRKERNDTSAK--------FEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSN 140

Query: 3607 LTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKK 3786
                +  L+E    +E +  +    NN+  N  +   E   + +  +    N  +ELE+K
Sbjct: 141  QQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERK 200

Query: 3787 VEDAKKFKNEIESLKSELQSVK----AYENSTVNSKIIKDLKESFKREKDELIEQMXXXX 3954
             ++    ++  + L+ EL S      +Y   T     I +++    R K++         
Sbjct: 201  TQELNLLQSNKDWLEKELSSKSEQYLSYRQRT--DATISEIRSELNRLKNDF-------- 250

Query: 3955 XXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMR 4134
                       + ++KNN L+N  +   +                K+    E  LK+R+ 
Sbjct: 251  ---QLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTE----KQEFSTEIALKQRLI 303

Query: 4135 LPSEEKINAVIEKRRKVLEQEFE--TKLRELGLNADGNGVVTDTRAQIEKELR-EKFNLE 4305
               E ++NAV E+ + + + +    T      L ++   ++ D R   EK  + E   L 
Sbjct: 304  DLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLR 363

Query: 4306 LAEIKKKAFEEGKQQSMMKST 4368
            L+ I ++  EE    +   ST
Sbjct: 364  LSSITEETGEESGTLTSRSST 384

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  302 bits (774), Expect = 1e-82
 Identities = 379/1598 (23%), Positives = 692/1598 (43%), Gaps = 131/1598 (8%)
 Frame = +1

Query: 43   DKISSFFDLPGNTWESMDEHALEKIYTKAYDLM---KENSFVSAAIDDIKHVYEGKINTI 213
            DKIS F  +P  + + ++   L K++ K  +     +E + ++  +D+IK  Y  +I+ +
Sbjct: 3    DKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRISKL 62

Query: 214  SQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDH 393
            S K                 +L  +++L+ ++++     DALN ++   +   +A++R +
Sbjct: 63   S-KLLNESSEQKNIASKELSHL--QDQLMQDRERCRRKIDALNKQLDSSR---DAIKRLN 116

Query: 394  TTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQ 573
               +A+E   E+++ QSK +  +S+   + L ++  +   KL  M   L +  + +  LQ
Sbjct: 117  DEKDAKE---ESMIRQSKHQNVNSV--QNVLDKENKLLRRKLMEMENILQICKSNSVSLQ 171

Query: 574  TGMK-LLRENNLYLEIKCKETDK-----NKKLYSSAEDASR---LQDQLQIVSSEILSLK 726
                 +++E  L L+ K    +K     NK L   +  ASR   L+++L    ++  S  
Sbjct: 172  LKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESAL 231

Query: 727  SEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYK 906
            S    L   N+ LS  ++ K+  IK+L D     K EF+KE+TL++ +N+LL +++AS++
Sbjct: 232  SYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFE 291

Query: 907  K-----QIERLTSKNLETPE-KKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKL 1068
            +     +I +      + P+   +  EL++ K +   S+ EC  L++ +  ++  D+  +
Sbjct: 292  RDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATV 351

Query: 1069 ISK-----FGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSS 1233
             +       G     I++LR+QL+KE+  K  LQ Q+E F++ELE K P + SFKER  S
Sbjct: 352  DTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKS 411

Query: 1234 LERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLC 1413
            LE EL R T  LE  +  +   +RELT+L++KI++ E     L++QR DLA QV+ LLL 
Sbjct: 412  LEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLN 471

Query: 1414 ID----NKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXX 1581
                     P ++ +   ++KI+ + +  N+ D+  IIS+RL+ F N+ ELQ+KN+    
Sbjct: 472  TSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLY 531

Query: 1582 XXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSY 1761
                        E ++  TL   +   I E AK   ++LE     +ES+INI+ +ERDSY
Sbjct: 532  CIRTLADKLEFHEGKKDTTLAEVEKQTIKE-AKDAIIELENTNMKMESRINILLRERDSY 590

Query: 1762 KLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQ 1941
            KLL                     E + + L  ELSS K +   V++ L  ++ T +K  
Sbjct: 591  KLLASSKENNVNVNAKNFTEISH-EKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLL 649

Query: 1942 LTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNL 2121
               K+  +    +F+  K    L KE    LE ++  L+ DL + +L   + +    N +
Sbjct: 650  CDKKIASQ----DFENFK---MLAKEKESILETRVNNLKTDLEKQKLSVPSFVQD--NKV 700

Query: 2122 EQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNL--LDNKVLQLETSLS 2295
              S   EL  +  K   L  EIS+LK +  N    +L  +L+++L     + +QL+  L 
Sbjct: 701  RDS--TELLQSRTKTEILMHEISSLKKETAN--SMVLKESLTRDLERCCKEKIQLQMKLK 756

Query: 2296 ERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRREL 2475
            E E+  N Q  N + +  K   Y    K+LE            E+LE L+ + ++  +E+
Sbjct: 757  ESEISLNEQKVNFDSKGIK---YDARIKQLE------------ESLERLRIELKSKAQEI 801

Query: 2476 KEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXX 2655
            K +Q   D    S LK        +N +     KL SV T L +K   +    S++    
Sbjct: 802  KSLQSSKD----SQLKW------AQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKI---- 847

Query: 2656 XXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLR 2835
                                EN ++E   N +             K  F +  +  S L+
Sbjct: 848  --------------------ENLDNELRENKL-------------KYEFLNNTSDASTLQ 874

Query: 2836 QAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDG--------K 2991
             A+    +Q+ +   + ++++    E +   E  +   + ++  + E YD         K
Sbjct: 875  PALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDYDARIELECKEK 934

Query: 2992 ILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSF-VKIDQQSXXX 3168
            + N   +  L R L   + +            +++  + +N  EK      KID+ +   
Sbjct: 935  LANEEELSLLRRELDEIRSLQPKLKEGTVCLVKQSE-KLRNQAEKIQEMKAKIDKMNWNV 993

Query: 3169 XXXXXVMENTTKLLALEESN-------AKLIKEVENCTKVNETLSSQLADMQVKLEPLEQ 3327
                   E T++  ++ ++N        +L KE  +     + L S L   Q  L+  E+
Sbjct: 994  QVYK--KEKTSQFQSIMKANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLLDTHEK 1051

Query: 3328 EINELKLKVAEKEQHLNICQEELERWKLRSQTILQQ-GKIVE----EEAHMK-------- 3468
            +  E K   A+ E+ L    E+ E  ++ +  ++++ G + E     E ++K        
Sbjct: 1052 KWMEEK---ADYERELISNIEQTESLRVENSVLIEKIGSVTEGSDGNEDYLKLVSFFSNL 1108

Query: 3469 -----SLE-KIKTLEEQLETVRTENAQLTD-----RFDRLKKQAHEKLDAAKTMQINLTT 3615
                 SLE K+ T +  L  V+ +NA L       + D+   Q   +  A    + N  T
Sbjct: 1109 RHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTELQCSAVIIDEFNDIT 1168

Query: 3616 ----QINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAEL------------ 3747
                Q+N L E    L+KSL+   EKN +         EE+ +L+++L            
Sbjct: 1169 KEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNAN 1228

Query: 3748 -------------------------------EKSNNFSNELEKKVEDAKKFKNEIESLKS 3834
                                           EK N+  ++ + K+ DA+  K E+E+  +
Sbjct: 1229 KILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKTELENKFN 1288

Query: 3835 ELQSVKAYE-------NSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILA 3993
             L+  +A+E         T  +  +K+LK    + + +L  +              T+  
Sbjct: 1289 RLKK-QAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTVDLDTEPKEHTV-- 1345

Query: 3994 QRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEK 4173
             +  ++L + ++ A++              + K    + +  +K +R   EE+ N +I +
Sbjct: 1346 -QSGDLLRDQEKVASLPLIEEIESLKRELQVFKNANNSSDAFEK-LRDNMEEEKNKIINE 1403

Query: 4174 RRKVLEQEFETKLRELGLNADGNGVVTDTRAQIE---KELREKFNLELAEIKKKAFEEGK 4344
            R K    EFE KL E+   +   G V D    IE   KE  +++  E     ++A E  K
Sbjct: 1404 RTK----EFEKKLEEIVSKSKSTGKVADNSENIETLKKEWLKEYEEETIRRIREAEENLK 1459

Query: 4345 QQSMMKS-----TLLERKLSKLESQTLSPTKNNDSNET 4443
            ++  + S      ++ ++  +LE +     K N S+ T
Sbjct: 1460 KRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLT 1497

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 169/844 (20%), Positives = 337/844 (39%), Gaps = 100/844 (11%)
 Frame = +1

Query: 343  SEITL----IKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKE----QI 498
            SEI+L    + +D + ++ D     AR ++ E  LE+ ++EL+    E  +L+     Q+
Sbjct: 758  SEISLNEQKVNFDSKGIKYD-----ARIKQLEESLERLRIELKSKAQEIKSLQSSKDSQL 812

Query: 499  GVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASR 678
               +  +D   ++L    TE  + +  +  L      L+ + +E     +  ++  DAS 
Sbjct: 813  KWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKYEFLNNTSDAST 872

Query: 679  LQDQLQIVSSEI-LSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEIT 855
            LQ  L+    +  L LK   + ++   E +ST+ +     +K+L+  L S K+++   I 
Sbjct: 873  LQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKA----LKELNSQLASMKEDYDARIE 928

Query: 856  LKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTV 1035
            L+ +       E++  +++++ + S   +  E  +   LV   EKL N  ++  E+K+ +
Sbjct: 929  LECKEKLANEEELSLLRRELDEIRSLQPKLKEGTVC--LVKQSEKLRNQAEKIQEMKAKI 986

Query: 1036 DKY---INIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMI 1206
            DK    + + +K+  S+F +  K  + L   + + ++     Q +++     L +   ++
Sbjct: 987  DKMNWNVQVYKKEKTSQFQSIMKANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLL 1046

Query: 1207 DSFK----ERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQR 1374
            D+ +    E  +  EREL+      E    E  +   ++ ++ +    NE +  +L+   
Sbjct: 1047 DTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEGSDGNEDYL-KLVSFF 1105

Query: 1375 SDLAHQVQYLLLCIDNKSPFTEKEATLVK-KIVSNENTENDTDSHKIISKRLLHFQNV-- 1545
            S+L H+   L    + K    +++  LVK K  S E   ND    +  S+  L    V  
Sbjct: 1106 SNLRHERNSL----ETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTELQCSAVII 1161

Query: 1546 -------KELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEK 1704
                   KE+ Q N+                E+ ++    +T   + V   KS  +  ++
Sbjct: 1162 DEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQLKSDLIKTKE 1221

Query: 1705 HIKTLESKI---------------NIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCEL 1839
             +    +KI               ++ +Q+R+  K  +                    + 
Sbjct: 1222 QVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKT 1281

Query: 1840 EKER----------------------LTNELSSMKQQHVKVLEELENK-IKTLQKSQLTS 1950
            E E                       LTNEL  +K    K+ ++L +K  KT+       
Sbjct: 1282 ELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTVDLDTEPK 1341

Query: 1951 KMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQ- 2127
            +  V+   L  D+ K  +  L E ++ L+ +++  +     ++ FEK       +N+E+ 
Sbjct: 1342 EHTVQSGDLLRDQEKVASLPLIEEIESLKRELQVFKNANNSSDAFEKLR-----DNMEEE 1396

Query: 2128 -SKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDN-------KVLQLE 2283
             +KII     E +   L++ +S  KS  K  ++     TL K  L         ++ + E
Sbjct: 1397 KNKIINERTKEFEKK-LEEIVSKSKSTGKVADNSENIETLKKEWLKEYEEETIRRIREAE 1455

Query: 2284 TSLSER-ELPKNTQI------KNEE---------KEPAKQQTYTFERKKLESVNDSDISY 2415
             +L +R  LP   +I      + EE         KE A   T++ +RK+     D D+  
Sbjct: 1456 ENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSCDRKETNDDPDEDLWN 1515

Query: 2416 LYYENLEELQNQFRTLRRELK-EVQEDL----------DMKTESHLKLENKYTKVKNDLK 2562
               +   E  +      ++   +VQE L          D ++ S  K  +   KV +D  
Sbjct: 1516 SPSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSMNKENSALVKVNDDKA 1575

Query: 2563 QATY 2574
             +T+
Sbjct: 1576 ASTF 1579

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  294 bits (752), Expect = 9e-80
 Identities = 338/1557 (21%), Positives = 666/1557 (42%), Gaps = 99/1557 (6%)
 Frame = +1

Query: 19   NEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAY---DLMKENSFVSAAIDDIKHV 189
            ++ T   +  I+SFF       ES++   ++ +  K     +L  EN  ++ + D++K  
Sbjct: 14   SDNTDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTN 73

Query: 190  YEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEITLIKYD 369
               KI+ + ++                G    R+    + + E +    +++E+  IK  
Sbjct: 74   SSKKIDNLKKEM-------ENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRR 126

Query: 370  LEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSA-------LKEQIGVFEGKLDSM 528
             + +  +   L+  +++T  +L++   EL+ + ++N+        L+  I   E K   +
Sbjct: 127  ADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDL 186

Query: 529  TQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQ--DQLQIV 702
                  +  E ++    + +L+  N +LE +    ++    Y    D   L+  ++L  +
Sbjct: 187  ITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHL 246

Query: 703  SSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELL 882
             S+    K++   L   N+ LS  LQ KL  IK L D L+S KQEF+ EI LKQR+ +LL
Sbjct: 247  RSDFQVEKTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLL 306

Query: 883  HNEIASYKKQIERLTSKNLETPEKKIIQELVDL-------KEKLVNSEKECNELKSTVDK 1041
             +++ + K++++           KK + E  DL       KE+L   + EC  L S + +
Sbjct: 307  ESQLNAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGE 366

Query: 1042 YINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKE 1221
                DE+   S   +    I +L++QL+KEKR K+ LQ Q+ESF++ELE K+P+I+SFKE
Sbjct: 367  ---TDEESGSSTSRSSSDFI-LLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKE 422

Query: 1222 RNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQY 1401
            R  +LE EL      LE T+ E++ K REL+   +K+   E     L++QR DL  QVQY
Sbjct: 423  RTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQY 482

Query: 1402 LLL----CIDNKSPFTEKEATLVKKIVSNE-NTENDTDSHKIISKRLLHFQNVKELQQKN 1566
            LL+      D+K P  ++E   ++ I+ N+ +T  +TDS KI+++RL+ F+++ ELQ+KN
Sbjct: 483  LLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKN 542

Query: 1567 MXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQ 1746
                             E E +++L+  ++  I E AK   + L+   + LESK+  + +
Sbjct: 543  TELLKIVRNLADRLESNENESKQSLQKIESETINE-AKEAILTLKAEKEQLESKVEELEK 601

Query: 1747 ERDSYKLLVXXXXXXXXXXXXXXXXXXXCELE--KERLTNELSSMKQQHVKVLEELENKI 1920
            E ++ K L+                     LE   + L + +S + ++  + +  L  +I
Sbjct: 602  ECENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEI 661

Query: 1921 KTL--QKSQLTSKMEVEKHAL-----NFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENE 2079
            + L   KS ++ K+  EK +       F  + +  +L K   D+L  +   L+  + + +
Sbjct: 662  QDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQD 721

Query: 2080 LFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNK-------NLEDKILTM 2238
                        +  Q  + E    + K++  + E+ NLK + K       NL+ ++  +
Sbjct: 722  ------------SKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKL 769

Query: 2239 TLSKNLLDNKVLQLETSLSER-----ELPKNTQIKNEEKEPAKQQ-----TYTFER-KKL 2385
            +  K  L   V QL+T   ER     E  K+ Q K +E E A  +     ++  +R K+L
Sbjct: 770  SSEKTGLRIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQL 829

Query: 2386 ESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQ 2565
            E  N+S I + Y   +E L+    ++   + + Q +++        LE +    +N ++ 
Sbjct: 830  EEDNNSSIEW-YQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEID--ENKIRL 886

Query: 2566 ATYKLA-------SVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENE 2724
             TY +        S+   LE+    L ++ SQ+Q                  K + +  +
Sbjct: 887  HTYNVIDGTINDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKD 946

Query: 2725 NSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDH 2904
             S +I N       +  E ++ ++     K  +  L   ++   +     ++ +  +I  
Sbjct: 947  FSNRIKN-------LTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISI 999

Query: 2905 ANERLEEAEVKMASFDGKVTEILESYDGKIL--NTAAIGHLVRSLIHEKKMXXXXXXXXX 3078
                 +E E   + ++ K+++I +  D + +  NTA   +      H             
Sbjct: 1000 LQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQ 1059

Query: 3079 XXXRRARYRNKN-PREKFPSFVKIDQQSXXXXXXXXVME---NTTKLLALEESNAKLIKE 3246
                R +       R +  S +K +++S        + +   + +++  L   N  L  +
Sbjct: 1060 LHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQ 1119

Query: 3247 VENCTKVNE---------TLSSQLADMQ-------VKLEPLEQEINELKLKVAEKEQHLN 3378
            +E  T  ++          L+S L  ++        K+   E++   L+ K++  +  L 
Sbjct: 1120 IELYTTADKGVTDTNDKPALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQ 1179

Query: 3379 ICQEELERWKLRSQ---TILQQGKIVEEEAHMKSL--EKIKTLEEQLETVRTENAQLTDR 3543
              + +L+  +L  +   TI+QQ + + E+ +  +L  E   TL  +LE    E   L   
Sbjct: 1180 EARTKLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSE 1239

Query: 3544 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNL---EKSLQQEIEKNNQSGNGAADE 3714
             D+LK+           ++ ++  +  EL  TK  +   +K  Q  +EK+ Q  +   ++
Sbjct: 1240 LDKLKQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEK 1299

Query: 3715 SE-EIIRLRAELEKSNNFSNELEKKVEDAKKFKNE-IESLKSELQSVKAYENSTVNSKII 3888
             E EI  L+ +L++      E E++    ++   E +++ K  L ++    N   N+KI 
Sbjct: 1300 LEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIK 1359

Query: 3889 KDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXX 4068
             +        K E +E                +    +N    + +E             
Sbjct: 1360 LEKSLDDANTKIEELENAKAEQDNNQLDAIKRLQQDAEN----SSKEFKTKLEEKATFYD 1415

Query: 4069 XXXALILKRITEAEENLKKRMRL-------PSEEK--INAVIEKRRKVLEQEFETKLREL 4221
                 + + I    E ++K+ R+       P+ E+  ++ ++E  +K  E++    +RE 
Sbjct: 1416 STIKKLNEEIITLREEIEKQRRIQQQLQSEPANEQNDLSKIVESMKKTFEEDKINFIRE- 1474

Query: 4222 GLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSK 4392
                     V +   + ++ L +  N+ + E+K K   E +++ + +    E  L K
Sbjct: 1475 -----KTKEVNEKILEAQERLNQPSNINIDELKIKWKAEHEEEVVNRIREAEEALKK 1526

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  283 bits (725), Expect = 2e-76
 Identities = 338/1452 (23%), Positives = 618/1452 (42%), Gaps = 68/1452 (4%)
 Frame = +1

Query: 298  VSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTEN 477
            VS+       +     EI  +K  L  +Q  +  LE + RK+E+    S     D L  N
Sbjct: 325  VSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAVSNSTSSDDL-RN 383

Query: 478  SALK--EQIGVFEGKL--DSMTQELWLANTEN--KKLQTGMKLLRENNLYLEIKCKETDK 639
            S  K  + I V + KL  +   +E +  N E     L+T +  L         + +E  +
Sbjct: 384  SLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLEAYRHRAAAREEELKE 443

Query: 640  NKKLYSSA-EDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDN 816
               L   A ++ S +  +L    S I S++ EI  +      L+  LQ  L      +D+
Sbjct: 444  ATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDS 503

Query: 817  LNSSKQEFAKEI-TLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKL 993
                  E  K I  + Q  +E+   E  + K   ERLT            +++++L++K 
Sbjct: 504  AGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTK----------FKDIIELQQKN 553

Query: 994  VNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESF 1173
            +   K   EL + +++    D+ K   K    ++ I   +  ++  + +  +L  ++ + 
Sbjct: 554  MELLKTTRELATKLEEE---DKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAKIAAL 610

Query: 1174 LVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFN 1353
              ELE    ++ + ++ ++  + +  R    +E T   ++++ R  + +Q+   N    N
Sbjct: 611  TKELET-YKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQESKENANILN 669

Query: 1354 DELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLH 1533
            D++        H +   L    +     E+   L++K +    TEN+      + KRL  
Sbjct: 670  DKIFALDEKNNH-ISIELAREKSAKQLAEERLKLLQKSMDMTITENER-----LQKRLNS 723

Query: 1534 FQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIK 1713
             +NV   Q K                     + ++   T  NK   S     + L    +
Sbjct: 724  LRNVVVEQDKRTHETINSLI-----------KTRSELATVENKWNVSQNEIKL-LHSSEE 771

Query: 1714 TLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVK 1893
             L++++  +++E++S KLLV                    + E+E L   LS+ + +  K
Sbjct: 772  MLKNELTRLNEEKNSMKLLVTRLQTL--------------QSEREHL---LSTTQDKFNK 814

Query: 1894 VLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDN------------NNLLKEYVDKLE 2037
             L +LE     L+K    ++           E+KD+            +N+ K Y + +E
Sbjct: 815  ELNDLEGTCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVE 874

Query: 2038 NKIKT------LEQDLAEN-ELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNL 2196
             + +T      L + L E  EL EK          ++ K+ E+S  ++++  L  E++  
Sbjct: 875  KERETKWENTRLTKQLKEKTELIEKYKAASD----DEGKLEEISSLQKELQVLKNELTES 930

Query: 2197 KSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFER 2376
             S+ ++    I  +  S   ++ +VL  E +  ER     T+++  +   A   T    +
Sbjct: 931  YSQTESYRKDIELLNQSIADINKQVLNKEAAFKERI----TEVELAKNNIADSNTVL--K 984

Query: 2377 KKLESVNDS-DISYLYYE----NLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYT 2541
             +++ +N+  ++    YE    N     N+   + + L++ + D + K +S +K   +  
Sbjct: 985  TQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQV 1044

Query: 2542 KVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAEN 2721
            K  N       K  + Y    Q ++ ++ ++SQL+                 E+ Q    
Sbjct: 1045 KYAN-------KAQNNYEQELQNHANVSKTISQLR-----------------EQTQHYRT 1080

Query: 2722 ENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQS-LVIESNYNTEI 2898
            E +E   +A    + + E   +++     ++  +   ++ I    +Q+ ++ E +  T  
Sbjct: 1081 EIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQ 1140

Query: 2899 DHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXX 3078
             +  +  E + V     D K+   L S    +     +      L+ E+           
Sbjct: 1141 ANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRER------LTSIE 1194

Query: 3079 XXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENC 3258
               R      +  +E+  ++  + +Q         VM   T+L  L ESN  L  E    
Sbjct: 1195 KDFRATDLELQKIKEETHNYPDLLEQHKT------VMSQLTQLDLLRESNITLRNETIEL 1248

Query: 3259 TKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQG 3438
               N+ L +++ ++  KL PLE E+  L   + EK++ L+IC EE ERWK RSQ IL + 
Sbjct: 1249 QSKNQHLQTEVENLHDKLLPLETELQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKY 1308

Query: 3439 KIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQ 3618
            + ++   H    E+   L+ QLE    EN +L +RF++LKKQAHEKL+A+K  Q +LT Q
Sbjct: 1309 QRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQ 1368

Query: 3619 INELNETKVNLEKSLQQEIEKN---NQSGNGAADESEEIIRLRAELE----KSNNFSNEL 3777
            IN+L   K  L   L+ E E      +        S +I+ ++++LE    KS +F  + 
Sbjct: 1369 INDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKF 1428

Query: 3778 EKKVEDAKKFK----NEIESLKSE---LQSVKAYENST-----------------VNSKI 3885
               VE +K+ +    +EI+ L+ E   LQ   A+E  T                 V++ I
Sbjct: 1429 INSVESSKQIEENLNSEIKKLQEESSKLQEELAHEKLTTSTTEIGNVDQDTVDGGVSNDI 1488

Query: 3886 IKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXX 4065
            ++ +K+SF+ EK + IE+               + A+ +   +       N         
Sbjct: 1489 VESMKQSFEEEKIKFIEEQTTEFKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEE 1548

Query: 4066 XXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKL----RELGLNA 4233
                    +RI EAEENLK+R+RLP+EEKIN VI+KRR  LE EF+ K+    +EL    
Sbjct: 1549 YEQATS--QRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGD 1606

Query: 4234 DGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLS 4413
            + N      + +I++EL  K+  EL  +KKKAF+EG+QQ +MK++ LE+K++KLES   +
Sbjct: 1607 EKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQN 1666

Query: 4414 PTKNNDSNETQV 4449
               N  + +  +
Sbjct: 1667 AKSNTGATDNTI 1678

 Score =  255 bits (652), Expect = 9e-68
 Identities = 326/1571 (20%), Positives = 663/1571 (42%), Gaps = 104/1571 (6%)
 Frame = +1

Query: 4    STDSRNEPTPSI-IDKISSFFDLPGNTWESMDEHALEKI---YTKAYDLMKENSFVSAAI 171
            +TDS   P  S  I K++SF D   +  +++DE  L+ +   + +   +  E   +S  +
Sbjct: 8    TTDSNKNPLSSATIAKVASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTEL 67

Query: 172  DDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEFDSNDALNSEI 351
            +  K      I  +  +                    A +K+  E++K+ D+ D L S++
Sbjct: 68   EVTKKTNNTTIKKLKNELTELIDSYESVCKEKED---AYKKIAEEEEKKIDNRDELESKL 124

Query: 352  TLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQD-----SLTENSALKEQIGVFEGK 516
              I     +++ + + L++++++    L+    EL +      L  N   K +  + +  
Sbjct: 125  IQI----HSLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQ-- 178

Query: 517  LDSMTQELWLAN----TENKKLQTGMKLLRENNLYLEIKCKETDKNKKLY--SSAEDASR 678
            L++  Q+L + +    T+ ++L   ++ + +  L+LE +  E  +    Y   S  +   
Sbjct: 179  LENENQDLKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQD 238

Query: 679  LQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITL 858
            L+ QL  V +E+  +KS    L+   + LS  L+     +K++  + N+ K    KE+TL
Sbjct: 239  LKLQLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTL 298

Query: 859  KQRVNELLHNEIASYKKQIER---LTSKNLETPEKK---IIQELVDLKEKLVNSEKECNE 1020
            KQ++  +L +++   +++      LT  +  +  +K     +E+ DLK +L + ++   E
Sbjct: 299  KQQLIVVLQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVE 358

Query: 1021 LKSTVDK---YINIDEK----KLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLV 1179
            L+  + K   Y  +        L +        I++L+++L  E+  ++  ++ +E F+ 
Sbjct: 359  LEFKLRKSEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMD 418

Query: 1180 ELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDE 1359
            +LE +LP +++++ R ++ E EL   T  LE+  KE+ +   EL   Q +I + EQ    
Sbjct: 419  DLETELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKL 478

Query: 1360 LLRQRSDLAHQVQYLL----LCIDNKSPFTEKEATLVKKIVSNENTEND--TDSHKIISK 1521
            + +QRSDLA+Q+Q+ L    +  D+  P T++E   ++ I+  ++  +D  TD+ K+IS+
Sbjct: 479  VAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISE 538

Query: 1522 RLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLE 1701
            RL  F+++ ELQQKNM                ++ +Q      +   I E AK   + L+
Sbjct: 539  RLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEETIAE-AKEAILTLQ 597

Query: 1702 KHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQ 1881
             +  +L +KI  +++E ++YK+L                     + +K+R   E+     
Sbjct: 598  NYNSSLTAKIAALTKELETYKVL-----------SNTEDSSTPADFDKQREQREI----- 641

Query: 1882 QHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYV----------DK 2031
            +H ++++ELE +I ++ +    +   +       DE   NN++  E            ++
Sbjct: 642  EHTQLVKELETRIASIIQESKENANILNDKIFALDE--KNNHISIELAREKSAKQLAEER 699

Query: 2032 LENKIKTLEQDLAENELFEKNLITGGVNNLEQSKII------------ELSVAEQKISFL 2175
            L+   K+++  + ENE  +K L +     +EQ K              EL+  E K +  
Sbjct: 700  LKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVS 759

Query: 2176 DKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERE-LPKNTQIKNEEKEPAK 2352
              EI  L S  + L++++  +   KN +   V +L+T  SERE L   TQ K  ++    
Sbjct: 760  QNEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDL 819

Query: 2353 QQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLD------MKTES 2514
            + T    RKKL+   ++  S +  E   EL++ FR  ++ LKE   +++      ++ E 
Sbjct: 820  EGTCNDLRKKLKEAEENYGSLM--EETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKER 877

Query: 2515 HLKLENKYTKVKNDLKQAT-----YK-----------LASVYTTLEQKNSFLANSVSQLQ 2646
              K EN  T++   LK+ T     YK           ++S+   L+   + L  S SQ +
Sbjct: 878  ETKWEN--TRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTE 935

Query: 2647 GXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLS 2826
                             +++   E    E+I    +    + + NT  K       N L 
Sbjct: 936  SYRKDIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELE 995

Query: 2827 RLRQAINSIQQQSLVIESNYNTEIDHANERLEEA----EVKMASFDGKVTEILE------ 2976
              ++     + + +    N N E++   + LE++    E K+ S    + E ++      
Sbjct: 996  VQKKL---YEDEKINFTRNAN-ELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQ 1051

Query: 2977 -SYDGKILNTAAIGHLV----------RSLIHEKKMXXXXXXXXXXXXRRARYRNKNPRE 3123
             +Y+ ++ N A +   +          R+ I E  +            + +  + ++  E
Sbjct: 1052 NNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYE 1111

Query: 3124 KFPSFVK--IDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLAD 3297
            K   F K  I+++S          + TT+    + + +  +  +E   K+  +L S+   
Sbjct: 1112 KQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDL 1171

Query: 3298 MQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLE 3477
            +Q +L   E E   L+ ++   E+       EL+  K++ +T      + + +  M  L 
Sbjct: 1172 LQERLNVTEAEEKLLRERLTSIEKDFRATDLELQ--KIKEETHNYPDLLEQHKTVMSQLT 1229

Query: 3478 KIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEK 3657
            ++  L E   T+R E  +L  +   L+ +     D    ++  L T  N + E    L  
Sbjct: 1230 QLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLETELQTLTNLIEEKDKQL-S 1288

Query: 3658 SLQQEIEKNNQSGNGAADESEEIIRLRAE--LEKSNNFSNELEKKVEDAKKFKNEIESLK 3831
               +E E+  Q       + + I  +  E   E+ N    +LE+K ++ ++  N  E LK
Sbjct: 1289 ICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLK 1348

Query: 3832 SELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNI 4011
             +          + NS  I+      + +K EL+ Q+               +  + ++ 
Sbjct: 1349 KQAHEKLNASKISQNSLTIQ--INDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNSHD 1406

Query: 4012 LANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLE 4191
            + + Q                    ++   + EENL   ++   EE      + + ++  
Sbjct: 1407 IVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNSEIKKLQEES----SKLQEELAH 1462

Query: 4192 QEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTL 4371
            ++  T   E+G N D + V       I + +++ F     E K K  EE   +   K   
Sbjct: 1463 EKLTTSTTEIG-NVDQDTVDGGVSNDIVESMKQSFE----EEKIKFIEEQTTEFKKK--- 1514

Query: 4372 LERKLSKLESQ 4404
            L+ +++KL+++
Sbjct: 1515 LQAEINKLKAE 1525

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  237 bits (605), Expect = 2e-62
 Identities = 299/1317 (22%), Positives = 572/1317 (43%), Gaps = 102/1317 (7%)
 Frame = +1

Query: 298  VSEKQKEF----DSNDALNSEI-----TLIKYDLEAMQRDHTTLEARERKTENVLEQSKL 450
            +S+K +E+    +S+  L+S I     TL K  L + +  +  L+  E +  N ++  K 
Sbjct: 35   LSKKSEEYNSLKESSLGLSSSISELSKTLQKEKLASQETKNELLKLLEERI-NQIDTLKA 93

Query: 451  ELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKE 630
            +L   + EN  L E       ++++   E  L  T+  K+   + L  +   + E +   
Sbjct: 94   DLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTLSLTMKQKQHTESEYLS 153

Query: 631  TDKNKKLYSSAEDAS--RLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKD 804
             +K+ + Y   ++     + + L  + +E+     + A L   NE LS DL+ K+  IK 
Sbjct: 154  KEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAELFKRNEELSKDLRGKISEIKS 213

Query: 805  LDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETP------EKKIIQ 966
            L+++L +S  +F  E  L+ ++   L N+I + ++Q+E L+ +  + P      + ++++
Sbjct: 214  LENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLSDEKFDDPGTQKLDKHELLR 273

Query: 967  ELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKL----------IEILRR 1116
            ++ +L EKL  SE+E   L  +++++ NI E++  S   +              + ILR+
Sbjct: 274  QIKNLNEKLEISERERLSLVHSMEEFQNIPEEESSSVSSHASGRNNSALSLSGDVNILRK 333

Query: 1117 QLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDI 1296
              +KE++ K  L+ Q+   L ELE+ +P + S+KER++ LE+EL      LE   KE   
Sbjct: 334  HFLKERQQKRQLEEQMRQILQELERNMPSLSSYKERSTFLEKELNSSNILLEHIKKENLD 393

Query: 1297 KDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNK----SPFTEKEATLVKK 1464
            K  EL   + + SN     + L  QR+ LA QV+YLLL I N     S    K+  L+ +
Sbjct: 394  KSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQ 453

Query: 1465 IVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLR 1644
             ++    E  +DS KI+ +RL  F+NVKELQ +NM                E+   K + 
Sbjct: 454  YLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQIS 513

Query: 1645 ITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXX 1824
             ++ ++ +  AK   + L+++ + LES+I  +S E    K                    
Sbjct: 514  -SEEDETINDAKEAILVLQEYSQKLESQIKELSDELAVQK----KEKTEKESISAMSKIE 568

Query: 1825 XXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNN 2004
                     L  +LS+  +    +++ L ++I+ L ++     + ++K        +D  
Sbjct: 569  DDASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRY 628

Query: 2005 NLLKEYVDKLENKIKTLEQD---LAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFL 2175
            NLL+  V  L+++ + L+++   L +N L ++   +    +    K  +LS AE +I+ L
Sbjct: 629  NLLEYNVSLLKSEKEELQEEVNKLQQNILDKEKQFSYSSRDYISCK-SKLSTAEAEITSL 687

Query: 2176 --DKEIS-----NLKSKNKNL--EDKILTMTLSK-NLLDNKVLQLETSLSERELPKNTQI 2325
              + E+S      L++K + L  E   L MT+++ N L+N   +L+T L E +   + ++
Sbjct: 688  RAENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLNN---ELQTLLKETKSGYDDKL 744

Query: 2326 KNEEKEPAKQ----QTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQED 2493
            K    +  +     Q       +L+S NDS+I + Y   +++L+     L  ELK+ +E 
Sbjct: 745  KISALKCTQTNNQLQLVQQRMSELKSQNDSEIKW-YKATIDDLKANVFELNEELKQKEEK 803

Query: 2494 LD--MKT-----------------ESHLKLENKYTKVKNDLKQATYKLASVYTTLE-QKN 2613
            ++   KT                 E    LE + ++VK+ L+++  ++      +   K 
Sbjct: 804  IEEFSKTLENVQNELTLANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKR 863

Query: 2614 SFLANSV----------SQLQGXXXXXXXXXXXXXXXTEKLQMAENE---NSEKINNAIV 2754
            SF   S+          S+L                   ++ + ++E   N+  ++   V
Sbjct: 864  SFENKSIQYEDRIKALASKLDSELRERTTLQENLSTLQARMVVQQDELTSNNNTLSELRV 923

Query: 2755 LLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEV 2934
               +++ E  TFKD     ++ ++      +S+ +    I    N+E+    E L E EV
Sbjct: 924  SYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERIMQE-NSELSKVVELLRE-EV 981

Query: 2935 KMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKN 3114
            K  + +G+    LE  +  I     +         EKK+                  N++
Sbjct: 982  KNRTSNGEKEGDLEDTESIIKKGQDVWD------EEKKVFEVQITNLNERLSELLEENES 1035

Query: 3115 PREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLA 3294
               +  S    D+ +           N   L AL      LI+++    K   ++  +L 
Sbjct: 1036 LLARLES---QDKGNNSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKLR 1092

Query: 3295 DMQVKLEPLEQEINELKLKVAEKEQ-------------HLNICQEELERWKLRSQTILQQ 3435
            + +  L     E+ ++K ++ E                HL   +EE  +  L +   ++Q
Sbjct: 1093 ETEHALSENAFELKKIKSQIFELSSLPQNEHDILRHLVHLKEQREEKNKDALGTNKYMEQ 1152

Query: 3436 GKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTD-RFDRLKKQAHEKLDAAKTMQINLT 3612
               V  EA     EKI+ LEEQL   +  N + T    D L ++  +  +  K+  ++  
Sbjct: 1153 PNKVTTEAQ----EKIQDLEEQLNGAK--NLETTSLEHDSLVQEMKDNFEKEKSSLLSQQ 1206

Query: 3613 TQ-INELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKV 3789
             Q I +L + +  L +  ++EI+K          ++EE ++ R  L      +  +EK+ 
Sbjct: 1207 EQEIEKLTDNERKLREFYEEEIQKK-------VSQAEENLKKRIRLPTEEKINGIIEKR- 1258

Query: 3790 EDAKKFKNEIES-----LKSELQSVKAYENSTVNSKIIKDLKESFKRE-KDELIEQM 3942
                  K+E+ES     +K E +S+  + +     KI K+++ES +   + E  EQ+
Sbjct: 1259 ------KSELESSFEQKIKEEAKSLLLHSDDDKIKKIYKEIEESGRETLQQEFDEQL 1309

 Score = 79.3 bits (194), Expect = 7e-14
 Identities = 169/820 (20%), Positives = 321/820 (39%), Gaps = 35/820 (4%)
 Frame = +1

Query: 295  LVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTE 474
            L SEK++  +  + L   I   +       RD+ + +++    E  +   + E + S+  
Sbjct: 638  LKSEKEELQEEVNKLQQNILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIET 697

Query: 475  NSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLY 654
             + L+ +      + +++   +   N+ N +LQT   LL+E          ++  + KL 
Sbjct: 698  QTTLRTKKEALLNERNNLRMTVTQMNSLNNELQT---LLKET---------KSGYDDKLK 745

Query: 655  SSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQ 834
             SA   ++  +QLQ+V   +  LKS+             D + K +  K   D+L ++  
Sbjct: 746  ISALKCTQTNNQLQLVQQRMSELKSQ------------NDSEIKWY--KATIDDLKANVF 791

Query: 835  EFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKEC 1014
            E  +E+  K+   E     + + + ++    SK++   ++ + +EL ++K +L  S  E 
Sbjct: 792  ELNEELKQKEEKIEEFSKTLENVQNELTLANSKDVSEEKRALEKELSEVKSQLEKSNLEV 851

Query: 1015 NELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQK 1194
             E ++ +       E K I      +  I+ L  +L  E R + TLQ  + +    +   
Sbjct: 852  KEYENVISTSKRSFENKSIQY----EDRIKALASKLDSELRERTTLQENLSTLQARM--- 904

Query: 1195 LPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTN-LQKKISNNEQFN---DEL 1362
            +   D     N++L    +   S L E    +D K+ EL + +  K  N +  +   + +
Sbjct: 905  VVQQDELTSNNNTLSELRVSYDSLLLEQKTFKD-KEAELRSVIAVKTGNYDSLSKSYERI 963

Query: 1363 LRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQN 1542
            +++ S+L+  V+ L   + N++   EKE  L              D+  II K     Q+
Sbjct: 964  MQENSELSKVVELLREEVKNRTSNGEKEGDL-------------EDTESIIKKG----QD 1006

Query: 1543 VKELQQKNMXXXXXXXXXXXXXXXXEQEQ-QKTLRITDNNKIVESAKSTSVDLEKHIKTL 1719
            V + ++K                  E E     L   D      SA++ +   E+ +  L
Sbjct: 1007 VWDEEKKVFEVQITNLNERLSELLEENESLLARLESQDKGNNSPSAETNAAGNEETLAAL 1066

Query: 1720 ES-------KINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEK-ERLTNELSSM 1875
             S       K+    +E  S +                       EL+K +    ELSS+
Sbjct: 1067 RSERTSLIEKLTAAQKEERSVR--------HKLRETEHALSENAFELKKIKSQIFELSSL 1118

Query: 1876 KQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTL 2055
             Q    +L  L +      K Q   + E  K AL  ++  +  N   +   + + KI+ L
Sbjct: 1119 PQNEHDILRHLVH-----LKEQ---REEKNKDALGTNKYMEQPN---KVTTEAQEKIQDL 1167

Query: 2056 EQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILT 2235
            E+ L             G  NLE + +   S+ ++     +KE S+L S+ +   +K+  
Sbjct: 1168 EEQL------------NGAKNLETTSLEHDSLVQEMKDNFEKEKSSLLSQQEQEIEKLTD 1215

Query: 2236 MTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEK------------EPAKQQTYTFERK 2379
                      + +Q + S +E  L K  ++  EEK            E + +Q    E K
Sbjct: 1216 NERKLREFYEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAK 1275

Query: 2380 KLESVNDSDISYLYYENLEE-----LQNQFR-----TLRRELKEVQEDLDMKTESHLKLE 2529
             L   +D D     Y+ +EE     LQ +F        ++  +E ++ + MK+     LE
Sbjct: 1276 SLLLHSDDDKIKKIYKEIEESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAF---LE 1332

Query: 2530 NKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQG 2649
             K + ++  LK+   KL +    L++  S      S +QG
Sbjct: 1333 RKISMLEGQLKEKN-KLNNNSKNLKENVSSTDEHNSSIQG 1371

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  227 bits (578), Expect = 4e-59
 Identities = 315/1508 (20%), Positives = 632/1508 (41%), Gaps = 169/1508 (11%)
 Frame = +1

Query: 430  VLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLY 609
            +L+ S L++   +TE +   E+IG    ++ ++T +      E + LQ  ++LL++ +L 
Sbjct: 59   LLKSSNLDMSRIVTERA---EEIGRLRDEVSTVTGQTSALRAELENLQNDLELLKDKDLA 115

Query: 610  LEIKCKETD--------KNKKLYSSAEDASRLQDQLQ-------------IVSSE--ILS 720
            L+ +   T         +N  L +  E A  L    Q             +VS E  +  
Sbjct: 116  LQSERDSTVALLDGLKLENSALRAEIEQAKELASIRQHDYEADLDSKTGALVSKEEELRL 175

Query: 721  LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS 900
             KSE A+L    E LS +L ++   I+ L D     + E+  EI L++    LL  ++AS
Sbjct: 176  AKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQKHRARLLQEQVAS 235

Query: 901  YKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYI--NIDEKKLIS 1074
             +K+ + +  +     E     E V L+++             ++D  +  N +    +S
Sbjct: 236  LEKEAKLVGHETEPEYEIPPPGEEVALQQR---------SHSISMDSLLTGNDETSHSMS 286

Query: 1075 KFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLR 1254
            +  N    I IL  +L +E   K  L++QV  F+ ELEQ  P+I SFK+++   + ++ +
Sbjct: 287  ELNNN---ISILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHK 343

Query: 1255 ITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLL---CIDNK 1425
            +   LE   K+++   +E+   +K++      +  L R+R DLA Q+QYLLL     D+ 
Sbjct: 344  LQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVKDSD 403

Query: 1426 SPFTEKEATLVKKIVS---NENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXX 1596
             P T  E + +K+I++    E   + TDS  IISKR+L F+++ ELQQ+N+         
Sbjct: 404  DPLTSSEFSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTL 463

Query: 1597 XXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVX 1776
                   E++    L   D+ + +  AK T +DL+++  +LE+K+  ++ +  + +    
Sbjct: 464  SDRAETLERK----LESGDSIEAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTS 519

Query: 1777 XXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKM 1956
                                   + L N+  S+  +  + +  L ++I  LQ+S+     
Sbjct: 520  IGDGEFGNSDLSDGNNI------QALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAK 573

Query: 1957 EVE-----KHALNFDEMK---DNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLI---- 2100
            E E     KH +  D +K   D  +L K     L N+IK   Q L E E+     I    
Sbjct: 574  ECESLINSKHLIE-DRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYL 632

Query: 2101 -----TGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDN 2265
                    +    ++ ++E  + +   S ++ +++    +  N +  I  +   +   D 
Sbjct: 633  DCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDE 692

Query: 2266 KVLQLETSLSER----ELPKNTQIKN--EEKEPAKQQTYTFERKKLESVNDSDISYLYYE 2427
            ++  ++ SL  +    EL +NT+++N  + KE +     T  + +LE           ++
Sbjct: 693  QLKDIQVSLQNKIDDLEL-ENTELRNKIDTKETSPSSALTNPKAELEWYQTK------FD 745

Query: 2428 NLEELQNQFRTLRRELKEVQEDLDMKTES------HLKLENKYTKVKNDLKQATYKLASV 2589
            +L    +       E     E L +KT++          +NK  + +  +        ++
Sbjct: 746  SLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGAL 805

Query: 2590 YTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTM 2769
             T L    + L ++  +L+                 E+    ENEN + + + I +L+  
Sbjct: 806  ETELATSRTRLTDTSRELEISSNTIRQYQSEIKVLNERQSELENEN-KHLRDEIAILR-- 862

Query: 2770 VEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEE-----AEV 2934
             +E T     F+  K +L +    +   Q +   +E +Y  EI+     L++      E+
Sbjct: 863  -DELTHNGGEFEREKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEI 921

Query: 2935 KMASFDGKVTEILESYDGKILNTAAIGHLVRSLIH-------EKKMXXXXXXXXXXXXRR 3093
            K+A  D +V E+         N   +  + ++ +        E ++            R 
Sbjct: 922  KLA-HDEEVREVQNRNTETYRNELELVEIRQTKVFVEKEKELESRIKILNEQIELDKERM 980

Query: 3094 ARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENT--TKLLALEESN--AKLIKEVENCT 3261
             ++ ++    +    +  D+++          E T   + L+ E+ N  +KL        
Sbjct: 981  KQFSDEESLLREQVKLLADEKASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKN 1040

Query: 3262 KVNETLS---SQLADMQVKLEPLEQEI-NELKLKVAEKEQHLNICQEELERWKLRSQTI- 3426
            ++ E L+   S++A + +  E  ++E+  E+  +    E+H+     +LE  K  + ++ 
Sbjct: 1041 RLREQLTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEEHI----AQLESLKESNMSLT 1096

Query: 3427 -------LQQGKIVEEEAHMKSLEKIKTLEEQLETVRT-------ENAQLTDRFDRLKKQ 3564
                   ++ G+I+ E   +K+  K K++E QL+  R        +  +L     RLK  
Sbjct: 1097 NEVKLAQMRNGEIIAELNELKT--KFKSVESQLDEARNVLSSKDMKLMELQTECSRLKAT 1154

Query: 3565 AH------------EKLDAAKTMQINLTTQINELNETKVNLE-------KSLQQEIEKNN 3687
            +H            E + A ++    LT Q++ L      LE       +  ++ ++ + 
Sbjct: 1155 SHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASK 1214

Query: 3688 QSGNGAADESEEIIR----LRAELEKSNNFSNELEKKVED-------AKKFKNEIESLKS 3834
             + N   D  E + +    L+  +E+S +  NEL  K+++        K+ K E+ ++ S
Sbjct: 1215 VTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMS 1274

Query: 3835 ELQSVKAYENST----------VNSKI------IKDLKESFKRE---KDELIEQMXXXXX 3957
            + + ++A  N T          +N +I      ++ LKE+   E    +E+   +     
Sbjct: 1275 KNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEPQGNEEMSGVVESMRK 1334

Query: 3958 XXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEEN---LKKR 4128
                     + A  +++     +E   +            +L++++    EEN   +K R
Sbjct: 1335 AFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENTALMKAR 1394

Query: 4129 MRLPS--------------------EEKINAVIEKRRKVLEQEFETKLR--ELGLNADGN 4242
              +P                     +EK + ++  +   LE++F+ ++R  E  LNA   
Sbjct: 1395 SDVPDIETLQKQWEASNKERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKEKELNA--- 1451

Query: 4243 GVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTK 4422
                  + +IE++ +      L  +KK+AFEEGKQQ+ MK ++LERK++KLE+++ +   
Sbjct: 1452 -----LKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKS 1506

Query: 4423 NNDSNETQ 4446
             +D + ++
Sbjct: 1507 GSDMSVSE 1514

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 223/1182 (18%), Positives = 441/1182 (37%), Gaps = 54/1182 (4%)
 Frame = +1

Query: 142  KENSFVSAAIDDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVAREKLVSEKQKEF 321
            K +S ++ + + I H+Y  +IN + Q                     ++  L  E +   
Sbjct: 542  KYDSLMAESSETIGHLYS-QINNLQQ---------------------SKSDLAKECESLI 579

Query: 322  DSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIG 501
            +S   +   + + +  L+  + +++TL  R + T   L++ ++E   ++ +      ++ 
Sbjct: 580  NSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLD 639

Query: 502  VFEGKLDSMTQELWLANTENKKLQTGM-KLLRENN----LYLEIKCKETDKNKKLYSSAE 666
            V + +L++   E  +       ++  + + L+E N    L  +++  + +++++L     
Sbjct: 640  VIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQV 699

Query: 667  DASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAK 846
                  D L++ ++E   L+++I T +    S  T+ + +L   +   D+L+ S      
Sbjct: 700  SLQNKIDDLELENTE---LRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGS------ 750

Query: 847  EITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELK 1026
                    N+ L+ ++      IE LT K           + +D+  +  NS+ +  E +
Sbjct: 751  --------NDALNEKMIECASTIETLTVKT----------QTLDILLQEANSKNKLLEAR 792

Query: 1027 STVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMI 1206
             TVD               +  KL   L  +L   +       R++E     + Q    I
Sbjct: 793  ETVD---------------DVNKLTGALETELATSRTRLTDTSRELEISSNTIRQYQSEI 837

Query: 1207 DSFKERNSSLERELLRITSSL----EETAKERDIKDRELTNLQKKISNNEQFNDELLRQR 1374
                ER S LE E   +   +    +E        +RE   L KK+SN E    EL +  
Sbjct: 838  KVLNERQSELENENKHLRDEIAILRDELTHNGGEFEREKEALMKKLSNLEIRQAELTKLE 897

Query: 1375 SDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKEL 1554
             D   +++ L L +D       K+A L K+I                  +L H + V+E+
Sbjct: 898  EDYTAEIEKLKLDLD-------KQAMLGKEI------------------KLAHDEEVREV 932

Query: 1555 QQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKIN 1734
            Q +N                      +T R   N   +   + T V +EK  K LES+I 
Sbjct: 933  QNRN---------------------TETYR---NELELVEIRQTKVFVEKE-KELESRIK 967

Query: 1735 IISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLT--NELSSMKQQHVKVL--- 1899
            I++++                            EL+KER+   ++  S+ ++ VK+L   
Sbjct: 968  ILNEQ---------------------------IELDKERMKQFSDEESLLREQVKLLADE 1000

Query: 1900 --EELENKIKTLQKSQLTSKMEVEKHAL--NFDEMKDNNNLLKEYVDKLENKIKTLEQDL 2067
               +L +   + + + L  K+  EK  L       +   N L+E + K E++I  L  + 
Sbjct: 1001 KASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNY 1060

Query: 2068 AENELFEKNLITGGVNN--------------LEQSKII---ELSVAEQKISFLDKEISNL 2196
             +     K  +   VNN              L++S +    E+ +A+ +   +  E++ L
Sbjct: 1061 EQ----AKKEVAAEVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNEL 1116

Query: 2197 KSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFER 2376
            K+K K++E ++       +  D K+++L+T  S  +   +   +N  K+ +         
Sbjct: 1117 KTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGNKDSSS-------- 1168

Query: 2377 KKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKND 2556
                            E +  LQ+   TL        E +D    ++ +LE+++ ++K  
Sbjct: 1169 ----------------ELVGALQSSVATL-------TEQVDNLKHANTELEDRFGRLKRQ 1205

Query: 2557 LKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEK 2736
             ++          +L      L    + LQ                 E+ +   NE   K
Sbjct: 1206 ARERLDASKVTINSLRDNVETLTKDKTALQ--------------DVIERSKDELNELRAK 1251

Query: 2737 INNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANER 2916
            I   I     M E  T         K+  + L +   S  Q +  +     + + H  + 
Sbjct: 1252 IQEHIETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIES-LKHEVQY 1310

Query: 2917 LEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRA 3096
            L+EA       + +++ ++ES              +R    ++K+            R A
Sbjct: 1311 LKEASSAEPQGNEEMSGVVES--------------MRKAFEDEKIAFMKATSEDSEARLA 1356

Query: 3097 RYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIK------EVENC 3258
              R K  RE          ++        VME T     L E N  L+K      ++E  
Sbjct: 1357 EERGKLKRE---------MEALEKEKDSLVMEKT----RLGEENTALMKARSDVPDIETL 1403

Query: 3259 TKVNET--------LSSQLAD--MQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWK 3408
             K  E         L  + +D  M+ K++ LE++      +V  KE+ LN  ++E+E  K
Sbjct: 1404 QKQWEASNKERLVLLYKEKSDQMMRAKMDELEEQFQN---RVRNKEKELNALKDEIEE-K 1459

Query: 3409 LRS---QTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTEN 3525
             ++    T++   K   EE   ++  K+  LE ++  +  E+
Sbjct: 1460 CKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAES 1501

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  204 bits (519), Expect = 3e-52
 Identities = 147/437 (33%), Positives = 229/437 (52%), Gaps = 17/437 (3%)
 Frame = +1

Query: 3184 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 3363
            ++E  T+L  L+E N +L +E+    + N  L  QL +   +L+PLE +I+EL + + +K
Sbjct: 826  LIEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDK 885

Query: 3364 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 3543
            +  +N+  E+ E WK R   +    K  + E        +  L++Q+E    EN +L+DR
Sbjct: 886  DNIINVSNEKAENWKTRFNELTLSAKNNDNE-------DLINLQKQVEEKSKENEELSDR 938

Query: 3544 FDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEE 3723
            F+RLKKQA+E+L A+K  Q NLT Q NEL     +LE++L +++E+  +  N  + + +E
Sbjct: 939  FNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQE 998

Query: 3724 I-------IRLRAELEKSNNFSNELEKKVEDAKK----FKNEIES----LKSELQSVKAY 3858
            +        +L   L+KS  F  EL K V +++      KNEIES    LKS+  SV   
Sbjct: 999  LGSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKLKSKESSVGLQ 1058

Query: 3859 ENSTVNSK--IIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQES 4032
            E+   N+K  +I +L+E   + K EL                  +  + +  +L    E 
Sbjct: 1059 ESEIENAKKILIAELEEKLNKTKSEL-----------------DLKHKEELKVLKTEYEG 1101

Query: 4033 ANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKL 4212
                             I KR+ EAEE LK+++RLPSEEKIN +IE +   LE++++ KL
Sbjct: 1102 D----------------IQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKL 1145

Query: 4213 RELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSK 4392
                        V+     IEK ++++F   L   KKKAFEEGKQQ+ MK+  LE K++K
Sbjct: 1146 E----------TVSAESTDIEK-IKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAK 1194

Query: 4393 LESQTLSPTKNNDSNET 4443
            LESQ     +NN+S+ T
Sbjct: 1195 LESQ----LQNNESDVT 1207

 Score =  189 bits (479), Expect = 2e-47
 Identities = 285/1253 (22%), Positives = 535/1253 (42%), Gaps = 86/1253 (6%)
 Frame = +1

Query: 427  NVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNL 606
            N+L ++ ++   +  ENS  +     F  K+D++  ++   N +N KL   +K     N+
Sbjct: 22   NLLNETSIDQLLNYNENSDTESFKDKF--KIDNLNLQIQHINNDNLKLSNQLK-----NI 74

Query: 607  YLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRK 786
              +    + D+NK + +      +L+++ + ++S  L+L  +       N++L+ +L  K
Sbjct: 75   IEKFNLSKIDQNKTIENLKLKLFKLENENKTLNSTNLNLTDK-------NDTLNNNLNLK 127

Query: 787  LFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQ 966
            L  +K+L+DN+         E+ LK+      +N+I    K I++L SK         I+
Sbjct: 128  LIELKNLNDNIT--------ELELKR------NNDIQLKDKLIQQLNSK---------IE 164

Query: 967  ELVDLKEKLVNSEKECNELKSTVD-KYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHK 1143
             L+    KL  S K  NE++   D K IN D +   SK   P    + L +Q        
Sbjct: 165  NLL----KLGKSPKFKNEVEIINDSKTINDDIEN--SKATIPPSPAKALSKQ-------N 211

Query: 1144 DTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQ 1323
            + L+  ++++L ELEQ+LP+I++FK    +L+  L +    +E    ++    + + +++
Sbjct: 212  NGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMK 271

Query: 1324 KKISNNEQFNDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTEN 1491
            K I+      + L  QR+DLAHQ+QYLL+      DN  P ++ E   ++ +++ +    
Sbjct: 272  KTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRL 331

Query: 1492 DTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVE 1671
             +D   +IS RL+ F+++  LQ+KNM                E E + +    DN+ I E
Sbjct: 332  SSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINE 391

Query: 1672 SAKSTSVDLEKH-------IKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXX 1830
             AK T + L+++       I TL+SKI+ +     + K                      
Sbjct: 392  -AKETILSLQEYNNVLKLEIGTLQSKISELQSSIPNSK------------ESEKQHFNYH 438

Query: 1831 CELEKERLTNELSSMKQQHVKVLEELENKIKTL--QKSQLTSKMEVEKHAL-----NFDE 1989
              L K+ L ++LS +       +E L   I+ L  +++ +   +E EK +          
Sbjct: 439  SNLVKD-LESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTL 497

Query: 1990 MKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKIS 2169
            ++++ +LL    ++L +K   LEQ L E    EKNL    +N+  + K   L     +++
Sbjct: 498  LQNSYDLLTLENEELSSKNSMLEQQLNEE---EKNL-NSVLNDYIKCKTNLLDFT-NRLT 552

Query: 2170 FLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSE---------RELPKNTQ 2322
             L+     L+ +N +L+ +I +       LD+K   LE SL           +EL  N  
Sbjct: 553  LLNNNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVKELELNIS 612

Query: 2323 IKNEEK--EPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRREL------- 2475
              NE+K     K Q    E   L S N   IS+ Y + L++ +   +TL   L       
Sbjct: 613  KLNEQKLILERKLQNKNIEIDDLNSSNYDQISW-YQKKLDQYEKTIKTLESRLPADTQNS 671

Query: 2476 KEVQEDL---DMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQ 2646
            K + ED    D +  S +       ++   +   + K   +Y   E+KN  L     +L+
Sbjct: 672  KALVEDKALEDSRDASPVSSSASCNEITIRIFGDSNKTKKIYPIEEEKN--LELITKELE 729

Query: 2647 GXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQ----TMVEENTTFKDAFKHFK 2814
                             EKL+ + N    ++++  V L+    T+ ++   ++   +   
Sbjct: 730  DTKVRVQNLATQNRLLLEKLERSAN---LEVDDIFVSLRYERDTLSDQVVNYEKDMQVIL 786

Query: 2815 NSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKI 2994
              L  ++  +N+   Q L  E+      DH     ++  V   +   K+TE+ E  +  +
Sbjct: 787  ADLESVQSELNAANSQILNFENQRAMVQDH-----KKGNVNEETLIEKLTELDELKERNM 841

Query: 2995 LNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXX 3174
              T  I  L  + I  K               +    N    +K  + + +  +      
Sbjct: 842  ELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDK-DNIINVSNEKAENWK 900

Query: 3175 XXXVMENTTKLLALEESNAKLI---KEVENCTKVNETLS-----------SQLADMQVKL 3312
                  N   L A    N  LI   K+VE  +K NE LS            +L   +V  
Sbjct: 901  TRF---NELTLSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQ 957

Query: 3313 EPLEQEINELKLKVAEKEQHLNICQEELERWK-------LRSQTILQQGKIVEEEAHMKS 3471
              L ++ NELK +  + E++L+   E++ER+K       L+ Q +   G + E+ A+  +
Sbjct: 958  NNLTEQSNELKARNTDLERNLS---EQMERFKELENSISLKDQELGSIGDLKEQLAN--A 1012

Query: 3472 LEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKT------------MQINLTT 3615
            L+K K  EE+L    +E+  L        +  +EKL + ++             +I +  
Sbjct: 1013 LDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKLKSKESSVGLQESEIENAKKILIAE 1072

Query: 3616 QINELNETKVNLEKSLQQEIE--KNNQSGN--GAADESEEIIRLRAELEKSNNFSNELEK 3783
               +LN+TK  L+   ++E++  K    G+      E+EE ++ +  L      +  +E 
Sbjct: 1073 LEEKLNKTKSELDLKHKEELKVLKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIES 1132

Query: 3784 KVEDAKK-FKNEIESLKSELQSV----KAYENSTVNSKIIKDLKESFKREKDE 3927
            KV D ++ +K ++E++ +E   +    + +E++ VN+K     K++F+  K +
Sbjct: 1133 KVADLEEDYKKKLETVSAESTDIEKIKQEFEDNLVNAK-----KKAFEEGKQQ 1180

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 173/829 (20%), Positives = 359/829 (43%), Gaps = 69/829 (8%)
 Frame = +1

Query: 337  LNSEITLIKYDLEAMQRDHTTLEARERKT--ENVLEQSKLELQDSLTENSALKEQIGVFE 510
            L +E T I  +LE  +   +T+ A E+ T  +N  +   LE ++  ++NS L++Q+   E
Sbjct: 470  LYNERTDILINLE--KEKSSTILANEKLTLLQNSYDLLTLENEELSSKNSMLEQQLNEEE 527

Query: 511  GKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQ 690
              L+S+  +     T        + LL  N L LE                E+ + L+ +
Sbjct: 528  KNLNSVLNDYIKCKTNLLDFTNRLTLLNNNKLGLE----------------EENNSLKQE 571

Query: 691  LQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNS-SKQEFAKEITLKQR 867
            ++    +I  L S+    K++ +SL  ++ +   ++K+L+ N++  ++Q+   E  L+ +
Sbjct: 572  IKSNYEQIKDLDSKS---KHLEQSLENEISKYTDKVKELELNISKLNEQKLILERKLQNK 628

Query: 868  ------VNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKS 1029
                  +N   +++I+ Y+K++++   K ++T E ++  +  + K  + +   E +   S
Sbjct: 629  NIEIDDLNSSNYDQISWYQKKLDQY-EKTIKTLESRLPADTQNSKALVEDKALEDSRDAS 687

Query: 1030 TVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELE----QKL 1197
             V    + +E   I  FG+  K  +I     ++E+++ + + +++E   V ++    Q  
Sbjct: 688  PVSSSASCNEIT-IRIFGDSNKTKKIYP---IEEEKNLELITKELEDTKVRVQNLATQNR 743

Query: 1198 PMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRS 1377
             +++   ER+++LE + + ++   E       + + E  ++Q  +++ E    EL    S
Sbjct: 744  LLLEKL-ERSANLEVDDIFVSLRYERDTLSDQVVNYE-KDMQVILADLESVQSELNAANS 801

Query: 1378 DLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQ 1557
             + +      +  D+K     +E TL++K+     TE D                  EL+
Sbjct: 802  QILNFENQRAMVQDHKKGNVNEE-TLIEKL-----TELD------------------ELK 837

Query: 1558 QKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINI 1737
            ++NM                 +  Q+   + +NN  ++     S++  K ++T  S++NI
Sbjct: 838  ERNM-----------------ELTQEIHALNENNIALKCQLEESLERLKPLETKISELNI 880

Query: 1738 ISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENK 1917
            + +++D+  + V                      + E L N L    ++  K  EEL ++
Sbjct: 881  LIEDKDNI-INVSNEKAENWKTRFNELTLSAKNNDNEDLIN-LQKQVEEKSKENEELSDR 938

Query: 1918 IKTLQKSQLTSKMEVEKHALN-----FDEMKDNNNLLK-------EYVDKLENKIKTLEQ 2061
               L+K Q   ++   K A N      +E+K  N  L+       E   +LEN I   +Q
Sbjct: 939  FNRLKK-QANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQ 997

Query: 2062 DLAENELFEKNLITGGVNNLEQSKIIE------LSVAEQKISFLDKEISNLKSKNKNLED 2223
            +L      ++ L     N L++SK  E      +S +E  +S L  EI +L  K K+ E 
Sbjct: 998  ELGSIGDLKEQL----ANALDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKLKSKES 1053

Query: 2224 KI-LTMTLSKNLLDNKVLQLETSL----SERELPKNTQIK--------------NEEKEP 2346
             + L  +  +N     + +LE  L    SE +L    ++K               E +E 
Sbjct: 1054 SVGLQESEIENAKKILIAELEEKLNKTKSELDLKHKEELKVLKTEYEGDIQKRVAEAEEA 1113

Query: 2347 AKQQTYTFERKKLESVNDSDISYL---YYENLEELQNQFRTLRRELKEVQEDL------- 2496
             K++      +K+ ++ +S ++ L   Y + LE +  +   + +  +E +++L       
Sbjct: 1114 LKRKIRLPSEEKINTIIESKVADLEEDYKKKLETVSAESTDIEKIKQEFEDNLVNAKKKA 1173

Query: 2497 --DMKTESHLK---LENKYTKVKNDLK----QATYKLASVYTTLEQKNS 2616
              + K ++ +K   LENK  K+++ L+      T K A V TT  +K++
Sbjct: 1174 FEEGKQQASMKTKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNEKSN 1222

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 131/661 (19%), Positives = 270/661 (40%), Gaps = 60/661 (9%)
 Frame = +1

Query: 277  LVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEAR---ERKTENVLEQSK 447
            L+   KL ++  +  D N +   +I+  +  L+  ++   TLE+R   + +    L + K
Sbjct: 619  LILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESRLPADTQNSKALVEDK 678

Query: 448  LELQDS-----LTENSALKE-QIGVF--------------EGKLDSMTQELWLANTENKK 567
              L+DS     ++ +++  E  I +F              E  L+ +T+EL       + 
Sbjct: 679  A-LEDSRDASPVSSSASCNEITIRIFGDSNKTKKIYPIEEEKNLELITKELEDTKVRVQN 737

Query: 568  LQTGMKLLRE----------NNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEIL 717
            L T  +LL E          +++++ ++ +    + ++ +  +D   +   L+ V SE+ 
Sbjct: 738  LATQNRLLLEKLERSANLEVDDIFVSLRYERDTLSDQVVNYEKDMQVILADLESVQSELN 797

Query: 718  SLKSEIATLKYMNE-SLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEI 894
            +  S+I  L + N+ ++  D ++     + L + L    +   + + L Q ++ L  N I
Sbjct: 798  AANSQI--LNFENQRAMVQDHKKGNVNEETLIEKLTELDELKERNMELTQEIHALNENNI 855

Query: 895  A---SYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKK 1065
            A     ++ +ERL  K LET   ++   L++ K+ ++N   E  E   T       +E  
Sbjct: 856  ALKCQLEESLERL--KPLETKISEL-NILIEDKDNIINVSNEKAENWKT-----RFNELT 907

Query: 1066 LISKFGNPKKLIEILRRQLVKEKRHKDTLQR----------QVESFLVELEQKLPMIDSF 1215
            L +K  + + LI + ++   K K +++   R          ++ +  V         +  
Sbjct: 908  LSAKNNDNEDLINLQKQVEEKSKENEELSDRFNRLKKQANERLHASKVAQNNLTEQSNEL 967

Query: 1216 KERNSSLERELLRITSSLEETAKERDIKDREL---TNLQKKISN----NEQFNDELLRQR 1374
            K RN+ LER L       +E      +KD+EL    +L+++++N    +++F +EL++  
Sbjct: 968  KARNTDLERNLSEQMERFKELENSISLKDQELGSIGDLKEQLANALDKSKKFEEELIKTV 1027

Query: 1375 SDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKEL 1554
            S+    V          S    +  +L +K+ S E++    +S    +K++L    + EL
Sbjct: 1028 SESESLV----------SDLKNEIESLNEKLKSKESSVGLQESEIENAKKIL----IAEL 1073

Query: 1555 QQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIK-TLESKI 1731
            ++K                   +E+ K L+      I +        L++ I+   E KI
Sbjct: 1074 EEK-------LNKTKSELDLKHKEELKVLKTEYEGDIQKRVAEAEEALKRKIRLPSEEKI 1126

Query: 1732 NIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELE 1911
            N I                                     + ++++ +++ + K LE + 
Sbjct: 1127 NTI-------------------------------------IESKVADLEEDYKKKLETVS 1149

Query: 1912 NKIKTLQKSQLTSKMEVEKHALN-----FDEMKDNNNLLKEYVDKLENKIKTLEQDLAEN 2076
             +   ++K     K E E + +N     F+E K   ++  ++   LENKI  LE  L  N
Sbjct: 1150 AESTDIEK----IKQEFEDNLVNAKKKAFEEGKQQASMKTKF---LENKIAKLESQLQNN 1202

Query: 2077 E 2079
            E
Sbjct: 1203 E 1203

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 97/461 (21%), Positives = 176/461 (38%), Gaps = 55/461 (11%)
 Frame = +1

Query: 3208 LALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLE---QEINELKLKVAEKEQHLN 3378
            + +++ N      ++     NE   ++    + K++ L    Q IN   LK++ + +++ 
Sbjct: 16   IPIDQLNLLNETSIDQLLNYNENSDTESFKDKFKIDNLNLQIQHINNDNLKLSNQLKNI- 74

Query: 3379 ICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLK 3558
                 +E++ L     + Q K +E   ++K   K+  LE + +T+ + N  LTD+ D L 
Sbjct: 75   -----IEKFNLSK---IDQNKTIE---NLKL--KLFKLENENKTLNSTNLNLTDKNDTLN 121

Query: 3559 KQAHEKLDAAKTMQINLT-----------------TQINELNETKVNLEKS--LQQEIEK 3681
               + KL   K +  N+T                  Q+N   E  + L KS   + E+E 
Sbjct: 122  NNLNLKLIELKNLNDNITELELKRNNDIQLKDKLIQQLNSKIENLLKLGKSPKFKNEVEI 181

Query: 3682 NNQSG--NGAADESEEII--RLRAELEKSN--------NFSNELEKKVEDAKKFKNEIES 3825
             N S   N   + S+  I       L K N        N+ NELE+++   + FK EIE+
Sbjct: 182  INDSKTINDDIENSKATIPPSPAKALSKQNNGLKSDIQNYLNELEQQLPLIENFKAEIEN 241

Query: 3826 LKSELQS----VKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILA 3993
            L+  L      +++ +N    +  + D  +    EK   IE +              ++ 
Sbjct: 242  LQDNLNKKNLIIESLQNDKKENLKLMDSMKKTINEKSSSIEALDIQRTDLAHQLQYLLIH 301

Query: 3994 QRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEK 4173
                N        + I             L     +   + L K   + S ++ N  + K
Sbjct: 302  SSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTK 361

Query: 4174 RRKVLEQEFETKLRELGLNADG--NGVVTDTRAQI--EKELREKFNLELAEIKKK----- 4326
              + L    E+K  E+  + +   N  + + +  I   +E      LE+  ++ K     
Sbjct: 362  SIRNLAFSLESKESEIKNSRENYDNDTINEAKETILSLQEYNNVLKLEIGTLQSKISELQ 421

Query: 4327 -----AFEEGKQQSMMKSTL---LERKLSKLESQTLSPTKN 4425
                 + E  KQ     S L   LE KLSKL + + S  +N
Sbjct: 422  SSIPNSKESEKQHFNYHSNLVKDLESKLSKLSAYSQSTIEN 462

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score =  175 bits (444), Expect = 4e-43
 Identities = 320/1497 (21%), Positives = 619/1497 (41%), Gaps = 46/1497 (3%)
 Frame = +1

Query: 97   EHALEKIYTKAYDLMKENSFVSAAIDDIKHVYE---GKINTISQKYFXXXXXXXXXXXXX 267
            E  +E++  K+ + + +   +    D +K+ YE   G+  ++S+K               
Sbjct: 732  ELKVEELSNKSKNSISDYESIKNEYDILKNNYEEKEGEFESVSKKL-------------- 777

Query: 268  SGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSK 447
               L  REKL S   ++    +   S++   K ++E ++ +   ++ R+   EN + +  
Sbjct: 778  DELLTEREKLNSVTSEQLKKLEQNKSDLEKCKLNIEKLENELKEVKERKDNAENGVNKMN 837

Query: 448  LELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCK 627
             EL +   E    KEQ+ + +GKL+   QE  ++  E+ K++   +L        +++  
Sbjct: 838  KELSNLSKE----KEQLRIEQGKLEKKIQEQ-ISVYEDSKIKFNQELESTEKQITDLQSN 892

Query: 628  ETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDL 807
               KN +L +  ++ S L  +L    ++  S           +++L   L  KL  + + 
Sbjct: 893  LESKNTELDNLNKEKSGLMKELTEWKAKFKS-----------HDALVPKLTEKLKSLANS 941

Query: 808  DDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKE 987
               L + +  ++ ++     +N+   +E++S  + I      NL+  + KI+ E    K 
Sbjct: 942  YKELQTERDNYSSQLI---EINKNKTSELSSLSESIS-----NLKIEKDKILDE----KS 989

Query: 988  KLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVE 1167
            KL+N   + +EL+S + +   I E++               + +L+  K        ++E
Sbjct: 990  KLIN---KVSELESQITENCKIFEEE---------------KEKLILSK-------DELE 1024

Query: 1168 SFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNN-- 1341
              +++L ++L  +++ KE  S    EL +  ++L    K++D K  EL  L +   NN  
Sbjct: 1025 ELVIDLNEQLKELETQKETTSKNADELNKSIANLNTQLKQKDSKLIELEELVEVTKNNLN 1084

Query: 1342 --EQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKII 1515
              E     L+ + S+L  + + + L ++      E E T +K    +   E DT   K+ 
Sbjct: 1085 DSESQVSNLIAKISELDEENKSVKLEVEK----LENEITEIKNSHKSAQKETDTLQTKLD 1140

Query: 1516 SKRLLHFQNVKE--LQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTS 1689
               LL  Q+ KE  L  KN                   E   TL   +N +  E   S  
Sbjct: 1141 ETELL-LQSSKEEILSLKN-------------------EYSSTLSDKENLENSEKKSSEK 1180

Query: 1690 V-DLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNEL 1866
            + +LEK+   L+ +   I+ E  S K                                E 
Sbjct: 1181 IEELEKNFSNLQEQFENITAENKSLK-------------------------------EEC 1209

Query: 1867 SSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALN--FDEMKDNNNLLKEYVDKLEN 2040
            S  +++   V E+L+      Q  +  S +  EK  LN   D+ +   + L E ++ +  
Sbjct: 1210 SGTEEKFKDVNEKLD------QYGETISSLSDEKDKLNGIIDDKEKIISNLNEKLESISE 1263

Query: 2041 KIKTLEQDLAENELFEK-NLITGGVNNLEQSKIIELSVAEQ-KISF--LDKEISNLKSKN 2208
             I  +E+  A+N L EK   +T  +N+ E       S+ +  KI F  L K  S+  +  
Sbjct: 1264 DIDIIEK--AKNLLEEKLATMTSELNDSENGSSELRSLYDSLKIEFEELQKTNSDKSANL 1321

Query: 2209 KNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLE 2388
            K LE+K  ++T ++ +L     ++E+S+++    K+   K +E    K      ++ KLE
Sbjct: 1322 KELENKHTSLTETQEILLEDKKKMESSINDYVKIKDDLEKEKEDLLNKYNVLEDKKDKLE 1381

Query: 2389 SV---NDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDL 2559
             +   N+S I  L + +++ L+ +    + E+ +++  ++     +     +  K  + L
Sbjct: 1382 IILEENNSSIKVLEH-SIDALKKENEIYKNEIHDMKLQMESSNSEYKNKAGEQEKKISRL 1440

Query: 2560 KQATYKLASVY------TTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAEN 2721
            K+   KL + Y        +E KN  L +   + Q                + K ++   
Sbjct: 1441 KEECNKLKNSYEEKIEKLEVESKNLSLGHDTEKKQ----------FEDKITSLKQEIISI 1490

Query: 2722 ENSEKINNAIVLLQ--TMVEENTTFKDAFKHFKN----SLSRLRQAINSIQQQSLVIESN 2883
            E S+K +  ++  Q  T+ +E    KD F + +N     L   +  INS++++ L IE+ 
Sbjct: 1491 EKSKKQDEKVLKNQKNTLQKELEELKDQFTNSENEYIKKLDNFQNEINSVRKEKLDIEAV 1550

Query: 2884 YNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXX 3063
             N++I+     L ++E K        + ILE  + + L    +  + +SL  + K     
Sbjct: 1551 LNSKIETLKADLSKSEEK--------SLILEKSNKEHLIKMEV--IQKSLEKQNKELDIL 1600

Query: 3064 XXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLA----LEESNA 3231
                           K  +E+  S  K+DQ          V EN   +      L+E  +
Sbjct: 1601 GNEKDTLTMNLNNEIKGLKEEINS--KVDQIGNLKTELNTVSENMEDIQVRYDQLKEEKS 1658

Query: 3232 KLI-KEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWK 3408
            ++  K +E+  K+ E  SS        +  L   +  L+  +  K++   + ++E E  K
Sbjct: 1659 EISDKLIESEEKLKENFSS--------ISDLNSSVISLEASIISKDEEYTLLKKEFEEVK 1710

Query: 3409 LRSQTI-LQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLD- 3582
            +  Q +  Q+ K++EE + MK     +T E +L+ +R E      +FD+ +K  +E  D 
Sbjct: 1711 ISKQELDNQKDKLLEEYSIMK-----RTNESKLKDLRNELDSKIIKFDKERKLLNEGSDN 1765

Query: 3583 AAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKS-- 3756
             A+     +T+   EL   K+  +  +  E+E+N +S N A  E   +++ R E  K   
Sbjct: 1766 IAQEYSEKVTSLEEELRNQKIYSDDKI-SELEENIKSKNNALTEKSNLLQKRLEEIKELE 1824

Query: 3757 ---NNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDE 3927
               + +  +LE  ++++    +E E++  EL SVK  E        IK ++E    ++D 
Sbjct: 1825 STLSKYKADLEATMKNSDLKNDEFENVCKEL-SVKENE--------IKKIEEILSSKEDL 1875

Query: 3928 LIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEA 4107
            + E               ++L  +K + L   QE   +              + K+ITE 
Sbjct: 1876 IAEIESQKDNLKDELNEKSLLLDKKESQLEAFQEDVEVQKEN----------LQKKITE- 1924

Query: 4108 EENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELR 4287
             +NL+K M L +++ +    EK+ + LE + E+    L               + ++   
Sbjct: 1925 YDNLQKLMSLDNKKLVKC--EKQIEDLELKLESSSNHL---------------KEQEGKY 1967

Query: 4288 EKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLS---PTKNNDSNETQV 4449
            EK   E  E KK   E   +  ++++  L+   +K E Q LS    T  N+S  T++
Sbjct: 1968 EKLEFESGENKKLISE---KDELIQTLQLDISNNKDEIQKLSDKISTLQNNSENTEL 2021

 Score =  172 bits (436), Expect = 4e-42
 Identities = 292/1474 (19%), Positives = 611/1474 (41%), Gaps = 92/1474 (6%)
 Frame = +1

Query: 304  EKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSA 483
            E QKE  S +A     ++   + +  Q+D   +E  E     ++E +K  L DS ++ S 
Sbjct: 1038 ETQKETTSKNADELNKSIANLNTQLKQKDSKLIELEE-----LVEVTKNNLNDSESQVSN 1092

Query: 484  LKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSA 663
            L  +I   + +  S+  E+     E  +++   K  ++    L+ K  ET+         
Sbjct: 1093 LIAKISELDEENKSVKLEVEKLENEITEIKNSHKSAQKETDTLQTKLDETEL-------- 1144

Query: 664  EDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFA 843
                     LQ    EILSLK+E ++     E+L    ++   +I++L+ N ++ +++F 
Sbjct: 1145 --------LLQSSKEEILSLKNEYSSTLSDKENLENSEKKSSEKIEELEKNFSNLQEQFE 1196

Query: 844  KEITLKQRVNELLHNEIASYKKQIERL-----TSKNLETPEKKIIQELVDLKEKLVNSEK 1008
                  + + E        +K   E+L     T  +L + EK  +  ++D KEK++++  
Sbjct: 1197 NITAENKSLKEECSGTEEKFKDVNEKLDQYGETISSL-SDEKDKLNGIIDDKEKIISN-- 1253

Query: 1009 ECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELE 1188
              NE   ++ + I+I EK         K L+E     +  E    +    ++ S    L+
Sbjct: 1254 -LNEKLESISEDIDIIEK--------AKNLLEEKLATMTSELNDSENGSSELRSLYDSLK 1304

Query: 1189 QKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLR 1368
             +   +       S+  +EL    +SL ET   ++I   +   ++  I++  +  D+L +
Sbjct: 1305 IEFEELQKTNSDKSANLKELENKHTSLTET---QEILLEDKKKMESSINDYVKIKDDLEK 1361

Query: 1369 QRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVK 1548
            ++ DL ++   L    D      E+  + +K +   E++ +       I K  +H   + 
Sbjct: 1362 EKEDLLNKYNVLEDKKDKLEIILEENNSSIKVL---EHSIDALKKENEIYKNEIHDMKL- 1417

Query: 1549 ELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDN--NKIVESAKSTSVDLEKHIKTLE 1722
            +++  N                 ++E  K     +    K+   +K+ S+  +   K  E
Sbjct: 1418 QMESSNSEYKNKAGEQEKKISRLKEECNKLKNSYEEKIEKLEVESKNLSLGHDTEKKQFE 1477

Query: 1723 SKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLE 1902
             KI  + QE      ++                    + E E L ++ ++ + +++K L+
Sbjct: 1478 DKITSLKQE------IISIEKSKKQDEKVLKNQKNTLQKELEELKDQFTNSENEYIKKLD 1531

Query: 1903 ELENKIKTLQKSQ------LTSKMEVEKHALNFDEMK----DNNNLLKEYVDKLENKIKT 2052
              +N+I +++K +      L SK+E  K  L+  E K    + +N  KE++ K+E   K+
Sbjct: 1532 NFQNEINSVRKEKLDIEAVLNSKIETLKADLSKSEEKSLILEKSN--KEHLIKMEVIQKS 1589

Query: 2053 LEQDLAENELF--EKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDK 2226
            LE+   E ++   EK+ +T  +NN  +    E++    +I  L  E++ +    ++++ +
Sbjct: 1590 LEKQNKELDILGNEKDTLTMNLNNEIKGLKEEINSKVDQIGNLKTELNTVSENMEDIQVR 1649

Query: 2227 ILTMTLSKNLLDNKVLQLETSLSERELP----KNTQIKNEEKEPAKQQTYTFERKKLESV 2394
               +   K+ + +K+++ E  L E         ++ I  E    +K + YT  +K+ E V
Sbjct: 1650 YDQLKEEKSEISDKLIESEEKLKENFSSISDLNSSVISLEASIISKDEEYTLLKKEFEEV 1709

Query: 2395 NDS--DISYLYYENLEELQNQFRTLRRELKEVQEDLD---MKTESHLKLENKYTKVKNDL 2559
              S  ++     + LEE     RT   +LK+++ +LD   +K +   KL N+ +   N  
Sbjct: 1710 KISKQELDNQKDKLLEEYSIMKRTNESKLKDLRNELDSKIIKFDKERKLLNEGS--DNIA 1767

Query: 2560 KQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKI 2739
            ++ + K+ S+   L  +  +  + +S+L+                 +K      E    +
Sbjct: 1768 QEYSEKVTSLEEELRNQKIYSDDKISELEENIKSKNNALTEKSNLLQKRLEEIKELESTL 1827

Query: 2740 NNAIVLLQTMVEENTTFKDAFKHF-------KNSLSRLRQAINSIQQQSLVIESNYNTEI 2898
            +     L+  ++ +    D F++        +N + ++ + ++S +     IES  +   
Sbjct: 1828 SKYKADLEATMKNSDLKNDEFENVCKELSVKENEIKKIEEILSSKEDLIAEIESQKDNLK 1887

Query: 2899 DHANER---LEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXX 3069
            D  NE+   L++ E ++ +F   V    E+   KI       +L + +  + K       
Sbjct: 1888 DELNEKSLLLDKKESQLEAFQEDVEVQKENLQKKI---TEYDNLQKLMSLDNKKLVKCEK 1944

Query: 3070 XXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEV 3249
                   +    + + +E+   + K++ +S          +   + L L+ SN K   E+
Sbjct: 1945 QIEDLELKLESSSNHLKEQEGKYEKLEFESGENKKLISEKDELIQTLQLDISNNK--DEI 2002

Query: 3250 ENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWK------- 3408
            +  +    TL +   + ++ LE  E+ ++EL  K+ EKE  +   + +L + K       
Sbjct: 2003 QKLSDKISTLQNNSENTELTLEEKEKMVDELNSKLQEKEAQVETLELDLNKLKETLDKEL 2062

Query: 3409 ------------LRSQTILQQGKIVEEEAHMKSLEK--------IKTLEE---------- 3498
                        LR + I+Q+ KI E +  +   EK        +K +EE          
Sbjct: 2063 ESSSELQIAHDNLRDENIIQKQKITELKVKIDDSEKDSQVIIDNMKEMEENIMDLRNDLS 2122

Query: 3499 ----QLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQ 3666
                Q+E V  + +      ++L K+  EK     +++  L    ++L+E++ N  K L 
Sbjct: 2123 SKTIQIEKVNEDLSSKNSEIEQLNKKLAEKCAEYDSIKSELVAS-SKLSESEKNDMKQLS 2181

Query: 3667 QEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIES----LKS 3834
             EI   N+       ++E + ++ ++L+ +NN S++   +++ A     EIES    L+ 
Sbjct: 2182 DEI---NELKEQLELKNENLKKVTSDLQIANNTSDKYNDELKVANNTIREIESKIPNLQK 2238

Query: 3835 ELQSVKAYENSTVNSKIIKDLK-ESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNI 4011
            +L   +   N T++SK   D K ++F +E + L +++               L + KN++
Sbjct: 2239 QLDLKEIEYNDTLSSKKDLDKKLDNFSKESEILSKEVKSLKKEKLD------LEKEKNDL 2292

Query: 4012 LANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLE 4191
            +    +  N                   I +    LK+  +  SE +   +I  + K+  
Sbjct: 2293 IVELDKYKN------------------DIIDLNNTLKENEKNGSEVE-TEIIGLKDKI-- 2331

Query: 4192 QEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEI-----KKKAFEE---GKQ 4347
             EF  KL    LN +   + +D +  +  E  +K     +EI     K ++F++     +
Sbjct: 2332 -EF-YKLNVSQLNEEKGKLESDIKTLV-GERDDKLKSSQSEIIELTNKLESFKDISVAYE 2388

Query: 4348 QSMMKSTLLERKLSKLESQTLSPTKNNDSNETQV 4449
            +S ++S  L+ KLS++E       +N DS   ++
Sbjct: 2389 ESKVESDGLKNKLSEIEKSLEESNENVDSANKEI 2422

 Score =  165 bits (418), Expect = 5e-40
 Identities = 296/1373 (21%), Positives = 589/1373 (42%), Gaps = 151/1373 (10%)
 Frame = +1

Query: 277  LVAREKLVSEKQKEFDSN-DALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLE 453
            L+A+   + E+ K      + L +EIT IK   ++ Q++  TL+ +  +TE +L+ SK E
Sbjct: 1093 LIAKISELDEENKSVKLEVEKLENEITEIKNSHKSAQKETDTLQTKLDETELLLQSSKEE 1152

Query: 454  LQDSLTENSAL---KEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKC 624
            +     E S+    KE +   E K     +EL         LQ   + +   N  L+ +C
Sbjct: 1153 ILSLKNEYSSTLSDKENLENSEKKSSEKIEEL---EKNFSNLQEQFENITAENKSLKEEC 1209

Query: 625  KET-----DKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTD----- 774
              T     D N+KL    E  S L D+   ++  I   +  I+ L    ES+S D     
Sbjct: 1210 SGTEEKFKDVNEKLDQYGETISSLSDEKDKLNGIIDDKEKIISNLNEKLESISEDIDIIE 1269

Query: 775  -----LQRKLFRI-KDLDDNLNSSKQEFAKEITLKQRVNEL--LHNEIASYKKQIERLTS 930
                 L+ KL  +  +L+D+ N S +  +   +LK    EL   +++ ++  K++E   +
Sbjct: 1270 KAKNLLEEKLATMTSELNDSENGSSELRSLYDSLKIEFEELQKTNSDKSANLKELENKHT 1329

Query: 931  KNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFG---NPKKLI 1101
               ET E      L++ K+K+ +S  +  ++K  ++K    +++ L++K+    + K  +
Sbjct: 1330 SLTETQEI-----LLEDKKKMESSINDYVKIKDDLEK----EKEDLLNKYNVLEDKKDKL 1380

Query: 1102 EILRRQ---LVKEKRHK-DTLQRQVESFLVEL-EQKLPMIDSFKE----------RNSSL 1236
            EI+  +    +K   H  D L+++ E +  E+ + KL M  S  E          + S L
Sbjct: 1381 EIILEENNSSIKVLEHSIDALKKENEIYKNEIHDMKLQMESSNSEYKNKAGEQEKKISRL 1440

Query: 1237 ERELLRITSSLEETAKERDIKDREL---------------TNLQKKISNNEQFNDE---- 1359
            + E  ++ +S EE  ++ +++ + L               T+L+++I + E+   +    
Sbjct: 1441 KEECNKLKNSYEEKIEKLEVESKNLSLGHDTEKKQFEDKITSLKQEIISIEKSKKQDEKV 1500

Query: 1360 LLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQ 1539
            L  Q++ L  +++ L      K  FT  E   +KK+ + +N  N     K+  + +L+ +
Sbjct: 1501 LKNQKNTLQKELEEL------KDQFTNSENEYIKKLDNFQNEINSVRKEKLDIEAVLNSK 1554

Query: 1540 ------NVKELQQKNMXXXXXXXXXXXXXXXXE---QEQQKTLRITDNNKIVESAKSTSV 1692
                  ++ + ++K++                +   ++Q K L I  N K      + ++
Sbjct: 1555 IETLKADLSKSEEKSLILEKSNKEHLIKMEVIQKSLEKQNKELDILGNEK-----DTLTM 1609

Query: 1693 DLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSS 1872
            +L   IK L+ +IN    + D    L                     + EK  ++++L  
Sbjct: 1610 NLNNEIKGLKEEIN---SKVDQIGNLKTELNTVSENMEDIQVRYDQLKEEKSEISDKLIE 1666

Query: 1873 MKQ---QHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKL--- 2034
             ++   ++   + +L + + +L+ S ++   E       F+E+K +   L    DKL   
Sbjct: 1667 SEEKLKENFSSISDLNSSVISLEASIISKDEEYTLLKKEFEEVKISKQELDNQKDKLLEE 1726

Query: 2035 --------ENKIKTLEQDLAENELF---EKNLITGGVNNLEQSKIIELSVAEQKIS---- 2169
                    E+K+K L  +L    +    E+ L+  G +N+ Q    +++  E+++     
Sbjct: 1727 YSIMKRTNESKLKDLRNELDSKIIKFDKERKLLNEGSDNIAQEYSEKVTSLEEELRNQKI 1786

Query: 2170 FLDKEIS----NLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELP---KNTQIK 2328
            + D +IS    N+KSKN  L +K  +  L K L + K L+   S  + +L    KN+ +K
Sbjct: 1787 YSDDKISELEENIKSKNNALTEK--SNLLQKRLEEIKELESTLSKYKADLEATMKNSDLK 1844

Query: 2329 NEEKEPAKQQTYTFER--KKLESVNDSDISYL-----YYENLEELQNQFRTL----RREL 2475
            N+E E   ++    E   KK+E +  S    +       +NL++  N+   L      +L
Sbjct: 1845 NDEFENVCKELSVKENEIKKIEEILSSKEDLIAEIESQKDNLKDELNEKSLLLDKKESQL 1904

Query: 2476 KEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXX 2655
            +  QED++++ E+  K   +Y  ++  +     KL      +E     L +S + L+   
Sbjct: 1905 EAFQEDVEVQKENLQKKITEYDNLQKLMSLDNKKLVKCEKQIEDLELKLESSSNHLKEQE 1964

Query: 2656 XXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLR 2835
                          EKL+    EN + I+    L+QT+  + +  KD  +   + +S L+
Sbjct: 1965 GKY-----------EKLEFESGENKKLISEKDELIQTLQLDISNNKDEIQKLSDKISTLQ 2013

Query: 2836 QAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAI- 3012
               N+ +   L +E      +D  N +L+E E ++ + +  + ++ E+ D ++ +++ + 
Sbjct: 2014 ---NNSENTELTLEEKEKM-VDELNSKLQEKEAQVETLELDLNKLKETLDKELESSSELQ 2069

Query: 3013 ---GHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKI--DQQSXXXXXX 3177
                +L    I +K+             + ++    N +E   + + +  D  S      
Sbjct: 2070 IAHDNLRDENIIQKQKITELKVKIDDSEKDSQVIIDNMKEMEENIMDLRNDLSSKTIQIE 2129

Query: 3178 XXVMENTTKLLALEESNAKLIKEVENCTKVNETL--SSQLADMQVK-LEPLEQEINELKL 3348
                + ++K   +E+ N KL ++      +   L  SS+L++ +   ++ L  EINELK 
Sbjct: 2130 KVNEDLSSKNSEIEQLNKKLAEKCAEYDSIKSELVASSKLSESEKNDMKQLSDEINELKE 2189

Query: 3349 KVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLE-KIKTLEEQLETVRTE- 3522
            ++  K ++L     +L+     S     + K+      ++ +E KI  L++QL+    E 
Sbjct: 2190 QLELKNENLKKVTSDLQIANNTSDKYNDELKVANNT--IREIESKIPNLQKQLDLKEIEY 2247

Query: 3523 NAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEK---SLQQEIEK---- 3681
            N  L+      KK   +KLD        L+ ++  L + K++LEK    L  E++K    
Sbjct: 2248 NDTLSS-----KKDLDKKLDNFSKESEILSKEVKSLKKEKLDLEKEKNDLIVELDKYKND 2302

Query: 3682 ----NN---QSGNGAADESEEIIRLRAELE-------KSNNFSNELEKKV--------ED 3795
                NN   ++    ++   EII L+ ++E       + N    +LE  +        + 
Sbjct: 2303 IIDLNNTLKENEKNGSEVETEIIGLKDKIEFYKLNVSQLNEEKGKLESDIKTLVGERDDK 2362

Query: 3796 AKKFKNEIESLKSELQSVK----AYENSTVNSKIIKDLKESFKREKDELIEQM 3942
             K  ++EI  L ++L+S K    AYE S V S  +K+     ++  +E  E +
Sbjct: 2363 LKSSQSEIIELTNKLESFKDISVAYEESKVESDGLKNKLSEIEKSLEESNENV 2415

 Score =  145 bits (366), Expect = 6e-34
 Identities = 257/1246 (20%), Positives = 497/1246 (39%), Gaps = 47/1246 (3%)
 Frame = +1

Query: 124  KAYDLMKENSFVSAAIDDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVA-REKLV 300
            KA +  K+ S +    + +K+ YE KI  +  +                  + + +++++
Sbjct: 1429 KAGEQEKKISRLKEECNKLKNSYEEKIEKLEVESKNLSLGHDTEKKQFEDKITSLKQEII 1488

Query: 301  S-EKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARE-RKTENVLEQSKLELQDSLTE 474
            S EK K+ D     N + TL K +LE ++   T  E    +K +N   +     ++ L  
Sbjct: 1489 SIEKSKKQDEKVLKNQKNTLQK-ELEELKDQFTNSENEYIKKLDNFQNEINSVRKEKLDI 1547

Query: 475  NSALKEQIGVFEGKLDSMTQELWLANTENK----KLQTGMKLLRENNLYLEIKCKETDKN 642
             + L  +I   +  L    ++  +    NK    K++   K L + N  L+I   E  K+
Sbjct: 1548 EAVLNSKIETLKADLSKSEEKSLILEKSNKEHLIKMEVIQKSLEKQNKELDILGNE--KD 1605

Query: 643  KKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLN 822
                +   +   L++++     +I +LK+E+ T+    E +     +      ++ D L 
Sbjct: 1606 TLTMNLNNEIKGLKEEINSKVDQIGNLKTELNTVSENMEDIQVRYDQLKEEKSEISDKLI 1665

Query: 823  SSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKII-QELVDLKEKLVN 999
             S+++  +  +    +N  + +  AS   + E  T    E  E KI  QEL + K+KL+ 
Sbjct: 1666 ESEEKLKENFSSISDLNSSVISLEASIISKDEEYTLLKKEFEEVKISKQELDNQKDKLLE 1725

Query: 1000 --------SEKECNELKSTVD-KYINIDEKKLISKFGNPK----------KLIEILRRQL 1122
                    +E +  +L++ +D K I  D+++ +   G+             L E LR Q 
Sbjct: 1726 EYSIMKRTNESKLKDLRNELDSKIIKFDKERKLLNEGSDNIAQEYSEKVTSLEEELRNQK 1785

Query: 1123 VKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKD 1302
            +        L+  ++S    L +K  ++    E    LE  L +  + LE T K  D+K+
Sbjct: 1786 IYSDDKISELEENIKSKNNALTEKSNLLQKRLEEIKELESTLSKYKADLEATMKNSDLKN 1845

Query: 1303 RELTNLQKKIS---NNEQFNDELLRQRSDLAHQVQYLLLCIDN-KSPFTEKEATLVKKIV 1470
             E  N+ K++S   N  +  +E+L  + DL  +++      DN K    EK   L KK  
Sbjct: 1846 DEFENVCKELSVKENEIKKIEEILSSKEDLIAEIESQK---DNLKDELNEKSLLLDKKES 1902

Query: 1471 SNENTENDTDSHKI-ISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRI 1647
              E  + D +  K  + K++  + N+++L                               
Sbjct: 1903 QLEAFQEDVEVQKENLQKKITEYDNLQKLMS----------------------------- 1933

Query: 1648 TDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXX 1827
             DN K+V+  K    DLE     LES  N + ++   Y+ L                   
Sbjct: 1934 LDNKKLVKCEKQIE-DLELK---LESSSNHLKEQEGKYEKLEFESGENKKLIS------- 1982

Query: 1828 XCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNN 2007
                EK+ L   L      +   +++L +KI TLQ +   +++ +E+     DE+     
Sbjct: 1983 ----EKDELIQTLQLDISNNKDEIQKLSDKISTLQNNSENTELTLEEKEKMVDELNSKLQ 2038

Query: 2008 LLKEYVDKLE---NKIK-TLEQDL---AENELFEKNLITGGVNNLEQSKIIELSVAEQKI 2166
              +  V+ LE   NK+K TL+++L   +E ++   NL     N +++ KI EL V   KI
Sbjct: 2039 EKEAQVETLELDLNKLKETLDKELESSSELQIAHDNL--RDENIIQKQKITELKV---KI 2093

Query: 2167 SFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEP 2346
               +K+   +    K +E+ I+ +   +N L +K +Q+E  ++E    KN++I+   K+ 
Sbjct: 2094 DDSEKDSQVIIDNMKEMEENIMDL---RNDLSSKTIQIE-KVNEDLSSKNSEIEQLNKKL 2149

Query: 2347 AKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKL 2526
            A ++   ++  K E V  S +S       E  +N  + L  E+ E++E L++K E+  K+
Sbjct: 2150 A-EKCAEYDSIKSELVASSKLS-------ESEKNDMKQLSDEINELKEQLELKNENLKKV 2201

Query: 2527 ENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKL 2706
             +      N   +   +L     T+ +  S + N   QL                  +  
Sbjct: 2202 TSDLQIANNTSDKYNDELKVANNTIREIESKIPNLQKQL------------------DLK 2243

Query: 2707 QMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIE-SN 2883
            ++  N+      +    L    +E+       K  K     L +     ++  L++E   
Sbjct: 2244 EIEYNDTLSSKKDLDKKLDNFSKESEILSKEVKSLKKEKLDLEK-----EKNDLIVELDK 2298

Query: 2884 YNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXX 3063
            Y  +I   N  L+E E   +  + ++  + +  +   LN + +      L  + K     
Sbjct: 2299 YKNDIIDLNNTLKENEKNGSEVETEIIGLKDKIEFYKLNVSQLNEEKGKLESDIKTLVGE 2358

Query: 3064 XXXXXXXXRRARYRNKNPREKFPSF-VKIDQQSXXXXXXXXVMENTTKLLALEESNAKL- 3237
                    +       N  E F    V  ++           +    K  +LEESN  + 
Sbjct: 2359 RDDKLKSSQSEIIELTNKLESFKDISVAYEESKVESDGLKNKLSEIEK--SLEESNENVD 2416

Query: 3238 --IKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKL 3411
               KE+ +   +N+ L S   +++ K + L+ +  E   K+    Q +N           
Sbjct: 2417 SANKEISDLKVMNDKLQSHNLELEDKFQQLKNDTTETNRKI----QDIN----------- 2461

Query: 3412 RSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAK 3591
                     K+ EEE+  K+ EKI++L E++E ++ +           KK   +  D ++
Sbjct: 2462 ---------KLKEEES-SKAEEKIRSLTEEIEKLKND----------FKKNESKAPDTSE 2501

Query: 3592 TMQINLTTQINELNETKVNLEKSLQQ---EIEKNNQSGNGAADESE 3720
               + L   +++L+E     +  L++   E+  + ++ +   DE E
Sbjct: 2502 IDDLMLL--VSDLDEKNSKYKAKLEELGVELSSDEETESDDTDEEE 2545

 Score =  107 bits (268), Expect = 2e-22
 Identities = 188/948 (19%), Positives = 390/948 (41%), Gaps = 82/948 (8%)
 Frame = +1

Query: 1834 ELEKE--RLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNN 2007
            EL++E  +L  EL+ M      V+ ELE K++ L      S  + E     +D +K+N  
Sbjct: 705  ELQRECSKLKGELNDMFVSKGDVINELELKVEELSNKSKNSISDYESIKNEYDILKNN-- 762

Query: 2008 LLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEI 2187
              +E   + E+  K L++ L E E    ++ +  +  LEQ+K  +L   +  I  L+ E+
Sbjct: 763  -YEEKEGEFESVSKKLDELLTEREKL-NSVTSEQLKKLEQNK-SDLEKCKLNIEKLENEL 819

Query: 2188 SNLKSKNKNLEDKILTMT--LSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQT 2361
              +K +  N E+ +  M   LS    + + L++E    E+++ +   +  + K    Q+ 
Sbjct: 820  KEVKERKDNAENGVNKMNKELSNLSKEKEQLRIEQGKLEKKIQEQISVYEDSKIKFNQEL 879

Query: 2362 YTFERK------KLESVN------DSDISYLYYENLE-------------ELQNQFRTLR 2466
             + E++       LES N      + + S L  E  E             +L  + ++L 
Sbjct: 880  ESTEKQITDLQSNLESKNTELDNLNKEKSGLMKELTEWKAKFKSHDALVPKLTEKLKSLA 939

Query: 2467 RELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQ 2646
               KE+Q + D  +   +++    T   + L ++   L      +  + S L N VS+L+
Sbjct: 940  NSYKELQTERDNYSSQLIEINKNKTSELSSLSESISNLKIEKDKILDEKSKLINKVSELE 999

Query: 2647 GXXXXXXXXXXXXXXXTEKLQMAENENSE---KINNAIVLLQTMVEENTTFKDAFKHFKN 2817
                             EKL ++++E  E    +N  +  L+T  ++ TT K+A      
Sbjct: 1000 S---QITENCKIFEEEKEKLILSKDELEELVIDLNEQLKELET--QKETTSKNA-DELNK 1053

Query: 2818 SLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKIL 2997
            S++ L   +   Q+ S +IE     E+   N  L ++E ++++   K++E+ E      L
Sbjct: 1054 SIANLNTQLK--QKDSKLIELEELVEVTKNN--LNDSESQVSNLIAKISELDEENKSVKL 1109

Query: 2998 NTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVK--IDQQSXXXX 3171
                + + +  + +  K                    ++ +E+  S         S    
Sbjct: 1110 EVEKLENEITEIKNSHKSAQKETDTLQTKLDETELLLQSSKEEILSLKNEYSSTLSDKEN 1169

Query: 3172 XXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEIN---EL 3342
                  +++ K+  LE++ + L ++ EN T  N++L  + +  + K + + ++++   E 
Sbjct: 1170 LENSEKKSSEKIEELEKNFSNLQEQFENITAENKSLKEECSGTEEKFKDVNEKLDQYGET 1229

Query: 3343 KLKVAEKEQHLNICQEELER----WKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLET 3510
               +++++  LN   ++ E+       + ++I +   I+E+  ++   EK+ T+  +L  
Sbjct: 1230 ISSLSDEKDKLNGIIDDKEKIISNLNEKLESISEDIDIIEKAKNLLE-EKLATMTSELND 1288

Query: 3511 VRTENAQLTDRFDRLKKQAHE--KLDAAKTMQI----NLTTQINELNETKVNLEKSLQQE 3672
                +++L   +D LK +  E  K ++ K+  +    N  T + E  E  +  +K ++  
Sbjct: 1289 SENGSSELRSLYDSLKIEFEELQKTNSDKSANLKELENKHTSLTETQEILLEDKKKMESS 1348

Query: 3673 IEKNNQSGNGAADESEEII-----------RLRAELEKSNNFSNELEKKVEDAKK----F 3807
            I    +  +    E E+++           +L   LE++N+    LE  ++  KK    +
Sbjct: 1349 INDYVKIKDDLEKEKEDLLNKYNVLEDKKDKLEIILEENNSSIKVLEHSIDALKKENEIY 1408

Query: 3808 KNEIESLKSELQSVKA-YENST-VNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXX 3981
            KNEI  +K +++S  + Y+N      K I  LKE   + K+   E++             
Sbjct: 1409 KNEIHDMKLQMESSNSEYKNKAGEQEKKISRLKEECNKLKNSYEEKI------------E 1456

Query: 3982 TILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINA 4161
             +  + KN  L +  E                  + + I   E++ K+  ++   +K   
Sbjct: 1457 KLEVESKNLSLGHDTEKKQF--------EDKITSLKQEIISIEKSKKQDEKVLKNQK--N 1506

Query: 4162 VIEKRRKVLEQEFETKLRELGLNADG--NGV--VTDTRAQIEKELREKF-----NLELAE 4314
             ++K  + L+ +F     E     D   N +  V   +  IE  L  K      +L  +E
Sbjct: 1507 TLQKELEELKDQFTNSENEYIKKLDNFQNEINSVRKEKLDIEAVLNSKIETLKADLSKSE 1566

Query: 4315 IKKKAFEEGKQQSMMKSTLLERKLSKL---------ESQTLSPTKNND 4431
             K    E+  ++ ++K  ++++ L K          E  TL+   NN+
Sbjct: 1567 EKSLILEKSNKEHLIKMEVIQKSLEKQNKELDILGNEKDTLTMNLNNE 1614

 Score = 62.8 bits (151), Expect = 9e-09
 Identities = 124/503 (24%), Positives = 200/503 (39%), Gaps = 31/503 (6%)
 Frame = +1

Query: 3217 EESNAKLIKEV-----ENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNI 3381
            +ES AK+  E        C+K    L  +L DM V    +   INEL+LKV E       
Sbjct: 692  QESIAKISFETFDELQRECSK----LKGELNDMFVSKGDV---INELELKVEELSNKSKN 744

Query: 3382 CQEELERWKLRSQTILQ--QGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRL 3555
               + E  K     +    + K  E E+  K L+++ T  E+L +V +E         +L
Sbjct: 745  SISDYESIKNEYDILKNNYEEKEGEFESVSKKLDELLTEREKLNSVTSE---------QL 795

Query: 3556 KKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRL 3735
            KK    K D  K  ++N+    NEL E K           E+ + + NG    ++E+  L
Sbjct: 796  KKLEQNKSDLEKC-KLNIEKLENELKEVK-----------ERKDNAENGVNKMNKELSNL 843

Query: 3736 RAELEKSNNFSNELEKKV-------EDAK-KFKNEIESLKSELQSVKAYENSTVNSKIIK 3891
              E E+      +LEKK+       ED+K KF  E+ES + ++  ++    S + SK  +
Sbjct: 844  SKEKEQLRIEQGKLEKKIQEQISVYEDSKIKFNQELESTEKQITDLQ----SNLESKNTE 899

Query: 3892 DLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANG----QESANIXXXXXX 4059
               ++  +EK  L++++                   K   LAN     Q   +       
Sbjct: 900  --LDNLNKEKSGLMKELTEWKAKFKSHDALVPKLTEKLKSLANSYKELQTERDNYSSQLI 957

Query: 4060 XXXXXXALILKRITEAEENLKKRMRLPSEEK---INAVIEKRRKVLE--QEFETKLRELG 4224
                     L  ++E+  NLK       +EK   IN V E   ++ E  + FE +  +L 
Sbjct: 958  EINKNKTSELSSLSESISNLKIEKDKILDEKSKLINKVSELESQITENCKIFEEEKEKLI 1017

Query: 4225 LNADG-NGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKL-E 4398
            L+ D    +V D   Q+ KEL  +      E   K  +E  +     +T L++K SKL E
Sbjct: 1018 LSKDELEELVIDLNEQL-KELETQ-----KETTSKNADELNKSIANLNTQLKQKDSKLIE 1071

Query: 4399 SQTLSPTKNNDSNETQVXXXXXXXXXXXXXXXXGEKVLQLNYGANVVAETDNDDNPF--- 4569
             + L     N+ N+++                     L++    N + E  N        
Sbjct: 1072 LEELVEVTKNNLNDSESQVSNLIAKISELDEENKSVKLEVEKLENEITEIKNSHKSAQKE 1131

Query: 4570 --TLQSGKDETLLTKRSADNEII 4632
              TLQ+  DET L  +S+  EI+
Sbjct: 1132 TDTLQTKLDETELLLQSSKEEIL 1154

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score =  171 bits (434), Expect = 5e-42
 Identities = 256/1275 (20%), Positives = 520/1275 (40%), Gaps = 44/1275 (3%)
 Frame = +1

Query: 685  DQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQ 864
            ++ + +     +LK E+  L+  N++LS DL  KL  +     +++ + +    +    +
Sbjct: 712  EEFEELQGRCANLKKELVQLELDNKALSDDLNAKLDSLSTEYKSVSGNYERLKNDYEFLE 771

Query: 865  RVNELLHNEIASYKKQIERLTS--KNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVD 1038
              ++ +   + +   ++  +T   +NL    KKI +     K+K+   E + N L+S + 
Sbjct: 772  GKHKKVEKSLENVSTRLIEITKDKENLTAANKKITETFASNKKKIEAYESKINTLESKL- 830

Query: 1039 KYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFK 1218
                   + + SK    ++ I  + R+L   +++K+ ++   +    EL ++L   ++ K
Sbjct: 831  -------RDITSKKEQAEEGINKMSRELFNLEKNKEDIESAKKKVEKELNKEL---ENMK 880

Query: 1219 ERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQ 1398
              N  L+       ++L +  KE    D EL  L+K  S  E   D+  R+ ++      
Sbjct: 881  NENKKLD-------NTLAKKEKELQSLDEELQKLRKMQSLLETDKDQSARELTEW----- 928

Query: 1399 YLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXX 1578
                    KS F   +  + +           TD  K ++    + Q+ ++  QK++   
Sbjct: 929  --------KSKFQGHDELVTRL----------TDKLKSLANSFKNIQSERDTLQKHL--- 967

Query: 1579 XXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDS 1758
                                + ITDNNK+              ++ LES+I  +S ERD+
Sbjct: 968  --------------------MEITDNNKL-------------DVQNLESQIEALSTERDN 994

Query: 1759 YKLLVXXXXXXXXXXXXXXXXXXXCELEKE--RLTNELSSMKQQ---HVKVLEELENKIK 1923
              +L                        +E  RLT++   +++      K L E    + 
Sbjct: 995  -AILERNDLLNTITNLESATTQIHNNYREEIARLTSKTDDLQRTVNTQEKQLNEKNEDLI 1053

Query: 1924 TLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLIT 2103
             LQKS    K + +K  L F +++ + N + +  + +  K+K    +++           
Sbjct: 1054 ALQKSSEEQKEDAKKLELKFADVRSSKNEINKLFEDVSGKLKEAHDEIS----------- 1102

Query: 2104 GGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLE 2283
             G++  ++     L    +K + LD+E ++LK+KN NL+              N    LE
Sbjct: 1103 -GLSKRKEGLEKALEEYSKKTTILDEEANSLKTKNDNLQ--------------NAKEDLE 1147

Query: 2284 TSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTL 2463
            T L+E +       +  EKE +  Q+   + K        DI     E  EEL+N+    
Sbjct: 1148 TKLNEAK-------ERFEKEFSSTQSEIEDLKGNLQTKVKDIQRAN-ERKEELENKLTLA 1199

Query: 2464 RRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQL 2643
            + ++ E+++DL+MK     K+     K +N L  +  ++  +   LE K + +  +    
Sbjct: 1200 QSKISELKKDLEMKETHIQKMYETKEKCQNALNSSQSEVEELKKNLETKETKIQKATEAC 1259

Query: 2644 QGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSL 2823
            +                 ++ +   +E  EKI+    L +   +++ T K   +  + +L
Sbjct: 1260 ESLRSELETS-------VQESKRGMDELKEKISALETLKREAEKDSETMKKELEDKEKNL 1312

Query: 2824 SRLRQAINSIQQQSLVIESNYNTEIDHA------NERLEEAEVKM-ASFDGKVTEILESY 2982
            + L+ A + I +Q  ++E+N ++  D        NE L++   K+ A FD K  E+ ES 
Sbjct: 1313 ATLQSAFDDISKQLSLLENNLSSSHDDTKKLRDENEELQKQLGKLRADFDTKSNELEESL 1372

Query: 2983 -------DGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFV 3141
                     K  N++ +     SL   K              R      K   EK  +F 
Sbjct: 1373 VKLEGVTKEKTKNSSELTEAKSSLQKVK----------LELERNVTDLKKQLNEKTQAFE 1422

Query: 3142 KIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQL----ADMQVK 3309
            + +++           E + K+ ALEE       + E   +  E+  +++     D++  
Sbjct: 1423 R-ERKLLNEGSSSITKEYSEKVTALEEKLTSSKNDFEEKVRELESKQTEMDSLKLDLEAT 1481

Query: 3310 LEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKT 3489
            LE    EI +L  +++EKE  L     E+     +++  +++ +    E H +  EK   
Sbjct: 1482 LEQKNTEIKKLSSELSEKEIQLEKGSSEISEISKKNEITIKELEKQLSELHKQLAEK--- 1538

Query: 3490 LEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQ 3669
             +E+LET + +N +   +  +LK    E  D  K   +    Q ++L +   +L + L++
Sbjct: 1539 -DEKLETCKGDNEK---KITKLKHSFDETEDKLKESNM----QTSKLEKENKDLRQKLEE 1590

Query: 3670 EIEKNNQSGNGAADESEEIIRLRAELEKSNNFS----NELEKKVEDAKKFKNEIESLKSE 3837
             +++N+Q         E +++ + ELEKS N S    NE EK ++D +  K +++  ++ 
Sbjct: 1591 SLKRNSQEYKSLEQLQETLVKEKQELEKSLNDSKIQLNEKEKVIKDFEVTKEKLQETENA 1650

Query: 3838 L-QSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNIL 4014
            L +  KA ++     + +++ + +   EK++  +                 L + +  + 
Sbjct: 1651 LSEKEKAMQDFEATKEKLQETENALS-EKEKAAQDFEITKKK---------LVETEKALS 1700

Query: 4015 ANGQESANIXXXXXXXXXXXXALILKRITEAE-ENLKKRMRLPSEEKINAVIEKR----- 4176
              G+   ++             +   ++ E+E E  +K  +L   ++ +A  EK      
Sbjct: 1701 EKGKAVEDL------------EITTNKLKESEIELTEKGKKLEHFKETSATFEKELQEAI 1748

Query: 4177 --RKVLEQE---FETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIK---KKAF 4332
              +K LE++    E++L +L  + +    V   + Q+  + ++K N EL E++   KK  
Sbjct: 1749 AGKKSLEEKASLLESELLDLKNSLEEKDSVIQKKEQLISQSQQKNNSELMELRDLLKKLE 1808

Query: 4333 EEGKQQSMMKSTLLE 4377
            EE K+ S   S   E
Sbjct: 1809 EENKKLSEQVSDRTE 1823

 Score =  139 bits (350), Expect = 4e-32
 Identities = 230/1175 (19%), Positives = 488/1175 (41%), Gaps = 46/1175 (3%)
 Frame = +1

Query: 556  ENKKLQTGMKLLRENNLYLEI--KCKETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKS 729
            E ++LQ     L++  + LE+  K    D N KL S + +   +    + + ++   L+ 
Sbjct: 713  EFEELQGRCANLKKELVQLELDNKALSDDLNAKLDSLSTEYKSVSGNYERLKNDYEFLEG 772

Query: 730  EIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKK 909
            +   ++   E++ST    +L  I    +NL ++ ++  +     ++  E   ++I + + 
Sbjct: 773  KHKKVEKSLENVST----RLIEITKDKENLTAANKKITETFASNKKKIEAYESKINTLES 828

Query: 910  QIERLTSKNLETPE--KKIIQELVDL---KEKLVNSEKEC-NELKSTVDKYINIDEKKLI 1071
            ++  +TSK  +  E   K+ +EL +L   KE + +++K+   EL   ++   N + KKL 
Sbjct: 829  KLRDITSKKEQAEEGINKMSRELFNLEKNKEDIESAKKKVEKELNKELENMKN-ENKKLD 887

Query: 1072 SKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELL 1251
            +     +K ++ L  +L K ++ +  L+   +    EL +         E  + L  +L 
Sbjct: 888  NTLAKKEKELQSLDEELQKLRKMQSLLETDKDQSARELTEWKSKFQGHDELVTRLTDKLK 947

Query: 1252 RITSSLEETAKERDIKDREL-----------TNLQKKISNNEQFNDELLRQRSDLAHQVQ 1398
             + +S +    ERD   + L            NL+ +I       D  + +R+DL + + 
Sbjct: 948  SLANSFKNIQSERDTLQKHLMEITDNNKLDVQNLESQIEALSTERDNAILERNDLLNTIT 1007

Query: 1399 YLLLCIDN-KSPFTEKEATLVKKIVSNENTENDTDSHKIISKR--LLHFQNVKELQQKNM 1569
             L        + + E+ A L  K    + T N T   ++  K   L+  Q   E Q+++ 
Sbjct: 1008 NLESATTQIHNNYREEIARLTSKTDDLQRTVN-TQEKQLNEKNEDLIALQKSSEEQKEDA 1066

Query: 1570 XXXXXXXXXXXXXXXXEQE--QQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIIS 1743
                              +  +  + ++ + +  +         LEK ++    K  I+ 
Sbjct: 1067 KKLELKFADVRSSKNEINKLFEDVSGKLKEAHDEISGLSKRKEGLEKALEEYSKKTTILD 1126

Query: 1744 QERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIK 1923
            +E +S K                       +  KE L  +L+  K++  K     +++I+
Sbjct: 1127 EEANSLK-----------------TKNDNLQNAKEDLETKLNEAKERFEKEFSSTQSEIE 1169

Query: 1924 TLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLIT 2103
             L+ +  T   ++++     +E+++   L +  + +L+  ++  E  +   +++E     
Sbjct: 1170 DLKGNLQTKVKDIQRANERKEELENKLTLAQSKISELKKDLEMKETHI--QKMYETKEKC 1227

Query: 2104 GGVNNLEQSKIIELSV-AEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQL 2280
                N  QS++ EL    E K + + K     +S    LE  +       + L  K+  L
Sbjct: 1228 QNALNSSQSEVEELKKNLETKETKIQKATEACESLRSELETSVQESKRGMDELKEKISAL 1287

Query: 2281 ETSLSERELPKNT---QIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQ 2451
            ET   E E    T   +++++EK  A  Q+   +  K  S+ ++++S   +++ ++L+++
Sbjct: 1288 ETLKREAEKDSETMKKELEDKEKNLATLQSAFDDISKQLSLLENNLS-SSHDDTKKLRDE 1346

Query: 2452 FRTLRRELKEVQEDLDMKT----ESHLKLE---NKYTKVKNDLKQATYKLASVYTTLEQK 2610
               L+++L +++ D D K+    ES +KLE    + TK  ++L +A   L  V   LE+ 
Sbjct: 1347 NEELQKQLGKLRADFDTKSNELEESLVKLEGVTKEKTKNSSELTEAKSSLQKVKLELERN 1406

Query: 2611 NSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEEN-TT 2787
             + L   +++                   E+ +   NE S  I        T +EE  T+
Sbjct: 1407 VTDLKKQLNE--------------KTQAFERERKLLNEGSSSITKEYSEKVTALEEKLTS 1452

Query: 2788 FKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTE 2967
             K+ F+     L   +  ++S++          NTEI   +  L E E+++     +++E
Sbjct: 1453 SKNDFEEKVRELESKQTEMDSLKLDLEATLEQKNTEIKKLSSELSEKEIQLEKGSSEISE 1512

Query: 2968 ILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKI 3147
            I +       N   I  L      EK++            +    +  N ++        
Sbjct: 1513 ISKK------NEITIKEL------EKQLSELHKQLAEKDEKLETCKGDNEKKITKLKHSF 1560

Query: 3148 DQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKL----E 3315
            D+          + E+  +   LE+ N  L +++E   K N      L  +Q  L    +
Sbjct: 1561 DETE------DKLKESNMQTSKLEKENKDLRQKLEESLKRNSQEYKSLEQLQETLVKEKQ 1614

Query: 3316 PLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLE 3495
             LE+ +N+ K+++ EKE+ +     E+ + KL+      +  + E+E  M+  E  K   
Sbjct: 1615 ELEKSLNDSKIQLNEKEKVIK--DFEVTKEKLQE----TENALSEKEKAMQDFEATKEKL 1668

Query: 3496 EQLETVRTENAQLTDRFDRLKKQAHEKLDA----AKTMQINLTTQINELNETKVNLEKSL 3663
            ++ E   +E  +    F+  KK+  E   A     K ++ +L    N+L E+++ L +  
Sbjct: 1669 QETENALSEKEKAAQDFEITKKKLVETEKALSEKGKAVE-DLEITTNKLKESEIELTEK- 1726

Query: 3664 QQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQ 3843
             +++E   ++      E +E I  +  LE+    ++ LE ++ D K    E +S+  + +
Sbjct: 1727 GKKLEHFKETSATFEKELQEAIAGKKSLEEK---ASLLESELLDLKNSLEEKDSVIQKKE 1783

Query: 3844 SVKAYENSTVNSKI--IKDLKESFKREKDELIEQM 3942
             + +      NS++  ++DL +  + E  +L EQ+
Sbjct: 1784 QLISQSQQKNNSELMELRDLLKKLEEENKKLSEQV 1818

 Score =  111 bits (278), Expect = 1e-23
 Identities = 188/930 (20%), Positives = 376/930 (40%), Gaps = 25/930 (2%)
 Frame = +1

Query: 289  EKLVSEKQKEF-DSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDS 465
            E L +E+     + ND LN+ IT ++     +  ++    AR     + L+++    +  
Sbjct: 986  EALSTERDNAILERNDLLNT-ITNLESATTQIHNNYREEIARLTSKTDDLQRTVNTQEKQ 1044

Query: 466  LTENSA--LKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDK 639
            L E +   +  Q    E K D+   EL  A+  + K +        N L+ ++  K  + 
Sbjct: 1045 LNEKNEDLIALQKSSEEQKEDAKKLELKFADVRSSKNEI-------NKLFEDVSGKLKEA 1097

Query: 640  NKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNL 819
            + ++   ++    L+  L+  S +   L  E  +LK  N++L    +       DL+  L
Sbjct: 1098 HDEISGLSKRKEGLEKALEEYSKKTTILDEEANSLKTKNDNLQNAKE-------DLETKL 1150

Query: 820  NSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQE--LVDLKEKL 993
            N +K+ F KE +  Q   E L   + +  K I+R   +  E   K  + +  + +LK+ L
Sbjct: 1151 NEAKERFEKEFSSTQSEIEDLKGNLQTKVKDIQRANERKEELENKLTLAQSKISELKKDL 1210

Query: 994  VNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESF 1173
               E    ++  T +K  N       S+    KK +E    ++ K     ++L+ ++E+ 
Sbjct: 1211 EMKETHIQKMYETKEKCQNALNSSQ-SEVEELKKNLETKETKIQKATEACESLRSELETS 1269

Query: 1174 LVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQK--------- 1326
            + E ++ +   D  KE+ S+LE          E   KE + K++ L  LQ          
Sbjct: 1270 VQESKRGM---DELKEKISALETLKREAEKDSETMKKELEDKEKNLATLQSAFDDISKQL 1326

Query: 1327 -----KISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVK-KIVSNENTE 1488
                  +S++     +L  +  +L  Q+  L    D KS   E E +LVK + V+ E T+
Sbjct: 1327 SLLENNLSSSHDDTKKLRDENEELQKQLGKLRADFDTKS--NELEESLVKLEGVTKEKTK 1384

Query: 1489 NDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIV 1668
            N ++    +++     Q VK   ++N+                +Q  +KT       K++
Sbjct: 1385 NSSE----LTEAKSSLQKVKLELERNVTDLK------------KQLNEKTQAFERERKLL 1428

Query: 1669 -ESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEK 1845
             E + S + +  + +  LE K+   +  ++ ++  V                    ELE 
Sbjct: 1429 NEGSSSITKEYSEKVTALEEKL---TSSKNDFEEKVR-------------------ELES 1466

Query: 1846 ERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYV 2025
            ++   E+ S+K      LE+   +IK L       ++++EK +    E+   N +    +
Sbjct: 1467 KQ--TEMDSLKLDLEATLEQKNTEIKKLSSELSEKEIQLEKGSSEISEISKKNEIT---I 1521

Query: 2026 DKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIE-LSVAEQKISFLDKEISNLKS 2202
             +LE ++  L + LAE +  EK     G N  + +K+       E K+   + + S L+ 
Sbjct: 1522 KELEKQLSELHKQLAEKD--EKLETCKGDNEKKITKLKHSFDETEDKLKESNMQTSKLEK 1579

Query: 2203 KNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKK 2382
            +NK+L  K L  +L +N  + K L+        +L +    + +E E +   +     +K
Sbjct: 1580 ENKDLRQK-LEESLKRNSQEYKSLE--------QLQETLVKEKQELEKSLNDSKIQLNEK 1630

Query: 2383 LESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLK 2562
             + + D +++    E L+E +N      + +++ +   +   E+   L  K  K   D +
Sbjct: 1631 EKVIKDFEVTK---EKLQETENALSEKEKAMQDFEATKEKLQETENALSEK-EKAAQDFE 1686

Query: 2563 QATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENS---E 2733
                KL      L +K      +V  L+                 +KL+  +  ++   +
Sbjct: 1687 ITKKKLVETEKALSEKGK----AVEDLEITTNKLKESEIELTEKGKKLEHFKETSATFEK 1742

Query: 2734 KINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANE 2913
            ++  AI   +++ E+ +  +      KNSL      I   +Q     +   N+E+    +
Sbjct: 1743 ELQEAIAGKKSLEEKASLLESELLDLKNSLEEKDSVIQKKEQLISQSQQKNNSELMELRD 1802

Query: 2914 RLEEAEVKMASFDGKVTEILESYDGKILNT 3003
             L++ E +      +V++  E  D  +L T
Sbjct: 1803 LLKKLEEENKKLSEQVSDRTEIDDLMLLVT 1832

 Score =  110 bits (276), Expect = 2e-23
 Identities = 187/891 (20%), Positives = 365/891 (40%), Gaps = 54/891 (6%)
 Frame = +1

Query: 286  REKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDS 465
            +EK ++EK ++     AL       K D + ++     + + + +   + E    +L+++
Sbjct: 1041 QEKQLNEKNEDLI---ALQKSSEEQKEDAKKLELKFADVRSSKNEINKLFEDVSGKLKEA 1097

Query: 466  LTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNK 645
              E S L ++    E  L+  +++  + + E   L+T                    KN 
Sbjct: 1098 HDEISGLSKRKEGLEKALEEYSKKTTILDEEANSLKT--------------------KND 1137

Query: 646  KLYSSAEDA-SRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNL- 819
             L ++ ED  ++L +  +    E  S +SEI  LK   ++   D+QR   R ++L++ L 
Sbjct: 1138 NLQNAKEDLETKLNEAKERFEKEFSSTQSEIEDLKGNLQTKVKDIQRANERKEELENKLT 1197

Query: 820  --NSSKQEFAKEITLKQ-------RVNELLHNEIASYKKQIERLTSKNLETPEKKIIQEL 972
               S   E  K++ +K+          E   N + S + ++E L  KNLET E KI    
Sbjct: 1198 LAQSKISELKKDLEMKETHIQKMYETKEKCQNALNSSQSEVEEL-KKNLETKETKI---- 1252

Query: 973  VDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTL 1152
                     + + C  L+S ++  +  + K+ + +       +E L+R+  K+    +T+
Sbjct: 1253 -------QKATEACESLRSELETSVQ-ESKRGMDELKEKISALETLKREAEKD---SETM 1301

Query: 1153 QRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKI 1332
            ++++E     L       D   ++ S LE  L   +SS ++T K RD             
Sbjct: 1302 KKELEDKEKNLATLQSAFDDISKQLSLLENNL---SSSHDDTKKLRD------------- 1345

Query: 1333 SNNEQFNDELLRQRSDL---AHQVQYLLLCID--------NKSPFTEKEATLVKKIVSNE 1479
              NE+   +L + R+D    +++++  L+ ++        N S  TE +++L K  V  E
Sbjct: 1346 -ENEELQKQLGKLRADFDTKSNELEESLVKLEGVTKEKTKNSSELTEAKSSLQK--VKLE 1402

Query: 1480 NTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNN 1659
               N TD  K ++++   F+  ++L  +                  E  ++ T       
Sbjct: 1403 LERNVTDLKKQLNEKTQAFERERKLLNEG-----------SSSITKEYSEKVT------- 1444

Query: 1660 KIVESAKSTSVDLEKHIKTLESKINIISQERDSYKL-LVXXXXXXXXXXXXXXXXXXXCE 1836
             + E   S+  D E+ ++ LESK      E DS KL L                     E
Sbjct: 1445 ALEEKLTSSKNDFEEKVRELESK----QTEMDSLKLDLEATLEQKNTEIKKLSSELSEKE 1500

Query: 1837 LEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKME------------VEKHALN 1980
            ++ E+ ++E+S + +++   ++ELE ++  L K QL  K E            + K   +
Sbjct: 1501 IQLEKGSSEISEISKKNEITIKELEKQLSELHK-QLAEKDEKLETCKGDNEKKITKLKHS 1559

Query: 1981 FDEMKDNNNLLKEYVDKLENKIKTLEQDLAE----NELFEKNLITGGVNNLEQSKIIELS 2148
            FDE +D          KLE + K L Q L E    N    K+L       +++ + +E S
Sbjct: 1560 FDETEDKLKESNMQTSKLEKENKDLRQKLEESLKRNSQEYKSLEQLQETLVKEKQELEKS 1619

Query: 2149 VAEQKISFLDKE--ISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQ 2322
            + + KI   +KE  I + +   + L++       ++N L  K   ++   + +E  + T+
Sbjct: 1620 LNDSKIQLNEKEKVIKDFEVTKEKLQE-------TENALSEKEKAMQDFEATKEKLQETE 1672

Query: 2323 IKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDM 2502
                EKE A Q     ++K +E+           E+LE   N+ +    EL E  + L+ 
Sbjct: 1673 NALSEKEKAAQDFEITKKKLVETEKALSEKGKAVEDLEITTNKLKESEIELTEKGKKLEH 1732

Query: 2503 KTESHLKLENKYTKV---KNDLKQATYKLAS----VYTTLEQKNSFLANSVSQLQGXXXX 2661
              E+    E +  +    K  L++    L S    +  +LE+K+S +      +      
Sbjct: 1733 FKETSATFEKELQEAIAGKKSLEEKASLLESELLDLKNSLEEKDSVIQKKEQLISQSQQK 1792

Query: 2662 XXXXXXXXXXXTEKLQMAENENSE------KINNAIVLLQTMVEENTTFKD 2796
                        +KL+    + SE      +I++ ++L+  + E+N+ +++
Sbjct: 1793 NNSELMELRDLLKKLEEENKKLSEQVSDRTEIDDLMLLVTDLDEKNSRYRE 1843

 Score = 89.7 bits (221), Expect = 5e-17
 Identities = 154/736 (20%), Positives = 297/736 (40%), Gaps = 60/736 (8%)
 Frame = +1

Query: 52   SSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDIKHVYEGKINTISQKYFX 231
            S   DL GN    + +  +++   +  +L  + +   + I ++K   E K   I + Y  
Sbjct: 1166 SEIEDLKGNLQTKVKD--IQRANERKEELENKLTLAQSKISELKKDLEMKETHIQKMYET 1223

Query: 232  XXXXXXXXXXXXSGYLVAREKLVSEK---QKEFDSNDALNSEITLI----KYDLEAMQRD 390
                        S     ++ L +++   QK  ++ ++L SE+       K  ++ ++  
Sbjct: 1224 KEKCQNALNSSQSEVEELKKNLETKETKIQKATEACESLRSELETSVQESKRGMDELKEK 1283

Query: 391  HTTLEARERKTENVLEQSKLELQDS----LTENSA---LKEQIGVFEGKLDSMTQELWLA 549
             + LE  +R+ E   E  K EL+D      T  SA   + +Q+ + E  L S   +    
Sbjct: 1284 ISALETLKREAEKDSETMKKELEDKEKNLATLQSAFDDISKQLSLLENNLSSSHDDTKKL 1343

Query: 550  NTENKKLQTGMKLLR-----------ENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQ 696
              EN++LQ  +  LR           E+ + LE   KE  KN    + A+  S LQ    
Sbjct: 1344 RDENEELQKQLGKLRADFDTKSNELEESLVKLEGVTKEKTKNSSELTEAK--SSLQKVKL 1401

Query: 697  IVSSEILSLKSEI--------ATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEI 852
             +   +  LK ++           K +NE  S+  +    ++  L++ L SSK +F +++
Sbjct: 1402 ELERNVTDLKKQLNEKTQAFERERKLLNEGSSSITKEYSEKVTALEEKLTSSKNDFEEKV 1461

Query: 853  TLKQRVNELLHNEIASYKKQIE-RLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKS 1029
                R  E    E+ S K  +E  L  KN E   KK+  E   L EK +  EK  +E+ S
Sbjct: 1462 ----RELESKQTEMDSLKLDLEATLEQKNTEI--KKLSSE---LSEKEIQLEKGSSEI-S 1511

Query: 1030 TVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMI- 1206
             + K   I  K+L       +K +  L +QL ++    +T +   E  + +L+       
Sbjct: 1512 EISKKNEITIKEL-------EKQLSELHKQLAEKDEKLETCKGDNEKKITKLKHSFDETE 1564

Query: 1207 DSFKERN---SSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRS 1377
            D  KE N   S LE+E   +   LEE+ K    + + L  LQ+ +   +Q  ++ L    
Sbjct: 1565 DKLKESNMQTSKLEKENKDLRQKLEESLKRNSQEYKSLEQLQETLVKEKQELEKSLNDSK 1624

Query: 1378 DLAHQVQYLLLCI--------DNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLH 1533
               ++ + ++           + ++  +EKE  +     + E  +   ++     K    
Sbjct: 1625 IQLNEKEKVIKDFEVTKEKLQETENALSEKEKAMQDFEATKEKLQETENALSEKEKAAQD 1684

Query: 1534 FQ-NVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHI 1710
            F+   K+L +                    + ++  + +T+  K +E  K TS   EK +
Sbjct: 1685 FEITKKKLVETEKALSEKGKAVEDLEITTNKLKESEIELTEKGKKLEHFKETSATFEKEL 1744

Query: 1711 -------KTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELS 1869
                   K+LE K +++  E    K  +                      +KE+L   +S
Sbjct: 1745 QEAIAGKKSLEEKASLLESELLDLKNSLEEKDSVIQ--------------KKEQL---IS 1787

Query: 1870 SMKQQHVKVLEELENKIKTLQK------SQLTSKMEVEKHALNFDEMKDNNNLLKEYVDK 2031
              +Q++   L EL + +K L++       Q++ + E++   L   ++ + N+  +E ++ 
Sbjct: 1788 QSQQKNNSELMELRDLLKKLEEENKKLSEQVSDRTEIDDLMLLVTDLDEKNSRYREKLES 1847

Query: 2032 LENKIKTLEQDLAENE 2079
            L  ++ + E+D  E +
Sbjct: 1848 LGVEVSSDEEDDDEED 1863

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 103/427 (24%), Positives = 192/427 (44%), Gaps = 35/427 (8%)
 Frame = +1

Query: 334  ALNSEITLIKYDLEAMQRD----HTTLEARERKTENVLEQSKLELQDSLTENSALKEQIG 501
            AL  ++T  K D E   R+     T +++ +   E  LEQ   E++   +E S  + Q+ 
Sbjct: 1445 ALEEKLTSSKNDFEEKVRELESKQTEMDSLKLDLEATLEQKNTEIKKLSSELSEKEIQLE 1504

Query: 502  VFEGKLDSMTQELWLANTE-NKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASR 678
                ++  ++++  +   E  K+L    K L E +  LE  CK  D  KK+         
Sbjct: 1505 KGSSEISEISKKNEITIKELEKQLSELHKQLAEKDEKLET-CKG-DNEKKITKLKHSFDE 1562

Query: 679  LQDQLQIVSSEILSLKSEIATLKY-MNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEIT 855
             +D+L+  + +   L+ E   L+  + ESL  + Q +   ++ L + L   KQE  K + 
Sbjct: 1563 TEDKLKESNMQTSKLEKENKDLRQKLEESLKRNSQ-EYKSLEQLQETLVKEKQELEKSLN 1621

Query: 856  -LKQRVNELLHNEIASYKKQIERLT-SKNLETPEKKIIQELVDLKEKLVNSEKECNELKS 1029
              K ++NE     I  ++   E+L  ++N  + ++K +Q+    KEKL  +E   +E + 
Sbjct: 1622 DSKIQLNEK-EKVIKDFEVTKEKLQETENALSEKEKAMQDFEATKEKLQETENALSEKEK 1680

Query: 1030 TVDKYINIDEKKLI------SKFGNPKKLIEILRRQLVKEKRHKDTLQRQVE-------S 1170
                +  I +KKL+      S+ G   + +EI   +L + +       +++E       +
Sbjct: 1681 AAQDF-EITKKKLVETEKALSEKGKAVEDLEITTNKLKESEIELTEKGKKLEHFKETSAT 1739

Query: 1171 FLVELEQKLPMIDSFKERNSSLERELLRITSSLEE-----------TAKERDIKDRELTN 1317
            F  EL++ +    S +E+ S LE ELL + +SLEE            ++ +   + EL  
Sbjct: 1740 FEKELQEAIAGKKSLEEKASLLESELLDLKNSLEEKDSVIQKKEQLISQSQQKNNSELME 1799

Query: 1318 LQKKISNNEQFNDELLRQRSDLAHQVQYLLLCID---NKSPFTEKEATLVKKIVSNENTE 1488
            L+  +   E+ N +L  Q SD       +LL  D     S + EK  +L  ++ S+E  +
Sbjct: 1800 LRDLLKKLEEENKKLSEQVSDRTEIDDLMLLVTDLDEKNSRYREKLESLGVEVSSDEEDD 1859

Query: 1489 NDTDSHK 1509
            ++ D  +
Sbjct: 1860 DEEDEEE 1866

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_5.702
            YIL149C
          Length = 1183

 Score =  156 bits (395), Expect = 1e-37
 Identities = 263/1199 (21%), Positives = 499/1199 (41%), Gaps = 32/1199 (2%)
 Frame = +1

Query: 289  EKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSL 468
            E LV        +N++ NS        +   Q D + LE R     ++ EQ K EL    
Sbjct: 37   EFLVLSNSLNLSNNNSNNS--------INKKQLDFSELEKRFEVINSINEQLKNELYTKN 88

Query: 469  TENSALKEQIGV----FEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETD 636
             E   +K++  V    ++  L+ +   L     +NK  +   K++   N+Y     +  +
Sbjct: 89   KEYFQIKQECDVKIEDYKSNLNELKHRLSKEILQNKNNK--QKII---NVYEHSINESLE 143

Query: 637  KNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDN 816
             +KK     E    L+ +      ++  +K++I    Y N   +T +       +  D  
Sbjct: 144  NDKKYVKDFEKLETLESKFLETYDQMNIMKNKI----YFNTQPATPIAENEPSEESYDVE 199

Query: 817  LNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLV 996
            ++++   +   I   +++N  +   +   ++++E +++ N E  +   + E  ++   L 
Sbjct: 200  VDNNYNSWRTSIEYNEKLN--IKKVVYKLQERLETVSTMNKELLKIIKLSENEEMNISLQ 257

Query: 997  NSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFL 1176
            N     N L +  D + N D +  I+        I+ ++ +L+KEK  K  L+++   FL
Sbjct: 258  NLNSNNNNLYN--DTHSNNDFEFDINN-------IDDIKTELIKEKYEKSLLEKKFNDFL 308

Query: 1177 VELEQKLPMIDSFKERNSSLERELLRITSSLEETA-KERDIKDRELTNLQKKISNNEQFN 1353
             ++E KLP +     +N+S+E E        E+    E D    E  +L+ K+++ E   
Sbjct: 309  FDIESKLPYL-----QNNSVENETNNGNKIEEQKIIHEHDSLKLENQSLKIKLNDFESTV 363

Query: 1354 DELLRQRSDLAHQVQYLLLCI-----DNKSPFTEKEATLVKKIVSNENTENDTDSHKIIS 1518
              LL+QRSDL HQ+ YLL+       DN    TE E   ++ +V+       T++  IIS
Sbjct: 364  KTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQPTNTWSTETQNIIS 423

Query: 1519 KRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXE-QEQQKTLRITDNNKIVESAKSTSVD 1695
            +RLL F NV +L  KN+                E Q  QK   +  + K ++ AK   + 
Sbjct: 424  ERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMDFKSIDEAKQRMIV 483

Query: 1696 L-EKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSS 1872
            L E+++K  +    IIS++    KLL                           +T    S
Sbjct: 484  LKEENVKNKDIINQIISEK----KLLEDKIHGL-----------------NSTVTELNKS 522

Query: 1873 MKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKT 2052
            M+ +    L+ LE     LQK+  +   +  + ++      + N +LKE  D L      
Sbjct: 523  MEIKREPTLKNLE-----LQKTNQSLLEKNNQLSIEISNASNENKILKEKFDLLIKSYTE 577

Query: 2053 LEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKIL 2232
            L++  +E   + K+ +     N E +KI               E+ +LK+K KNLE    
Sbjct: 578  LKELKSEISTYTKSSVISKDGN-ETAKI--------------SELVDLKAKCKNLE---- 618

Query: 2233 TMTLSKNLLDNKVLQLETSLSERELPKNTQIKNE-EKEPAKQQTYTFERKKLESVNDSDI 2409
                 K+  D      E+   E E+ +N  +K+E +K  ++  T+   R  ++S N +  
Sbjct: 619  -----KSFKDR-----ESKFQELEI-ENNNVKDELKKVLSEYNTFKSTRGTIDSFNQNKN 667

Query: 2410 SYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKV-----KNDLKQATY 2574
            S    EN  +     + L+ EL  V + L+   E+ +KL+    K+     K+ +K    
Sbjct: 668  SIGINENTNK-----QLLKEELNTV-KSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQD 721

Query: 2575 KLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIV 2754
            K+  + TT+E K S LA+S                      E   M +N+N  +I+    
Sbjct: 722  KIDEMNTTMEVKISNLASS---------------------AESAAMLKNKN--EIDELKK 758

Query: 2755 LLQTMVEENTTFKDAF----KHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLE 2922
             ++T  +E T   D F    K  K+ L+  +   N +++    +E + N E++     LE
Sbjct: 759  QIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKN-ELEQRLLLLE 817

Query: 2923 EAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARY 3102
             +E  +     K+ + L + + ++ N                             +R++ 
Sbjct: 818  SSEKSLQEEIVKMKDELMTSNNELDNN----------------------------QRSQE 849

Query: 3103 RNKNPREKFPSFVKIDQQSXXXXXXXXVM-ENTTKLLALEESNAKLIKEVENCTKVNETL 3279
              +N  EK     KI ++         ++ EN    L LE     ++ +++   K +  +
Sbjct: 850  ELRNEYEKQNKLYKIKEEELESALNQLMLKENQNSALDLESLPDDVMLKLKEMVKKDIEI 909

Query: 3280 SSQLADMQVKLEPLE----QEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIV 3447
             + +  ++ KL+ +E    +++N   +++++     NI   + E W+   Q IL   KI 
Sbjct: 910  ENDII-LKAKLKEIEKNSAKDVNTDSIELSDD----NISTMK-EAWEKEYQHIL---KIR 960

Query: 3448 EEEAHMKSLEKI-KTLEEQL-ETVRTENAQLTDRFDRLKKQ--AHEKLDAAKTMQINLTT 3615
             E+A  +++ +  K LE++  E +  E+ +L+D+++   K   + E L   K   + L T
Sbjct: 961  IEDAENQAMARTRKELEKEYEERLSKESEKLSDQYNNKLKDDLSEELLKIDKKYAMELET 1020

Query: 3616 QI-NELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKV 3789
            ++ NE +E+K   + +L  E  KN            +I  L+ E  K ++   + ++K+
Sbjct: 1021 KLKNETDESKKEFQDALGTEQTKNKILSKKIEFLETQIKELKDEQTKHHSNPMKSDEKI 1079

 Score =  116 bits (291), Expect = 3e-25
 Identities = 236/1150 (20%), Positives = 456/1150 (39%), Gaps = 83/1150 (7%)
 Frame = +1

Query: 1204 IDSFKERNSSLERELLRITSSLE----ETAKERDIKDRELTNLQKKI----SNNEQFNDE 1359
            +   KE N+ L+ E L +++SL      +    + K  + + L+K+     S NEQ  +E
Sbjct: 24   LKDLKELNNGLKNEFLVLSNSLNLSNNNSNNSINKKQLDFSELEKRFEVINSINEQLKNE 83

Query: 1360 LLRQRSDLAHQVQYLLLCI-DNKSPFTEKEATLVKKIVSNENTEND---------TDSHK 1509
            L  +  +     Q   + I D KS   E +  L K+I+ N+N +            +S +
Sbjct: 84   LYTKNKEYFQIKQECDVKIEDYKSNLNELKHRLSKEILQNKNNKQKIINVYEHSINESLE 143

Query: 1510 IISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTS 1689
               K +  F+ ++ L+ K +                    Q    I +N     S +S  
Sbjct: 144  NDKKYVKDFEKLETLESKFLETYDQMNIMKNKIYF---NTQPATPIAENEP---SEESYD 197

Query: 1690 VDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELS 1869
            V+++ +  +  + I     E+ + K +V                       +ERL   +S
Sbjct: 198  VEVDNNYNSWRTSIEY--NEKLNIKKVVYKL--------------------QERLET-VS 234

Query: 1870 SMKQQHVKVLEELENKIKTLQKSQLTSK---MEVEKHALNFDEMKDNN------NLLKEY 2022
            +M ++ +K+++  EN+   +    L S    +  + H+ N  E   NN       L+KE 
Sbjct: 235  TMNKELLKIIKLSENEEMNISLQNLNSNNNNLYNDTHSNNDFEFDINNIDDIKTELIKEK 294

Query: 2023 VDK-------------LENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQK 2163
             +K             +E+K+  L+ +  ENE       T   N +E+ KII       +
Sbjct: 295  YEKSLLEKKFNDFLFDIESKLPYLQNNSVENE-------TNNGNKIEEQKIIH------E 341

Query: 2164 ISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEE-- 2337
               L  E  +LK K  + E  + T+   ++ L +++  L  + S      N  +   E  
Sbjct: 342  HDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELN 401

Query: 2338 --KEPAKQQTYTFERKKLESVND-----SDISYLYYENLE------ELQNQFRTLRRELK 2478
              +    Q T T+  +    +++     S++S L  +N++      EL N+  ++ ++  
Sbjct: 402  FIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNS 461

Query: 2479 EVQEDLDMKTESHLKLENKYTKVKNDL---KQATYKLASVYTTLEQKNSFLANSVSQLQG 2649
            +   DL+M  +S  + + +   +K +    K    ++ S    LE K   L ++V++L  
Sbjct: 462  QKFGDLEMDFKSIDEAKQRMIVLKEENVKNKDIINQIISEKKLLEDKIHGLNSTVTELNK 521

Query: 2650 XXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSR 2829
                             +LQ       EK N   + +     EN   K+ F     S + 
Sbjct: 522  SMEIKREPTLKNL----ELQKTNQSLLEKNNQLSIEISNASNENKILKEKFDLLIKSYTE 577

Query: 2830 LRQAINSIQQ--QSLVIESNYN-----TEIDHANERLEEAEVKMASFDGKVTEILESYDG 2988
            L++  + I    +S VI  + N     +E+     + +  E      + K  E+      
Sbjct: 578  LKELKSEISTYTKSSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESKFQEL------ 631

Query: 2989 KILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXX 3168
            +I N      L + L                         K+ R    SF          
Sbjct: 632  EIENNNVKDELKKVLSEYNTF-------------------KSTRGTIDSF---------- 662

Query: 3169 XXXXXVMENTTKLLALEESNAKLIKEVENCTK-VNETLSSQLADMQVKLEPLEQEINELK 3345
                   +N   +   E +N +L+KE  N  K +N++L ++     +KL+      N++K
Sbjct: 663  ------NQNKNSIGINENTNKQLLKEELNTVKSLNKSLEAK-----IKLQE-----NDIK 706

Query: 3346 LKVAEKEQHLNICQEELERWKLRSQT-ILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTE 3522
            + + + +  +   Q++++      +  I       E  A +K+  +I  L++Q+ET   E
Sbjct: 707  ILIEKYKSQIKWYQDKIDEMNTTMEVKISNLASSAESAAMLKNKNEIDELKKQIETKSKE 766

Query: 3523 NAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKS--LQQEIEKNNQSG 3696
              +  DRF RLKKQA +KL+  K  +  L     +L ++K  LE+   L +  EK+ Q  
Sbjct: 767  LTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKNELEQRLLLLESSEKSLQ-- 824

Query: 3697 NGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYE-NSTV 3873
                   EEI++++ EL  SN   NEL+      ++ +NE E  +++L  +K  E  S +
Sbjct: 825  -------EEIVKMKDELMTSN---NELDNNQRSQEELRNEYEK-QNKLYKIKEEELESAL 873

Query: 3874 NSKIIKDLKES---FKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIX 4044
            N  ++K+ + S    +   D+++ ++              IL  +   I  N  +  N  
Sbjct: 874  NQLMLKENQNSALDLESLPDDVMLKLKEMVKKDIEIENDIILKAKLKEIEKNSAKDVNTD 933

Query: 4045 XXXXXXXXXXXALILKRITEA-EENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLREL 4221
                          +  + EA E+  +  +++  E+  N  + + RK LE+E+E +L + 
Sbjct: 934  SIELSDDN------ISTMKEAWEKEYQHILKIRIEDAENQAMARTRKELEKEYEERLSKE 987

Query: 4222 G--LNADGNGVVTDTRAQIEKELREKFNLEL-------AEIKKKAFEEGKQQSMMKSTLL 4374
               L+   N  + D  ++   ++ +K+ +EL        +  KK F++       K+ +L
Sbjct: 988  SEKLSDQYNNKLKDDLSEELLKIDKKYAMELETKLKNETDESKKEFQDALGTEQTKNKIL 1047

Query: 4375 ERKLSKLESQ 4404
             +K+  LE+Q
Sbjct: 1048 SKKIEFLETQ 1057

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 197/1009 (19%), Positives = 397/1009 (39%), Gaps = 90/1009 (8%)
 Frame = +1

Query: 1900 EELENKIKTLQK--SQLTSKMEVEKHALNFDEMKDNNNLLKEYVD--KLENKIKTLEQ-- 2061
            + L NK+K L++  + L ++  V  ++LN      NN++ K+ +D  +LE + + +    
Sbjct: 18   DALHNKLKDLKELNNGLKNEFLVLSNSLNLSNNNSNNSINKKQLDFSELEKRFEVINSIN 77

Query: 2062 DLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMT 2241
            +  +NEL+ KN        ++Q   +++   +  ++ L   +S    +NKN + KI+   
Sbjct: 78   EQLKNELYTKNK---EYFQIKQECDVKIEDYKSNLNELKHRLSKEILQNKNNKQKII--- 131

Query: 2242 LSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLY 2421
               N+ ++ +              N  ++N++K       Y  + +KLE++    +    
Sbjct: 132  ---NVYEHSI--------------NESLENDKK-------YVKDFEKLETLESKFLET-- 165

Query: 2422 YENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTK--------VKNDLKQATYK 2577
            Y+ +  ++N+     +    + E+   +    ++++N Y           K ++K+  YK
Sbjct: 166  YDQMNIMKNKIYFNTQPATPIAENEPSEESYDVEVDNNYNSWRTSIEYNEKLNIKKVVYK 225

Query: 2578 LASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSE-KINNAIV 2754
            L     T+   N  L   +   +                        N + E  INN   
Sbjct: 226  LQERLETVSTMNKELLKIIKLSENEEMNISLQNLNSNNNNLYNDTHSNNDFEFDINNIDD 285

Query: 2755 LLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEID-------HANE 2913
            +   +++E        K F + L  +   +  +Q  S+  E+N   +I+       H + 
Sbjct: 286  IKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNKIEEQKIIHEHDSL 345

Query: 2914 RLEEA--EVKMASFDGKVTEILE----------------SY----DGKILNTAAIGHLVR 3027
            +LE    ++K+  F+  V  +L+                SY    + KIL    + + +R
Sbjct: 346  KLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENEL-NFIR 404

Query: 3028 SLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKL 3207
            +L+ +               R  ++ N +           D  +        V E T K+
Sbjct: 405  NLVAQPTNTWSTETQNIISERLLKFSNVS-----------DLTAKNIKLISLVRELTNKM 453

Query: 3208 LALEESNAKLIKEVENCTKVNETLSSQ---LADMQVKLEPLEQEINELKLKVAEKEQHLN 3378
             ++E+ N++   ++E   K  +    +   L +  VK + +  +I   K  + +K   LN
Sbjct: 454  ESIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEENVKNKDIINQIISEKKLLEDKIHGLN 513

Query: 3379 ICQEELER-WKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRL 3555
                EL +  +++ +  L+  ++  ++ +   LEK   L  ++     EN  L ++FD L
Sbjct: 514  STVTELNKSMEIKREPTLKNLEL--QKTNQSLLEKNNQLSIEISNASNENKILKEKFDLL 571

Query: 3556 KKQAHEKLDAAKTMQI-----------NLTTQINELNETKV---NLEKSLQ------QEI 3675
             K   E  +    +             N T +I+EL + K    NLEKS +      QE+
Sbjct: 572  IKSYTELKELKSEISTYTKSSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESKFQEL 631

Query: 3676 EKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEI--------ESLK 3831
            E  N   N   DE      L+  L + N F +     ++   + KN I        + LK
Sbjct: 632  EIEN---NNVKDE------LKKVLSEYNTFKS-TRGTIDSFNQNKNSIGINENTNKQLLK 681

Query: 3832 SELQSVKAYENSTVNSKI------IKDLKESFKRE---KDELIEQMXXXXXXXXXXXXXT 3984
             EL +VK+  N ++ +KI      IK L E +K +     + I++M             T
Sbjct: 682  EELNTVKSL-NKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEM------------NT 728

Query: 3985 ILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAV 4164
             +  + +N+ ++ + +A                +LK   E +E LKK++   S+E   ++
Sbjct: 729  TMEVKISNLASSAESAA----------------MLKNKNEIDE-LKKQIETKSKELTESL 771

Query: 4165 IEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGK 4344
                R  L+++ + KL E                  E +LRE +     +++K   E  +
Sbjct: 772  DRFAR--LKKQAKDKLNEF--------------KGTENKLREDY----CDLEKSKNELEQ 811

Query: 4345 QQSMMKST--LLERKLSKLESQTLSPTKNNDSNETQVXXXXXXXXXXXXXXXXGEKVLQL 4518
            +  +++S+   L+ ++ K++ + +  T NN+ +  Q                   K  +L
Sbjct: 812  RLLLLESSEKSLQEEIVKMKDELM--TSNNELDNNQRSQEELRNEYEKQNKLYKIKEEEL 869

Query: 4519 NYGANVVAETDNDDNPFTLQSGKDETLLTKR---SADNEIIQDIIKRPK 4656
                N +   +N ++   L+S  D+ +L  +     D EI  DII + K
Sbjct: 870  ESALNQLMLKENQNSALDLESLPDDVMLKLKEMVKKDIEIENDIILKAK 918

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score =  155 bits (393), Expect = 4e-37
 Identities = 293/1438 (20%), Positives = 596/1438 (41%), Gaps = 51/1438 (3%)
 Frame = +1

Query: 289  EKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKL---ELQ 459
            ++L+ E+Q   D   +   +   +  DLE +   + T+E  +R  EN + +++    EL+
Sbjct: 1126 DELLRERQSLKDELLSTKEKFNSVNDDLEELNSKYVTIEEEKRTLENSINENQFTIKELK 1185

Query: 460  DSLT----ENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCK 627
            D+++    + +AL+      E +L S T EL   +T   +L   ++ +    L L    +
Sbjct: 1186 DNISGLTNDYNALESSKLDLEEELSSQTTELDQKDTSLAELSKKLEEISSEKLKLNSLLQ 1245

Query: 628  ETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDL 807
             T+ N K      D  ++ +  +I    I SL+ E+  +K    S S +   KL  + D 
Sbjct: 1246 NTETNLK------DLEKVNEDKEI---RIQSLEKELKVVK----SNSKETDNKLQELSDK 1292

Query: 808  DDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTS-KNLETPEKKIIQELVDLK 984
             D ++   +       LK     LL+++   YK+  + +    N E   K++ +E   L+
Sbjct: 1293 HDQMSREYE------ILKADKESLLNSKEKLYKQYNDNVEKINNYEESLKQLKKEKTTLQ 1346

Query: 985  EKLVNSEKECNELK----STVDKYINIDEKKLISKFGNPKKLIE--ILRRQLVKEKRHKD 1146
              L  +E E N+L+    + V+ Y +I  +K   K     KL +  I   +LV E++ K 
Sbjct: 1347 ANLKTTEAELNDLQEKYSANVNSYNDIISEK--DKLTEEIKLSDDKIKELELVLEEKDKV 1404

Query: 1147 TLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQK 1326
               +  E   ++L+        F+E+ +  +R ++ + + L +  KE      E   L +
Sbjct: 1405 ITNQNAEIKNIKLD--------FEEKGNDYKRTIVDLKAKLSDLTKE----SAESKLLME 1452

Query: 1327 KISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSH 1506
            K   + + N E L+  S ++  +        +    T  E  + K  ++ E   N T+ +
Sbjct: 1453 KTIKDLEKNMETLKSESVISSNL--------STERITSLELEIAK--LTEEKKINQTNFN 1502

Query: 1507 KIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKST 1686
              IS+      N++  ++K+                 E+ Q K  ++ + + I   A  T
Sbjct: 1503 DKISELKSDIINLE--KEKDDSKEKNKTESAELKSEIEELQNKNFKMIEEHTITLDALKT 1560

Query: 1687 SVD-LEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNE 1863
             V+ LEK  +  + + N ++ + ++   L+                       KE+  N 
Sbjct: 1561 DVERLEKAKEDFQVQNNSLTSDLETKNELLHKL--------------------KEKSANT 1600

Query: 1864 LSSMKQQHVKVLEELENKIKTLQKSQL---TSKMEVEKHALNFDEMKDNNNLLKEYVDKL 2034
            +SS+K+       +L+ K K  ++S +       ++ + +  ++ +    +L ++ + ++
Sbjct: 1601 ISSLKEDLETQNLQLKEKTKCAEESAIELSNISKDLNELSAKYESLNSKLSLKQDALSEI 1660

Query: 2035 ENKIKTLEQDLAEN--ELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKN 2208
             N+   L   L ++  E+ + N     +N+    KI      E K S L+KE+  +  + 
Sbjct: 1661 TNENAELNSQLEKHKEEIADLNSSLNDINSRLDLKIKNFDSIESKNSDLEKELLKVNEEL 1720

Query: 2209 KNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFER--KK 2382
             +L++      LS   L++K+    TSLSE    + TQ+        K+ +    R  + 
Sbjct: 1721 AHLKESSSKTILS---LNDKI----TSLSEEFEKERTQLTEGSDSITKEYSEKINRLEES 1773

Query: 2383 LESVN-DSDISYLYYEN-LEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKND 2556
            L  V  D D   L Y+N L  + +Q     ++L   +ED  + TE+    +    K   +
Sbjct: 1774 LRKVELDKDKETLEYKNKLTSIIDQLSETEKDLTAAEEDKKILTETLNDQKTSLDKSHEE 1833

Query: 2557 LKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEK 2736
            L+    +L+   +  + K     N +S+LQ                 E L +   +   K
Sbjct: 1834 LELLNKQLSDALSDAQSK----VNCISELQS-------NNEALIKEVESLHLQITDLDSK 1882

Query: 2737 INNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANER 2916
            +N A V   +   E +      K   + LS +   I     ++L  E   N ++   NE+
Sbjct: 1883 LNEANVNSNSKENEISDLLIKAKDNSDQLSEMHSRI-----KTLTNEFELNEKL--LNEK 1935

Query: 2917 LEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIH--------EKKMXXXXXXX 3072
             EE     A  +GK  EI +      L+   I  +   L +        E+K+       
Sbjct: 1936 SEELSAIKAVTEGKENEIKKLTQELALSEEEIAVIKSKLKNSDETAASTERKLLETKEIL 1995

Query: 3073 XXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMEN----TTKLLALEESNAKLI 3240
                         N  +   S    + +         + EN    ++K+ +L+E   +L 
Sbjct: 1996 SQMP---TDLTTANKDKSDLSIQLTETKKQLDVLNLQINENGDLLSSKIESLKEKEDQLE 2052

Query: 3241 K---EVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKL 3411
            K   E +N  +  E L  QL+ +    + +  + N+L+ KV + E  +   + E++R++L
Sbjct: 2053 KLQIESDNSKEEIEKLKHQLSKLSENHDSILLDKNDLEAKVHDYENAIAERENEVKRYQL 2112

Query: 3412 RSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAK 3591
                +L +    +E       +KI   EE++ ++++E  +L   FD  KK     LD A 
Sbjct: 2113 ----LLNE----KERTSNDFKDKITVAEEEIHSLKSELDRLKIAFDEQKK----SLDLAS 2160

Query: 3592 TMQINLTTQI-NELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFS 3768
              + N  + + ++L  ++ N EK L ++ +K ++      D +E+   L+ E++   +  
Sbjct: 2161 EEKYNTNSILEDKLRISRDNFEKQLSEKDDKISELIIANTDATEKYSSLQTEIQSLKHLI 2220

Query: 3769 NELEKK---VEDAKKFKNE-IESLKSELQSVKAYENSTVNSK--IIKDLKESFKREKDEL 3930
            +E++++    E   K KN+ I+ L + + ++K+     +  K   I+ LK + K E+  L
Sbjct: 2221 DEIKEERDLYESNNKNKNDTIKDLTASIANIKSDCKMKIYEKDEEIELLKANTKYEERRL 2280

Query: 3931 IEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAE 4110
             E++             T L Q+ +++ +   E A +              +   IT  E
Sbjct: 2281 DEEL-------------TSLKQKYDDLKSKSTEEAILLKDKLQHKALNIETLNTEITRLE 2327

Query: 4111 ENLKK-RMRLPSEEKINAVI---EKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEK 4278
             N+ +  +     + +N  I   +     L ++ +  ++E       N  +      +E+
Sbjct: 2328 TNISELNLDTSKFKSLNEDILLKQSDNDSLSKKIDEIVKEKTDLKSANEELVIKSRTLEE 2387

Query: 4279 ELREKFNLELA-EIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQV 4449
            E++E  N + A + + K   + K++  ++++L E+  SK E+  LS  K+ND  ++++
Sbjct: 2388 EMKELSNSKNALQAELKTLSKLKEEKEIQTSLNEK--SKEENIQLS--KSNDELQSKI 2441

 Score =  148 bits (373), Expect = 9e-35
 Identities = 267/1316 (20%), Positives = 517/1316 (39%), Gaps = 47/1316 (3%)
 Frame = +1

Query: 97   EHALEKIYTKAYDLMKENSFVSAAIDDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGY 276
            E +L+++  +   L        A ++D++  Y   +N+ +                 S  
Sbjct: 1332 EESLKQLKKEKTTLQANLKTTEAELNDLQEKYSANVNSYND--IISEKDKLTEEIKLSDD 1389

Query: 277  LVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLEL 456
             +   +LV E++ +  +N   N+EI  IK D E    D+          +  +   K +L
Sbjct: 1390 KIKELELVLEEKDKVITNQ--NAEIKNIKLDFEEKGNDY----------KRTIVDLKAKL 1437

Query: 457  QDSLTENSA-----LKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIK 621
             D LT+ SA     +++ I   E  ++++  E  +++  + +  T ++L     L  E K
Sbjct: 1438 SD-LTKESAESKLLMEKTIKDLEKNMETLKSESVISSNLSTERITSLEL-EIAKLTEEKK 1495

Query: 622  CKETDKNKKLYSSAEDASRLQ----DQLQIVSSEILSLKSEIATLKYMN----------- 756
              +T+ N K+     D   L+    D  +   +E   LKSEI  L+  N           
Sbjct: 1496 INQTNFNDKISELKSDIINLEKEKDDSKEKNKTESAELKSEIEELQNKNFKMIEEHTITL 1555

Query: 757  ESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKN 936
            ++L TD++R     +D     NS   +   +  L  ++ E   N I+S K+ +E   ++N
Sbjct: 1556 DALKTDVERLEKAKEDFQVQNNSLTSDLETKNELLHKLKEKSANTISSLKEDLE---TQN 1612

Query: 937  LETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEI--- 1107
            L+  EK    E  +   +L N  K+ NEL +   KY +++ K  + +      L EI   
Sbjct: 1613 LQLKEKTKCAE--ESAIELSNISKDLNELSA---KYESLNSKLSLKQ----DALSEITNE 1663

Query: 1108 ---LRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEET 1278
               L  QL K K     L   +      L+ K+   DS + +NS LE+ELL++    EE 
Sbjct: 1664 NAELNSQLEKHKEEIADLNSSLNDINSRLDLKIKNFDSIESKNSDLEKELLKVN---EEL 1720

Query: 1279 AKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLV 1458
            A  ++   + + +L  KI++    ++E  ++R+ L                 TE   ++ 
Sbjct: 1721 AHLKESSSKTILSLNDKITS---LSEEFEKERTQL-----------------TEGSDSIT 1760

Query: 1459 KKIVSNENTENDTDSHKIISKRLLHFQNVKE-LQQKNMXXXXXXXXXXXXXXXXEQEQQK 1635
            K+     N   +       S R +     KE L+ KN                   E+ K
Sbjct: 1761 KEYSEKINRLEE-------SLRKVELDKDKETLEYKNKLTSIIDQLSETEKDLTAAEEDK 1813

Query: 1636 TL-------RITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXX 1794
             +       + T  +K  E  +  +  L   +   +SK+N IS+                
Sbjct: 1814 KILTETLNDQKTSLDKSHEELELLNKQLSDALSDAQSKVNCISE---------------- 1857

Query: 1795 XXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHA 1974
                         +   E L  E+ S+  Q    + +L++K+     +  + + E+    
Sbjct: 1858 ------------LQSNNEALIKEVESLHLQ----ITDLDSKLNEANVNSNSKENEISDLL 1901

Query: 1975 LNFDEMKDNNNLLKEYVDKLENKIKTL--EQDLAENELFEKNLITGGVNNLEQSKIIELS 2148
            +   + KDN++ L E    + ++IKTL  E +L E  L EK+     +  + + K  E+ 
Sbjct: 1902 I---KAKDNSDQLSE----MHSRIKTLTNEFELNEKLLNEKSEELSAIKAVTEGKENEIK 1954

Query: 2149 VAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIK 2328
               Q+++  ++EI+ +KSK KN ++   +        + K+L+ +  LS  ++P +    
Sbjct: 1955 KLTQELALSEEEIAVIKSKLKNSDETAAS-------TERKLLETKEILS--QMPTDLTTA 2005

Query: 2329 NEEKEPAKQQTYTFERKKLESVN-----DSDISYLYYENLEELQNQFRTLRRELKEVQED 2493
            N++K     Q  T  +K+L+ +N     + D+     E+L+E ++Q   L+ E    +E+
Sbjct: 2006 NKDKSDLSIQ-LTETKKQLDVLNLQINENGDLLSSKIESLKEKEDQLEKLQIESDNSKEE 2064

Query: 2494 LDMKTESHLKLENKYTKV---KNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXX 2664
            ++       KL   +  +   KNDL+   +   +     E       N V + Q      
Sbjct: 2065 IEKLKHQLSKLSENHDSILLDKNDLEAKVHDYENAIAERE-------NEVKRYQ------ 2111

Query: 2665 XXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSL---SRLR 2835
                        + +   N+  +KI  A   + ++  E    K AF   K SL   S  +
Sbjct: 2112 --------LLLNEKERTSNDFKDKITVAEEEIHSLKSELDRLKIAFDEQKKSLDLASEEK 2163

Query: 2836 QAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIG 3015
               NSI +  L I        D+  ++L E + K++      T+  E Y        ++ 
Sbjct: 2164 YNTNSILEDKLRISR------DNFEKQLSEKDDKISELIIANTDATEKYSSLQTEIQSLK 2217

Query: 3016 HLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMEN 3195
            HL+  +  E+ +              +  +NKN           D           +  +
Sbjct: 2218 HLIDEIKEERDLY------------ESNNKNKN-----------DTIKDLTASIANIKSD 2254

Query: 3196 TTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHL 3375
                +  ++   +L+K   N       L  +L  ++ K + L+ +  E  + + +K QH 
Sbjct: 2255 CKMKIYEKDEEIELLK--ANTKYEERRLDEELTSLKQKYDDLKSKSTEEAILLKDKLQHK 2312

Query: 3376 NICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRL 3555
             +  E L     R +T + +  +           K K+L E +   +++N  L+ + D +
Sbjct: 2313 ALNIETLNTEITRLETNISELNL--------DTSKFKSLNEDILLKQSDNDSLSKKIDEI 2364

Query: 3556 KKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRL 3735
             K+                T +   NE  V   ++L++E+++ + S N    E + + +L
Sbjct: 2365 VKE---------------KTDLKSANEELVIKSRTLEEEMKELSNSKNALQAELKTLSKL 2409

Query: 3736 RAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKE 3903
            + E E   + + + +++     K  +E++S  +EL    + E   +  K  +DL E
Sbjct: 2410 KEEKEIQTSLNEKSKEENIQLSKSNDELQSKIAELNK-DSMEQKRLLDKSRQDLSE 2464

 Score =  144 bits (362), Expect = 2e-33
 Identities = 309/1495 (20%), Positives = 583/1495 (38%), Gaps = 181/1495 (12%)
 Frame = +1

Query: 277  LVAREKLVSEKQKEFDSN-DALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLE 453
            L  +  ++S      +SN + + +E+  I   L    +++  L+A     E  ++    E
Sbjct: 745  LSEKHSILSGDNISLNSNYENIKNELNSISEQLSMASKENENLKATNASQEVDVKSLNKE 804

Query: 454  LQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYL--EIKCK 627
            L +       L++Q+ + + + D   + +   N E +KL T +  L E+   L  EIK +
Sbjct: 805  LNEKEKSIYELEKQLNLTKTEKDKAQEGINKMNNELRKLMTSIDTLNEDKSRLQNEIKLQ 864

Query: 628  ET---DKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRI 798
            +    DK  K+ S  E  S+  D L+    ++L+LK E        E L + L   L   
Sbjct: 865  KIELDDKETKINSEMEKTSKEYDNLK----KLLALKEEEI------EELKSKL---LISA 911

Query: 799  KDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKK-QIER-LTSKNLETPEKKIIQEL 972
            +DL +     K +F    +L  ++ E L     S+K+ +IER    ++L+T E+    EL
Sbjct: 912  RDLKEY----KGKFQSHDSLVPKLTEKLKTLATSFKELEIERDALLQSLKTNEENTSSEL 967

Query: 973  VDLKEKL--VNSEKECNEL--KSTVDKYINIDEK--KLISKFGNPKKLIEILRRQL---- 1122
              L  KL  + SE    E   K+ ++   N++ K   +I+   N KK +E  + +L    
Sbjct: 968  SLLTSKLDIIKSENATLEKNKKTLLENISNLESKIEDMITAHTNEKKALEESKEELEEFV 1027

Query: 1123 --------------VKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRIT 1260
                          ++       L+ +++SF  E+      +D+     S L+  L    
Sbjct: 1028 ISLNEQLEDLETSKLESSNKASELEAKIKSFNNEVNSYKNQLDTANNLISKLQISLDEAN 1087

Query: 1261 SSLEETAKER--DIK-----DRELTNLQKKISNNEQFNDELLRQRSDLAHQV----QYLL 1407
            S +E+  +++  D+K     D++L     ++SN +  NDELLR+R  L  ++    +   
Sbjct: 1088 SKIEQLEEDKVSDLKNLTKKDQKLEARDNELSNAKLQNDELLRERQSLKDELLSTKEKFN 1147

Query: 1408 LCIDNKSPFTEKEATLVKKIVSNENTEND---------------TDSHKIISKRLLHFQN 1542
               D+      K  T+ ++  + EN+ N+               T+ +  +    L  + 
Sbjct: 1148 SVNDDLEELNSKYVTIEEEKRTLENSINENQFTIKELKDNISGLTNDYNALESSKLDLE- 1206

Query: 1543 VKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEK------ 1704
             +EL  +                  E+   + L++   N ++++ ++   DLEK      
Sbjct: 1207 -EELSSQTTELDQKDTSLAELSKKLEEISSEKLKL---NSLLQNTETNLKDLEKVNEDKE 1262

Query: 1705 -HIKTLESKINII---SQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSS 1872
              I++LE ++ ++   S+E D+                         + +KE L N    
Sbjct: 1263 IRIQSLEKELKVVKSNSKETDN------KLQELSDKHDQMSREYEILKADKESLLNSKEK 1316

Query: 1873 MKQQH---VKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDN--------NNLLKE 2019
            + +Q+   V+ +   E  +K L+K + T +  ++      +++++         N+++ E
Sbjct: 1317 LYKQYNDNVEKINNYEESLKQLKKEKTTLQANLKTTEAELNDLQEKYSANVNSYNDIISE 1376

Query: 2020 YVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQ------------- 2160
              DKL  +IK  +  + E EL  +       N   + K I+L   E+             
Sbjct: 1377 -KDKLTEEIKLSDDKIKELELVLEEKDKVITNQNAEIKNIKLDFEEKGNDYKRTIVDLKA 1435

Query: 2161 KISFLDKEIS--------NLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLS----ERE 2304
            K+S L KE +         +K   KN+E       +S NL   ++  LE  ++    E++
Sbjct: 1436 KLSDLTKESAESKLLMEKTIKDLEKNMETLKSESVISSNLSTERITSLELEIAKLTEEKK 1495

Query: 2305 L------PKNTQIKNEEKEPAKQQTYTFERKKLESVN-DSDISYLYYENLEELQNQFRTL 2463
            +       K +++K++     K++  + E+ K ES    S+I  L  +N + ++    TL
Sbjct: 1496 INQTNFNDKISELKSDIINLEKEKDDSKEKNKTESAELKSEIEELQNKNFKMIEEHTITL 1555

Query: 2464 R------RELKEVQEDL---------DMKTESHL------KLENKYTKVKNDLKQATYKL 2580
                     L++ +ED          D++T++ L      K  N  + +K DL+    +L
Sbjct: 1556 DALKTDVERLEKAKEDFQVQNNSLTSDLETKNELLHKLKEKSANTISSLKEDLETQNLQL 1615

Query: 2581 ASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLL 2760
                   E+    L+N    L                  + L    NEN+E +N+    L
Sbjct: 1616 KEKTKCAEESAIELSNISKDLNELSAKYESLNSKLSLKQDALSEITNENAE-LNSQ---L 1671

Query: 2761 QTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIES---NYNTEIDHANERLEEAE 2931
            +   EE      +     + L    +  +SI+ ++  +E      N E+ H     E + 
Sbjct: 1672 EKHKEEIADLNSSLNDINSRLDLKIKNFDSIESKNSDLEKELLKVNEELAHLK---ESSS 1728

Query: 2932 VKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARY-RN 3108
              + S + K+T + E ++ +          +     EK              R+    ++
Sbjct: 1729 KTILSLNDKITSLSEEFEKERTQLTEGSDSITKEYSEK------INRLEESLRKVELDKD 1782

Query: 3109 KNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLL--ALEESNAKLIKEVENCTKVNETLS 3282
            K   E       I  Q           E   K+L   L +    L K  E    +N+ LS
Sbjct: 1783 KETLEYKNKLTSIIDQLSETEKDLTAAEEDKKILTETLNDQKTSLDKSHEELELLNKQLS 1842

Query: 3283 SQLADMQVKLEPLE--QEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEE 3456
              L+D Q K+  +   Q  NE  +K  E   HL I   +    KL    +    K   E 
Sbjct: 1843 DALSDAQSKVNCISELQSNNEALIKEVE-SLHLQITDLDS---KLNEANVNSNSK---EN 1895

Query: 3457 AHMKSLEKIKTLEEQLETVRTENAQLTDRF---DRLKKQAHEKLDAAKTM------QINL 3609
                 L K K   +QL  + +    LT+ F   ++L  +  E+L A K +      +I  
Sbjct: 1896 EISDLLIKAKDNSDQLSEMHSRIKTLTNEFELNEKLLNEKSEELSAIKAVTEGKENEIKK 1955

Query: 3610 TTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEII-RLRAELEKSNNFSNELEKK 3786
             TQ   L+E ++ + KS  +  ++   S      E++EI+ ++  +L  +N   ++L  +
Sbjct: 1956 LTQELALSEEEIAVIKSKLKNSDETAASTERKLLETKEILSQMPTDLTTANKDKSDLSIQ 2015

Query: 3787 VEDAKK---------------FKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREK 3921
            + + KK                 ++IESLK +   ++  +  + NS   K+  E  K + 
Sbjct: 2016 LTETKKQLDVLNLQINENGDLLSSKIESLKEKEDQLEKLQIESDNS---KEEIEKLKHQL 2072

Query: 3922 DELIEQ-----MXXXXXXXXXXXXXTILAQRKNNI-----LANGQESANIXXXXXXXXXX 4071
             +L E      +               +A+R+N +     L N +E  +           
Sbjct: 2073 SKLSENHDSILLDKNDLEAKVHDYENAIAERENEVKRYQLLLNEKERTSNDFKDKITVAE 2132

Query: 4072 XXALILK----RITEAEENLKKRMRLPSEEK--INAVIEKRRKVLEQEFETKLRE 4218
                 LK    R+  A +  KK + L SEEK   N+++E + ++    FE +L E
Sbjct: 2133 EEIHSLKSELDRLKIAFDEQKKSLDLASEEKYNTNSILEDKLRISRDNFEKQLSE 2187

 Score =  125 bits (315), Expect = 6e-28
 Identities = 178/885 (20%), Positives = 364/885 (41%), Gaps = 64/885 (7%)
 Frame = +1

Query: 1981 FDEMKDNNNLLKEYVDKLEN----KIKTLEQDLAE-----NELFEKNLITGGVN-----N 2118
            F++++ +   LK  +  LEN    KI TLE+ L E     N L EK+ I  G N     N
Sbjct: 703  FEKLQSDCTNLKNSLSALENDSSSKIDTLEEKLTELQNDFNILSEKHSILSGDNISLNSN 762

Query: 2119 LEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSE 2298
             E  K  EL+   +++S   KE  NLK+ N + E  + ++    N  +  + +LE  L+ 
Sbjct: 763  YENIKN-ELNSISEQLSMASKENENLKATNASQEVDVKSLNKELNEKEKSIYELEKQLN- 820

Query: 2299 RELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELK 2478
                    +   EK+ A+           E +N  +        L +L     TL  +  
Sbjct: 821  --------LTKTEKDKAQ-----------EGINKMN------NELRKLMTSIDTLNEDKS 855

Query: 2479 EVQEDLDMKTESHLKLENKYTKVKNDLKQATYK-------LASVYTTLEQKNSFLANSVS 2637
             +Q ++ ++    ++L++K TK+ +++++ + +       LA     +E+  S L  S  
Sbjct: 856  RLQNEIKLQK---IELDDKETKINSEMEKTSKEYDNLKKLLALKEEEIEELKSKLLISAR 912

Query: 2638 QLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMV--EENTTFKDAFKHF 2811
             L+                TEKL+       E       LLQ++   EENT+        
Sbjct: 913  DLKEYKGKFQSHDSLVPKLTEKLKTLATSFKELEIERDALLQSLKTNEENTS-------- 964

Query: 2812 KNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGK 2991
             + LS L   ++ I+ ++  +E N  T +++           +++ + K+ +++ ++  +
Sbjct: 965  -SELSLLTSKLDIIKSENATLEKNKKTLLEN-----------ISNLESKIEDMITAHTNE 1012

Query: 2992 ILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXX 3171
                                            ++A   +K   E+F   + +++Q     
Sbjct: 1013 --------------------------------KKALEESKEELEEF--VISLNEQLEDLE 1038

Query: 3172 XXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQV-------KLEPLEQE 3330
                 +E++ K   LE        EV +     +T ++ ++ +Q+       K+E LE++
Sbjct: 1039 TSK--LESSNKASELEAKIKSFNNEVNSYKNQLDTANNLISKLQISLDEANSKIEQLEED 1096

Query: 3331 -INELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLE 3507
             +++LK  + +K+Q L     EL   KL++  +L++ + +++E  + + EK  ++ + LE
Sbjct: 1097 KVSDLK-NLTKKDQKLEARDNELSNAKLQNDELLRERQSLKDEL-LSTKEKFNSVNDDLE 1154

Query: 3508 TVRTENAQLTDRFDRLKKQAHEKLDAAKTMQIN---LTTQINELNETKVNLEKSLQQEIE 3678
             + ++   + +    L+   +E     K ++ N   LT   N L  +K++LE+ L  +  
Sbjct: 1155 ELNSKYVTIEEEKRTLENSINENQFTIKELKDNISGLTNDYNALESSKLDLEEELSSQTT 1214

Query: 3679 KNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNE----IESLKSELQS 3846
            + +Q     A+ S+++  + +E  K N+     E  ++D +K   +    I+SL+ EL+ 
Sbjct: 1215 ELDQKDTSLAELSKKLEEISSEKLKLNSLLQNTETNLKDLEKVNEDKEIRIQSLEKELKV 1274

Query: 3847 VKAYENSTVNS---------------KIIKDLKESFKREKDELIEQMXXXXXXXXXXXXX 3981
            VK+    T N                +I+K  KES    K++L +Q              
Sbjct: 1275 VKSNSKETDNKLQELSDKHDQMSREYEILKADKESLLNSKEKLYKQYNDNVEKINNYEES 1334

Query: 3982 TILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSE--EKI 4155
                +++   L    ++                     I   ++ L + ++L  +  +++
Sbjct: 1335 LKQLKKEKTTLQANLKTTEAELNDLQEKYSANVNSYNDIISEKDKLTEEIKLSDDKIKEL 1394

Query: 4156 NAVIEKRRKVL-EQEFETKLRELGLNADGNG---VVTDTRAQIEKELREKFNLELAEIK- 4320
              V+E++ KV+  Q  E K  +L     GN     + D +A++    +E    +L   K 
Sbjct: 1395 ELVLEEKDKVITNQNAEIKNIKLDFEEKGNDYKRTIVDLKAKLSDLTKESAESKLLMEKT 1454

Query: 4321 ----KKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNET 4443
                +K  E  K +S++ S L   +++ LE +    T+    N+T
Sbjct: 1455 IKDLEKNMETLKSESVISSNLSTERITSLELEIAKLTEEKKINQT 1499

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 55/260 (21%), Positives = 118/260 (45%), Gaps = 5/260 (1%)
 Frame = +1

Query: 307  KQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSAL 486
            K K ++ ++ +       KY+   +  + T+L+ +    ++   +  + L+D L   +  
Sbjct: 2256 KMKIYEKDEEIELLKANTKYEERRLDEELTSLKQKYDDLKSKSTEEAILLKDKLQHKALN 2315

Query: 487  KEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAE 666
             E +     +L++   EL L  ++ K L   + L + +N  L  K  E  K K    SA 
Sbjct: 2316 IETLNTEITRLETNISELNLDTSKFKSLNEDILLKQSDNDSLSKKIDEIVKEKTDLKSAN 2375

Query: 667  D-----ASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSK 831
            +     +  L+++++ +S+   +L++E+ TL  + E             K++  +LN   
Sbjct: 2376 EELVIKSRTLEEEMKELSNSKNALQAELKTLSKLKEE------------KEIQTSLNEKS 2423

Query: 832  QEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKE 1011
            +E   +++   + N+ L ++IA   K  + +  K L    ++ + EL  LKE++   +KE
Sbjct: 2424 KEENIQLS---KSNDELQSKIAELNK--DSMEQKRLLDKSRQDLSELDILKEQIKILQKE 2478

Query: 1012 CNELKSTVDKYINIDEKKLI 1071
              ELK   +    +D+  L+
Sbjct: 2479 NTELKDNQNDSSEVDDLMLL 2498

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score =  151 bits (382), Expect = 7e-36
 Identities = 250/1300 (19%), Positives = 504/1300 (38%), Gaps = 62/1300 (4%)
 Frame = +1

Query: 700  VSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQ---EFAKEITLKQRV 870
            V ++  SLKS ++ L+  +    + L+++   IK L  N  +S+Q   E   +++     
Sbjct: 702  VQNQCTSLKSHLSELEIQSSEKRSQLEKQ---IKSLTSNFEASEQLKKELEDKLSTISEK 758

Query: 871  NELLHNEIASYKKQIERLTSKN-----LETPEKKIIQEL----VDLKEKLVNSEKECNEL 1023
             + L +E    KK++  +T+ N     L T ++K+ +EL     D KEKL   EK+  EL
Sbjct: 759  QQTLESEYEEKKKELAEITANNTSLEQLNTQKEKLTEELKKQLADTKEKLTQMEKQVKEL 818

Query: 1024 KSTVDKY---INIDEKKLISKFGNPKKLIEI---LRRQLVKEK----RHKDTLQRQVESF 1173
                +K    IN   + L S     +KL E     ++ L K K    + +  L+ Q+++ 
Sbjct: 819  SEHKEKNEQGINKMNRDLFSLQREKQKLEEDNKQSKKDLEKTKNDFTKQETKLKDQIKAK 878

Query: 1174 LVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFN 1353
             + +++    ++    ++     ++  ITS + E   +    D  +  L +K+       
Sbjct: 879  EILIKETTEKLNEATTQSKEYHDKIQNITSEMNEWQAKYKSHDTFVAKLTEKLKALATSF 938

Query: 1354 DELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKII------ 1515
             EL  +R  +  +++ +    D        E   ++++  N  +E D    KI       
Sbjct: 939  KELQAERDTIKSELEKITQERDTNIAAITSEKKSLEELYKNMESEKDGLLKKITELETGI 998

Query: 1516 ---SKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKST 1686
               +K+    ++  E + K +                E+E+ +TL  +   K+ E A S+
Sbjct: 999  ESDNKKFEDEKSALESETKRLTLEIAEFKSNAEKLDTERERLQTLTESYKEKLNE-ANSS 1057

Query: 1687 SVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNEL 1866
              +  K +  ++ +I     E  + K  +                      + +   NE 
Sbjct: 1058 IDEKNKDLNNIQQQIEGSQSEISTLKAEIT---------------------QLKTSLNEE 1096

Query: 1867 SSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKI 2046
             S ++   K+ EE E  I++ Q   L  + EV+       +  DNN+ LK+  D+L   +
Sbjct: 1097 KSTRKALEKLKEENETYIQSAQDELLQLQKEVDLLKSENKDALDNNSSLKQKYDEL---V 1153

Query: 2047 KTLEQDLAENELFEKNLITGGVNNLEQSKIIELSV-AEQKISFLDKEISNLKSKNKNLED 2223
            K LE                 + NLE  ++ + S+    KI  L+ +I +  +  K LE+
Sbjct: 1154 KELE-----------------LKNLESKQLSDNSLNLNSKIEQLEGDIKSKYNTIKELEE 1196

Query: 2224 KILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDS 2403
            K                 L TSL ERE         E K  +K++ YT +  KLE +  S
Sbjct: 1197 K-----------------LSTSLQEREENIANIADIELKLNSKEEQYTEQTNKLEELRIS 1239

Query: 2404 DISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLA 2583
                      E+ Q++ + L  +LK   +DL  K     +L+     +  D ++    L 
Sbjct: 1240 ---------FEKKQSECKELESKLKSSNDDLQEKNRLTKELQKNLDSLMKDKEKTEGSLQ 1290

Query: 2584 SVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQ 2763
            S+    +Q+       + QL                  E +     E + ++ +    + 
Sbjct: 1291 SLLEDKKQEEKKYKEEIDQL--------------GKENEDITKQNKELNLRLEDYSAKID 1336

Query: 2764 TMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMA 2943
               EE     DA    K  + +L + I  ++    + + + N+        LE+  ++M 
Sbjct: 1337 AKDEELKLANDAVASTKKKMLKLEEKIKDLEDTQHIFKDSENS----LKSELEKTALEM- 1391

Query: 2944 SFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPRE 3123
                   E+    D  I     +      LI E K             +       +  E
Sbjct: 1392 ------NELRSDNDNIIKLKNELQRTNDKLIEENKRTEEKLRSEVAKLKDELKTKSDTFE 1445

Query: 3124 KFPSFVKIDQQSXXXXXXXXVMENTTKLLALEES----NAKLIKEVENCTKVNETLSSQL 3291
            K    +  D  +        + E + K+ +LEE      ++  KE+       E L S+L
Sbjct: 1446 KERKLMNEDSSTI-------IKEYSEKISSLEEKVETIKSEYDKEINILEDKKEVLESEL 1498

Query: 3292 ADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQ----------------- 3420
            +D + ++    Q+I E + K  EKE+ + + +  L+  + + +                 
Sbjct: 1499 SDKKQEIIDYNQKIKEQETKATEKEKEIQVAKNALKNAEKKKKDIENDLRTTIATVEKEN 1558

Query: 3421 TILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQ 3600
            T L++   ++ E+  K    I  L+E+L   +    +  D   +L+K+  + +D    ++
Sbjct: 1559 TTLKRENQLKSESIDKHQNNIHLLQEELSKQKELADKKHDEIRKLEKENSKMIDRIDKLE 1618

Query: 3601 INLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELE 3780
                 Q  + NE   N+EK     I +         +  +EI  L++ LEK+++ S+  +
Sbjct: 1619 ----KQKADTNEKIANIEKENSSLISERKTLVEKVENFQDEITNLKSSLEKNDSLSSSHD 1674

Query: 3781 KKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXX 3960
            +  +   + + E++   +EL  +++ EN  ++ K+I+  ++    EK+    Q       
Sbjct: 1675 ELKDKFNELETELKRNLTELNKLES-ENKQLSDKVIEHEEKVSMVEKELSTAQK------ 1727

Query: 3961 XXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLP 4140
                       + + +++   ++S N                 + IT+ + ++ +     
Sbjct: 1728 ---------TLKEREDVINKLKDSNNELNKTIDKHGATEKHYEESITKKDSDIAQ----- 1773

Query: 4141 SEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKEL---REKFN---- 4299
             ++KI  + +K   +LE++ +  +    L  D    + ++ +++++EL   R K++    
Sbjct: 1774 LKKKIKDIEDKLSNILEEKAKAAMLMTQLEKDKTD-LKNSESELKQELEHYRSKYSSLES 1832

Query: 4300 --LELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLS 4413
                  E KK   EE ++Q    S  L+    KL+S  +S
Sbjct: 1833 KLKSTEEAKKHVEEESREQHQSMSLDLKATKDKLKSAEIS 1872

 Score =  137 bits (344), Expect = 2e-31
 Identities = 239/1230 (19%), Positives = 508/1230 (41%), Gaps = 85/1230 (6%)
 Frame = +1

Query: 289  EKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSL 468
            ++L   K+K     + +N ++  ++ + + ++ D+   +    KT+N   +         
Sbjct: 816  KELSEHKEKNEQGINKMNRDLFSLQREKQKLEEDNKQSKKDLEKTKNDFTK--------- 866

Query: 469  TENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDK--- 639
             + + LK+QI   E  +   T++L  A T++K+    ++ +       + K K  D    
Sbjct: 867  -QETKLKDQIKAKEILIKETTEKLNEATTQSKEYHDKIQNITSEMNEWQAKYKSHDTFVA 925

Query: 640  --NKKLYSSAEDASRLQDQLQIVSSE-----------ILSLKSEIATLKYMNESLSTDLQ 780
               +KL + A     LQ +   + SE           I ++ SE  +L+ + +++ ++  
Sbjct: 926  KLTEKLKALATSFKELQAERDTIKSELEKITQERDTNIAAITSEKKSLEELYKNMESEKD 985

Query: 781  RKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTS--KNLETPEK 954
              L +I +L+  + S  ++F  E +  +   + L  EIA +K   E+L +  + L+T  +
Sbjct: 986  GLLKKITELETGIESDNKKFEDEKSALESETKRLTLEIAEFKSNAEKLDTERERLQTLTE 1045

Query: 955  KIIQELVDLKEKLVNSEKECNELKSTVD-KYINIDEKKL-ISKFGNPKKLIEILRRQLVK 1128
               ++L +    +    K+ N ++  ++     I   K  I++        +  R+ L K
Sbjct: 1046 SYKEKLNEANSSIDEKNKDLNNIQQQIEGSQSEISTLKAEITQLKTSLNEEKSTRKALEK 1105

Query: 1129 EKRHKDTLQRQVESFLVELEQKLPMIDSFK----ERNSSLERELLRITSSLE-ETAKERD 1293
             K   +T  +  +  L++L++++ ++ S      + NSSL+++   +   LE +  + + 
Sbjct: 1106 LKEENETYIQSAQDELLQLQKEVDLLKSENKDALDNNSSLKQKYDELVKELELKNLESKQ 1165

Query: 1294 IKDRELTNLQKKISN---------------NEQFNDELLRQRSDLAHQVQYLLLCIDNKS 1428
            + D  L NL  KI                  E+ +  L  +  ++A+     L     + 
Sbjct: 1166 LSDNSL-NLNSKIEQLEGDIKSKYNTIKELEEKLSTSLQEREENIANIADIELKLNSKEE 1224

Query: 1429 PFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXX 1608
             +TE+   L +  +S E  +++    K +  +L    +  +LQ+KN              
Sbjct: 1225 QYTEQTNKLEELRISFEKKQSEC---KELESKLKSSND--DLQEKN-------------- 1265

Query: 1609 XXXEQEQQKTL--RITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXX 1782
                +E QK L   + D  K   S +S   D ++  K  + +I+ + +E +     +   
Sbjct: 1266 -RLTKELQKNLDSLMKDKEKTEGSLQSLLEDKKQEEKKYKEEIDQLGKENED----ITKQ 1320

Query: 1783 XXXXXXXXXXXXXXXXCELEKERLTNE-LSSMKQQHVKV---LEELENKIKTLQKSQLTS 1950
                             + E+ +L N+ ++S K++ +K+   +++LE+     + S+ + 
Sbjct: 1321 NKELNLRLEDYSAKIDAKDEELKLANDAVASTKKKMLKLEEKIKDLEDTQHIFKDSENSL 1380

Query: 1951 KMEVEKHALNFDEMK-DNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQ 2127
            K E+EK AL  +E++ DN+N++     KL+N+++     L E     +  +   V  L+ 
Sbjct: 1381 KSELEKTALEMNELRSDNDNII-----KLKNELQRTNDKLIEENKRTEEKLRSEVAKLKD 1435

Query: 2128 SKIIELSVAEQKISFLDKEISNL----KSKNKNLEDKILTMTLSK----NLLDNKVLQLE 2283
                +    E++   ++++ S +      K  +LE+K+ T+        N+L++K   LE
Sbjct: 1436 ELKTKSDTFEKERKLMNEDSSTIIKEYSEKISSLEEKVETIKSEYDKEINILEDKKEVLE 1495

Query: 2284 TSLSERE---LPKNTQIKNEEK---------EPAKQQTYTFERKKLESVNDSDISYLYYE 2427
            + LS+++   +  N +IK +E          + AK      E+KK +  ND         
Sbjct: 1496 SELSDKKQEIIDYNQKIKEQETKATEKEKEIQVAKNALKNAEKKKKDIEND--------- 1546

Query: 2428 NLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDL---KQATYKLASVYTT 2598
                L+    T+ +E   ++ +  +K+ES  K +N    ++ +L   K+   K       
Sbjct: 1547 ----LRTTIATVEKENTTLKRENQLKSESIDKHQNNIHLLQEELSKQKELADKKHDEIRK 1602

Query: 2599 LEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEE 2778
            LE++NS + + + +L+                 EK+   E ENS  I+      +T+VE+
Sbjct: 1603 LEKENSKMIDRIDKLE----------KQKADTNEKIANIEKENSSLISER----KTLVEK 1648

Query: 2779 NTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGK 2958
               F+D   + K+SL +   +++S   +     +   TE+      L + E +      K
Sbjct: 1649 VENFQDEITNLKSSLEK-NDSLSSSHDELKDKFNELETELKRNLTELNKLESENKQLSDK 1707

Query: 2959 VTEILE--SYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFP 3132
            V E  E  S   K L+TA      ++L   + +            +         +    
Sbjct: 1708 VIEHEEKVSMVEKELSTAQ-----KTLKEREDVINKLKDSNNELNKTIDKHGATEKHYEE 1762

Query: 3133 SFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKL 3312
            S  K D  S        + +   KL  + E  AK    +    K    L +  ++++ +L
Sbjct: 1763 SITKKD--SDIAQLKKKIKDIEDKLSNILEEKAKAAMLMTQLEKDKTDLKNSESELKQEL 1820

Query: 3313 EPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTL 3492
            E    + + L+ K+   E+     +EE           L+  K   + A + S+ ++  +
Sbjct: 1821 EHYRSKYSSLESKLKSTEEAKKHVEEESREQHQSMSLDLKATKDKLKSAEI-SISEMDAI 1879

Query: 3493 EEQLETVRTEN-------------AQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELN 3633
            ++Q+E +  EN             A+L    D LKK+ +EKL     +++N  +++++L 
Sbjct: 1880 KKQVELLTKENVDLKSKSNKADNSAKLKSELDELKKE-NEKLQ----LKVNDRSELDDLM 1934

Query: 3634 ETKVNLEKSLQQEIEKNNQSGNGAADESEE 3723
                 L++   +  EK ++ G   + + E+
Sbjct: 1935 LLVTELDEKNSKYREKLSELGVELSSDEED 1964

 Score =  119 bits (298), Expect = 5e-26
 Identities = 203/925 (21%), Positives = 395/925 (42%), Gaps = 64/925 (6%)
 Frame = +1

Query: 1846 ERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYV 2025
            E+    L+S  +   ++ +ELE+K+ T+ + Q T + E E+      E+  NN  L++  
Sbjct: 728  EKQIKSLTSNFEASEQLKKELEDKLSTISEKQQTLESEYEEKKKELAEITANNTSLEQLN 787

Query: 2026 DKLENKIKTLEQDLAE------------NELFE-KNLITGGVNNLEQSKIIELSVAEQKI 2166
             + E   + L++ LA+             EL E K     G+N + +  +  L   +QK+
Sbjct: 788  TQKEKLTEELKKQLADTKEKLTQMEKQVKELSEHKEKNEQGINKMNRD-LFSLQREKQKL 846

Query: 2167 SFLDKEISNLKSKNKN----LEDKILTMTLSKNLL---DNKVLQLETSLSERELPKNTQI 2325
               +K+      K KN     E K+     +K +L     + L   T+ S+    K   I
Sbjct: 847  EEDNKQSKKDLEKTKNDFTKQETKLKDQIKAKEILIKETTEKLNEATTQSKEYHDKIQNI 906

Query: 2326 KNEEKE-PAKQQTY-TFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLD 2499
             +E  E  AK +++ TF  K  E +     S+      +ELQ +  T++ EL+++ ++ D
Sbjct: 907  TSEMNEWQAKYKSHDTFVAKLTEKLKALATSF------KELQAERDTIKSELEKITQERD 960

Query: 2500 MK----TESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXX 2667
                  T     LE  Y  ++++      K+  + T +E  N    +  S L+       
Sbjct: 961  TNIAAITSEKKSLEELYKNMESEKDGLLKKITELETGIESDNKKFEDEKSALESETKRL- 1019

Query: 2668 XXXXXXXXXTEKLQMAE-NENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAI 2844
                        L++AE   N+EK++     LQT+ E   ++K+      +S+    + +
Sbjct: 1020 -----------TLEIAEFKSNAEKLDTERERLQTLTE---SYKEKLNEANSSIDEKNKDL 1065

Query: 2845 NSIQQQSLVIESNYNT---EIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIG 3015
            N+IQQQ    +S  +T   EI      L E +    + + K+ E  E+Y           
Sbjct: 1066 NNIQQQIEGSQSEISTLKAEITQLKTSLNEEKSTRKALE-KLKEENETY----------- 1113

Query: 3016 HLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMEN 3195
              ++S   E               + A   N + ++K+   VK                 
Sbjct: 1114 --IQSAQDELLQLQKEVDLLKSENKDALDNNSSLKQKYDELVK----------------- 1154

Query: 3196 TTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHL 3375
                  LE  N +  +  +N   +N  +     D++ K   +++   +L   + E+E+++
Sbjct: 1155 -----ELELKNLESKQLSDNSLNLNSKIEQLEGDIKSKYNTIKELEEKLSTSLQEREENI 1209

Query: 3376 -NICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDR 3552
             NI   EL+      Q   Q  K+  EE  +   +K    +E    +++ N  L ++ +R
Sbjct: 1210 ANIADIELKLNSKEEQYTEQTNKL--EELRISFEKKQSECKELESKLKSSNDDLQEK-NR 1266

Query: 3553 LKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEI-I 3729
            L K+  + LD+    +      +  L E K   EK  ++EI++  +       +++E+ +
Sbjct: 1267 LTKELQKNLDSLMKDKEKTEGSLQSLLEDKKQEEKKYKEEIDQLGKENEDITKQNKELNL 1326

Query: 3730 RLR----------AELEKSNNF-------SNELEKKVEDAKK----FKNEIESLKSELQ- 3843
            RL            EL+ +N+          +LE+K++D +     FK+   SLKSEL+ 
Sbjct: 1327 RLEDYSAKIDAKDEELKLANDAVASTKKKMLKLEEKIKDLEDTQHIFKDSENSLKSELEK 1386

Query: 3844 -SVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILAN 4020
             +++  E  + N  IIK LK   +R  D+LIE+              + +A+ K+ +   
Sbjct: 1387 TALEMNELRSDNDNIIK-LKNELQRTNDKLIEE-----NKRTEEKLRSEVAKLKDEL--- 1437

Query: 4021 GQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEE---KINAVIEKRRKVLE 4191
             +  ++             + I+K  +E   +L++++     E   +IN ++E +++VLE
Sbjct: 1438 -KTKSDTFEKERKLMNEDSSTIIKEYSEKISSLEEKVETIKSEYDKEIN-ILEDKKEVLE 1495

Query: 4192 QEFETKLRELGLNADGNGVVTDTRA-QIEKELREKFN-LELAEIKKKAFEEGKQQSM--- 4356
             E   K +E+ ++ +      +T+A + EKE++   N L+ AE KKK  E   + ++   
Sbjct: 1496 SELSDKKQEI-IDYNQKIKEQETKATEKEKEIQVAKNALKNAEKKKKDIENDLRTTIATV 1554

Query: 4357 -MKSTLLERKLSKLESQTLSPTKNN 4428
              ++T L+R+ ++L+S+++   +NN
Sbjct: 1555 EKENTTLKRE-NQLKSESIDKHQNN 1578

 Score =  117 bits (294), Expect = 1e-25
 Identities = 229/1187 (19%), Positives = 460/1187 (38%), Gaps = 24/1187 (2%)
 Frame = +1

Query: 952  KKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKE 1131
            +++  +   LK  L   E + +E +S ++K I    K L S F   ++L + L  +L   
Sbjct: 700  EEVQNQCTSLKSHLSELEIQSSEKRSQLEKQI----KSLTSNFEASEQLKKELEDKLSTI 755

Query: 1132 KRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDREL 1311
               + TL+ + E    EL +      S ++ N+  E+    +   L +T ++    ++++
Sbjct: 756  SEKQQTLESEYEEKKKELAEITANNTSLEQLNTQKEKLTEELKKQLADTKEKLTQMEKQV 815

Query: 1312 TNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTEN 1491
              L +    NEQ  +++ R    L  + Q L    DNK    + E T       N+ T+ 
Sbjct: 816  KELSEHKEKNEQGINKMNRDLFSLQREKQKLEE--DNKQSKKDLEKT------KNDFTKQ 867

Query: 1492 DTD-SHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQK-TLRITDNNKI 1665
            +T    +I +K +L  +  ++L +                    + Q K     T   K+
Sbjct: 868  ETKLKDQIKAKEILIKETTEKLNEATTQSKEYHDKIQNITSEMNEWQAKYKSHDTFVAKL 927

Query: 1666 VESAKSTSV---DLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCE 1836
             E  K+ +    +L+    T++S++  I+QERD+    +                    +
Sbjct: 928  TEKLKALATSFKELQAERDTIKSELEKITQERDTNIAAITSE-----------------K 970

Query: 1837 LEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLK 2016
               E L   + S K   +K + ELE  I++  K     K E EK AL             
Sbjct: 971  KSLEELYKNMESEKDGLLKKITELETGIESDNK-----KFEDEKSAL------------- 1012

Query: 2017 EYVDKLENKIKTLEQDLAENELFEKNLITGG--VNNLEQSKIIELSVAEQKISFLDKEIS 2190
                  E++ K L  ++AE +   + L T    +  L +S   +L+ A   I   +K+++
Sbjct: 1013 ------ESETKRLTLEIAEFKSNAEKLDTERERLQTLTESYKEKLNEANSSIDEKNKDLN 1066

Query: 2191 NLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTF 2370
            N++ + +  + +I T       L  ++ QL+TSL+E +  +    K +E+     Q+   
Sbjct: 1067 NIQQQIEGSQSEIST-------LKAEITQLKTSLNEEKSTRKALEKLKEENETYIQSAQD 1119

Query: 2371 ERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVK 2550
            E  +L+     ++  L  EN + L N   +L+++  E+ ++L++K     +L +    + 
Sbjct: 1120 ELLQLQK----EVDLLKSENKDALDNN-SSLKQKYDELVKELELKNLESKQLSDNSLNLN 1174

Query: 2551 NDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENS 2730
            + ++Q    + S Y T+++    L+ S+ + +                         EN 
Sbjct: 1175 SKIEQLEGDIKSKYNTIKELEEKLSTSLQERE-------------------------ENI 1209

Query: 2731 EKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHAN 2910
              I +  + L +  E+ T          N L  LR +    Q +   +ES   +  D   
Sbjct: 1210 ANIADIELKLNSKEEQYT-------EQTNKLEELRISFEKKQSECKELESKLKSSNDDLQ 1262

Query: 2911 ERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXR 3090
            E+    +    + D  + +       K     ++  L+     E+K              
Sbjct: 1263 EKNRLTKELQKNLDSLMKD-------KEKTEGSLQSLLEDKKQEEKKYKEEIDQLGKENE 1315

Query: 3091 RARYRNKNPREKFPSF-VKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKV 3267
                +NK    +   +  KID +          + +T K +   E   K +++ ++  K 
Sbjct: 1316 DITKQNKELNLRLEDYSAKIDAKDEELKLANDAVASTKKKMLKLEEKIKDLEDTQHIFKD 1375

Query: 3268 NETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIV 3447
            +E        ++ +LE    E+NEL+        ++   + EL+R    +  ++++ K  
Sbjct: 1376 SEN------SLKSELEKTALEMNELR----SDNDNIIKLKNELQR---TNDKLIEENKRT 1422

Query: 3448 EEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDA----AKTMQINLTT 3615
            EE+   +  +    L+ + +T   E   + +    + K+  EK+ +     +T++     
Sbjct: 1423 EEKLRSEVAKLKDELKTKSDTFEKERKLMNEDSSTIIKEYSEKISSLEEKVETIKSEYDK 1482

Query: 3616 QINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVED 3795
            +IN L + K  LE  L              +D+ +EII    ++++    + E EK+++ 
Sbjct: 1483 EINILEDKKEVLESEL--------------SDKKQEIIDYNQKIKEQETKATEKEKEIQV 1528

Query: 3796 AKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXX 3975
            AK      E  K ++++      +TV  +       + KRE     E +           
Sbjct: 1529 AKNALKNAEKKKKDIENDLRTTIATVEKE-----NTTLKRENQLKSESID---------- 1573

Query: 3976 XXTILAQRKNNI------LANGQESANIXXXXXXXXXXXXALILKRITEAE-ENLKKRMR 4134
                  + +NNI      L+  +E A+             + ++ RI + E +      +
Sbjct: 1574 ------KHQNNIHLLQEELSKQKELADKKHDEIRKLEKENSKMIDRIDKLEKQKADTNEK 1627

Query: 4135 LPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAE 4314
            + + EK N+ +   RK L ++ E    E+  N   +    D+ +    EL++KFN    E
Sbjct: 1628 IANIEKENSSLISERKTLVEKVENFQDEI-TNLKSSLEKNDSLSSSHDELKDKFNELETE 1686

Query: 4315 IKKKAFEEGKQQSMMKSTL-----LERKLSKLESQTLSPTKNNDSNE 4440
            +K+   E  K +S  K         E K+S +E +  +  K     E
Sbjct: 1687 LKRNLTELNKLESENKQLSDKVIEHEEKVSMVEKELSTAQKTLKERE 1733

 Score =  114 bits (285), Expect = 2e-24
 Identities = 151/737 (20%), Positives = 315/737 (42%), Gaps = 62/737 (8%)
 Frame = +1

Query: 277  LVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLEL 456
            L  + +L  E QK  DS   L  +    +  L+++  D    +  E+K +  ++Q   E 
Sbjct: 1261 LQEKNRLTKELQKNLDS---LMKDKEKTEGSLQSLLEDK---KQEEKKYKEEIDQLGKEN 1314

Query: 457  QDSLTENSALKEQIGVFEGKLDSMTQELWLAN-----TENKKLQTGMKLL---------- 591
            +D   +N  L  ++  +  K+D+  +EL LAN     T+ K L+   K+           
Sbjct: 1315 EDITKQNKELNLRLEDYSAKIDAKDEELKLANDAVASTKKKMLKLEEKIKDLEDTQHIFK 1374

Query: 592  -RENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILS--------LKSEIATL 744
              EN+L  E++    + N+ L S  ++  +L+++LQ  + +++         L+SE+A L
Sbjct: 1375 DSENSLKSELEKTALEMNE-LRSDNDNIIKLKNELQRTNDKLIEENKRTEEKLRSEVAKL 1433

Query: 745  K---------------YMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNEL 879
            K                MNE  ST ++    +I  L++ + + K E+ KEI + +   E+
Sbjct: 1434 KDELKTKSDTFEKERKLMNEDSSTIIKEYSEKISSLEEKVETIKSEYDKEINILEDKKEV 1493

Query: 880  LHNEIASYKKQI----ERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYI 1047
            L +E++  K++I    +++  +  +  EK+  +E+   K  L N+EK+  ++++ +   I
Sbjct: 1494 LESELSDKKQEIIDYNQKIKEQETKATEKE--KEIQVAKNALKNAEKKKKDIENDLRTTI 1551

Query: 1048 NIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERN 1227
               EK+  +           L+R+   +    D  Q  +     EL ++  + D   +  
Sbjct: 1552 ATVEKENTT-----------LKRENQLKSESIDKHQNNIHLLQEELSKQKELADKKHDEI 1600

Query: 1228 SSLERELLRITSSLEETAKERDIKDRELTNLQKK-----------ISNNEQFNDELLRQR 1374
              LE+E  ++   +++  K++   + ++ N++K+           +   E F DE+   +
Sbjct: 1601 RKLEKENSKMIDRIDKLEKQKADTNEKIANIEKENSSLISERKTLVEKVENFQDEITNLK 1660

Query: 1375 SDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKEL 1554
            S L           + K  F E E  L + +   E  + ++++ ++  K + H + V  +
Sbjct: 1661 SSLEKNDSLSSSHDELKDKFNELETELKRNL--TELNKLESENKQLSDKVIEHEEKVSMV 1718

Query: 1555 QQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSV--------DLEKHI 1710
            +++                  +    +  +  D +   E     S+         L+K I
Sbjct: 1719 EKELSTAQKTLKEREDVINKLKDSNNELNKTIDKHGATEKHYEESITKKDSDIAQLKKKI 1778

Query: 1711 KTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHV 1890
            K +E K++ I +E+    +L+                    E +K  L N  S +KQ+  
Sbjct: 1779 KDIEDKLSNILEEKAKAAMLM-----------------TQLEKDKTDLKNSESELKQE-- 1819

Query: 1891 KVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLA 2070
              LE   +K  +L+ S+L S  E +KH    +E ++ +  +   +   ++K+K+ E  ++
Sbjct: 1820 --LEHYRSKYSSLE-SKLKSTEEAKKHV--EEESREQHQSMSLDLKATKDKLKSAEISIS 1874

Query: 2071 ENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSK 2250
            E +  +K +      N++   +   S      + L  E+  LK +N+ L+ K+      +
Sbjct: 1875 EMDAIKKQVELLTKENVD---LKSKSNKADNSAKLKSELDELKKENEKLQLKV----NDR 1927

Query: 2251 NLLDNKVLQLETSLSER 2301
            + LD+ +L L T L E+
Sbjct: 1928 SELDDLML-LVTELDEK 1943

>ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] {ON}
            similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 2005

 Score =  145 bits (365), Expect = 7e-34
 Identities = 268/1293 (20%), Positives = 519/1293 (40%), Gaps = 77/1293 (5%)
 Frame = +1

Query: 286  REKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDS 465
            R+ L SE  K+  + +  N   T     ++ ++     + A + K E  + +   EL   
Sbjct: 772  RDNLSSENTKKQKALETANQTNTSSGEKVKTLENKLKGVTADKNKAEEGINKMTRELMSL 831

Query: 466  LTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLY-LEIKCKE---- 630
                  L+ +I   + K D +T E      + +K+  G+   R+ NL  L++  K+    
Sbjct: 832  TRSKGELESKIKDLQKKTDKLTNEFG----KKEKVFEGILEKRDQNLEALQVNIKKAEER 887

Query: 631  -----TDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFR 795
                 ++KN  +  S E  S+ Q    ++S     LKS   + K +     + L R L  
Sbjct: 888  IASLNSEKNALIKESGEWKSKFQSHDNLISKMTEKLKSFSESYKELQNERDS-LSRSLHE 946

Query: 796  IKDLDDN-LNSSKQEFA----KEITLKQRVNELLHNEIASYKKQIERLTSKNL-ETPEKK 957
                  N L + K E A    +++ L     ELL  +++S     E L+ ++  ET +  
Sbjct: 947  ASSNSSNELTALKNELATLSAEKVKLNSEKQELLE-QVSSLNSSYESLSKRHQDETSDLN 1005

Query: 958  IIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKR 1137
            +  E+  LKE + + + + +ELK++ D+        +     N ++  +I   Q+  ++ 
Sbjct: 1006 V--EVEKLKETVSHLKVQVDELKTSRDQ--------ITENANNLQEQCKIFEGQIENQEA 1055

Query: 1138 HKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSS----LEETAKERDIKDR 1305
             K    ++ E   +EL+Q   +  +  E+ +  ++EL     S    L +  K+ + K++
Sbjct: 1056 EK----KEAEKRYMELKQNFQVSTTDLEKLAKEKQELNDAKGSNEKELNKLKKDLEGKEQ 1111

Query: 1306 ELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENT 1485
            +L ++ ++    E+  DE     +D   +++  +  ++++    +KEA    K + NE  
Sbjct: 1112 KLKSITERAQELEKTLDEQRNSNADSERKLKENIKALEHQ----KKEAISNSKELENE-L 1166

Query: 1486 ENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQE-QQKTLRITDNNK 1662
            +   + HK + ++  + ++V+EL+ + +                E + Q+++  +    K
Sbjct: 1167 DQLKNKHKSLDEQ--NTKSVEELKTRVLEVEKERDEKHNNVQKIENKLQEESKSLESLQK 1224

Query: 1663 IVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELE 1842
              ES KS    L+  + +L  + N +  E+++ K                       E +
Sbjct: 1225 SQESNKSKLKVLQDKLDSLLQEKNDLVSEKNNLKENFAKVKEDFEESQRKIHGLKESEKK 1284

Query: 1843 KERLTNELSS-------MKQQHVKVLE----ELENKIKTLQ---------KSQLTSKMEV 1962
            K    +EL         +KQ+ +  LE    E++  +K LQ           ++  K+E 
Sbjct: 1285 KNHELHELQKKFKGELDVKQKQIADLERSREEVDKNLKNLQVDVKNVSEENKKVIEKLEK 1344

Query: 1963 EKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELF-EKNLITG----------- 2106
            EK AL+  E+       KE +D  + KIK LE    E +L  E N +T            
Sbjct: 1345 EKEALSL-ELNKLRKSSKENLDDRDKKIKDLEGK--ETKLSSELNQLTNKFKEDSKKNQE 1401

Query: 2107 GVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLET 2286
             + +LE+ K I   + +Q+         +L+ K K + D           L+N V ++ +
Sbjct: 1402 NIQHLEEEKKI---ITDQRAELQKNSKMDLEKKEKKIRD-----------LENSVKRISS 1447

Query: 2287 SLSERELPKNTQIKNEEKEPAKQ------QTYTFERKKLESVNDSDISYLYYENLEELQN 2448
             LS+  L K++Q   EE E  K+      Q +  ERK L   +D+ ++  Y E +  L++
Sbjct: 1448 ELSK--LQKSSQNDKEEVESVKKDLQEKVQAFEKERKLLNEGSDA-VTKQYSERITVLED 1504

Query: 2449 QFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLAN 2628
            +      E++   ++L+    +    +    +++N L++   +++S+ +T+ ++   +  
Sbjct: 1505 KVHQTELEVQRKNKELESAKSA---ADEASGELRNQLEEKVVEVSSLKSTIGEQEKAIKK 1561

Query: 2629 SVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKH 2808
              S L                  E L+ A ++   +I      L     E    +D    
Sbjct: 1562 LESDLTDSRESGNKKIEDLNGELEALKKALSDKQAEIEANKSDLNKRAGERKELEDTIAT 1621

Query: 2809 FKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDG 2988
             +  +    +A+  ++  +   + N    I   +  +E+ EV          ++ +  + 
Sbjct: 1622 LQKKVENSSKALQQLENSTDSSKKNQENLIKEKDTNIEKLEVA-------AKDLRKKDED 1674

Query: 2989 KILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQ-SXX 3165
            K    AA+     S+    +                    KN +EK  S  +   Q +  
Sbjct: 1675 KSKQLAALESEKSSMKENLE--------------------KNVKEKDESIAQFKSQVADM 1714

Query: 3166 XXXXXXVMENTTKL--LALEESNA--KLIKEVENCTKVNETLSSQLADMQVKLEPLEQEI 3333
                  + ENT KL  +  EE +   KL +  E   K+ + L  +  D Q     LEQ+ 
Sbjct: 1715 ESLKKELDENTNKLERMKFEEKSRIEKLTEITEEKKKIQKELEKRSEDAQNSRTELEQKT 1774

Query: 3334 NELKLKVAEK-------EQHLNICQEELERWKLRSQTILQQGKIV--EEEAHMKSLEKIK 3486
            +ELK   AEK       E+ L+  +  + +++     + +  K +  E E H K L    
Sbjct: 1775 DELKRYEAEKKLTIGKLEKLLSEKERIIAKFEAEIADLSKSNKDLKTELEQHSKKLSNSS 1834

Query: 3487 TLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELN-ETKVNLEKSL 3663
            ++EE+ + +++E   L    D LK    E   +     IN   +   L+ E K +LE  L
Sbjct: 1835 SIEEKNQELKSELKTLKKDSDALKADLEEVRGS-----INKHEEARRLSMEGKHSLESEL 1889

Query: 3664 QQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVED-AKKFKNEIESLKSEL 3840
            +Q  ++                     L+ SN    E +K+ E+  K+ K E E LKSEL
Sbjct: 1890 EQAYKR---------------------LQSSNTLIEEKQKEFEEKEKRMKKESEQLKSEL 1928

Query: 3841 QSVK--AYENSTVNSKIIKDLKESFKREKDELI 3933
              ++  A E    N K   +  E    E D+L+
Sbjct: 1929 DKLRLEASEPKKENGKETNNTNEG-SSEIDDLM 1960

 Score =  110 bits (276), Expect = 2e-23
 Identities = 206/989 (20%), Positives = 392/989 (39%), Gaps = 145/989 (14%)
 Frame = +1

Query: 1903 ELENKIKTLQKSQLTSKMEVEK--HALNFDEMKDN---------NNLLKEYVDKLENKIK 2049
            EL+  IK L+    TS +++EK  H+LN +  K N         ++   E + K+  + K
Sbjct: 700  ELKEGIKKLESDSNTSLLDLEKKLHSLNEEHEKLNKEHEVLQKDHSEASEQLSKIRQECK 759

Query: 2050 TLEQDL-----------AENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNL 2196
             L   L           +EN   +K L T    N    +  ++   E K+  +  + +  
Sbjct: 760  ELRDTLQAVTNERDNLSSENTKKQKALETANQTNTSSGE--KVKTLENKLKGVTADKNKA 817

Query: 2197 KSKNKNLEDKILTMTLSKNLLDNKV--LQLETSLSERELPKNTQI------KNEEKEPAK 2352
            +     +  +++++T SK  L++K+  LQ +T     E  K  ++      K ++   A 
Sbjct: 818  EEGINKMTRELMSLTRSKGELESKIKDLQKKTDKLTNEFGKKEKVFEGILEKRDQNLEAL 877

Query: 2353 QQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLEN 2532
            Q       +++ S+N S+ + L  E+  E +++F++    + ++ E L   +ES+ +L+N
Sbjct: 878  QVNIKKAEERIASLN-SEKNALIKES-GEWKSKFQSHDNLISKMTEKLKSFSESYKELQN 935

Query: 2533 KYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQM 2712
            +   +   L +A+   ++  T L+ + + L+    +L                  E L  
Sbjct: 936  ERDSLSRSLHEASSNSSNELTALKNELATLSAEKVKLNSEKQELLEQVSSLNSSYESLSK 995

Query: 2713 AENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIES---N 2883
               + +  +N   V ++ + E  +  K      K S  ++ +  N++Q+Q  + E    N
Sbjct: 996  RHQDETSDLN---VEVEKLKETVSHLKVQVDELKTSRDQITENANNLQEQCKIFEGQIEN 1052

Query: 2884 YNTEIDHANERLEEA----EVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLI-HEKK 3048
               E   A +R  E     +V     +    E  E  D K  N   +  L + L   E+K
Sbjct: 1053 QEAEKKEAEKRYMELKQNFQVSTTDLEKLAKEKQELNDAKGSNEKELNKLKKDLEGKEQK 1112

Query: 3049 MXXXXXXXXXXXXRRARYRNKNP---REKFPSFVKIDQQSXXXXXXXXVMENTTKLL--- 3210
            +                 RN N    R+   +   ++ Q          +EN    L   
Sbjct: 1113 LKSITERAQELEKTLDEQRNSNADSERKLKENIKALEHQKKEAISNSKELENELDQLKNK 1172

Query: 3211 --ALEESNAKLIKEV--------------------------------ENCTKVNETLSSQ 3288
              +L+E N K ++E+                                E+  K  E+  S+
Sbjct: 1173 HKSLDEQNTKSVEELKTRVLEVEKERDEKHNNVQKIENKLQEESKSLESLQKSQESNKSK 1232

Query: 3289 LADMQVKLEPLEQEINEL------------KLK------------VAEKEQHLNICQEEL 3396
            L  +Q KL+ L QE N+L            K+K            + E E+  N    EL
Sbjct: 1233 LKVLQDKLDSLLQEKNDLVSEKNNLKENFAKVKEDFEESQRKIHGLKESEKKKNHELHEL 1292

Query: 3397 ERWKLRSQTILQQGKIVEEEAHMKSLEK-IKTLEEQLETVRTENAQLTDRFDR------- 3552
            ++ K + +  ++Q +I + E   + ++K +K L+  ++ V  EN ++ ++ ++       
Sbjct: 1293 QK-KFKGELDVKQKQIADLERSREEVDKNLKNLQVDVKNVSEENKKVIEKLEKEKEALSL 1351

Query: 3553 ----LKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESE 3720
                L+K + E LD       +L  +  +L+     L    +++ +KN ++     +E +
Sbjct: 1352 ELNKLRKSSKENLDDRDKKIKDLEGKETKLSSELNQLTNKFKEDSKKNQENIQHLEEEKK 1411

Query: 3721 EIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNSK-----I 3885
             I   RAEL+K  N   +LEKK +  +  +N ++ + SEL  +   + S+ N K     +
Sbjct: 1412 IITDQRAELQK--NSKMDLEKKEKKIRDLENSVKRISSELSKL---QKSSQNDKEEVESV 1466

Query: 3886 IKDLKE---SFKREK-------DELIEQMXXXXXXXXXXXXXTIL-AQRKNNILANGQES 4032
             KDL+E   +F++E+       D + +Q              T L  QRKN  L + + +
Sbjct: 1467 KKDLQEKVQAFEKERKLLNEGSDAVTKQYSERITVLEDKVHQTELEVQRKNKELESAKSA 1526

Query: 4033 ANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKL 4212
            A+                     EA   L+ ++    EEK+  V   +  + EQE   K 
Sbjct: 1527 AD---------------------EASGELRNQL----EEKVVEVSSLKSTIGEQEKAIKK 1561

Query: 4213 RELGL---NADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKS-----T 4368
             E  L      GN  + D   ++E  L++  + + AEI+    +  K+    K       
Sbjct: 1562 LESDLTDSRESGNKKIEDLNGELE-ALKKALSDKQAEIEANKSDLNKRAGERKELEDTIA 1620

Query: 4369 LLERK-------LSKLESQTLSPTKNNDS 4434
             L++K       L +LE+ T S  KN ++
Sbjct: 1621 TLQKKVENSSKALQQLENSTDSSKKNQEN 1649

 Score = 89.7 bits (221), Expect = 5e-17
 Identities = 169/839 (20%), Positives = 323/839 (38%), Gaps = 103/839 (12%)
 Frame = +1

Query: 2230 LTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTY------TFERKK--- 2382
            +T TL K+   +++ Q +   +    PK   +  E  E    Q Y      TF  +    
Sbjct: 610  ITKTLGKDNYSSRISQFKRDSTFSGAPKEISLTPEFDETGLPQVYFSPYFVTFFNENYYR 669

Query: 2383 -----LESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKV 2547
                 L S  +   + + YE  EELQ Q   L+  +K+++ D      S L LE K    
Sbjct: 670  IKTALLHSCEEEPYTKISYETFEELQGQCHELKEGIKKLESD---SNTSLLDLEKKL--- 723

Query: 2548 KNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENEN 2727
             + L +   KL   +  L++ +S  +  +S+++                 + L  +EN  
Sbjct: 724  -HSLNEEHEKLNKEHEVLQKDHSEASEQLSKIRQECKELRDTLQAVTNERDNLS-SENTK 781

Query: 2728 SEKINNAIVLLQTMVEENTTFKDAFKHFKNSL-------SRLRQAINSIQQQSLVIESNY 2886
             +K       L+T  + NT+  +  K  +N L       ++  + IN + ++ L+  +  
Sbjct: 782  KQK------ALETANQTNTSSGEKVKTLENKLKGVTADKNKAEEGINKMTRE-LMSLTRS 834

Query: 2887 NTEIDHANERLEEAEVKMASFDGKVTE----ILESYDGKI----LNTAAIGHLVRSLIHE 3042
              E++   + L++   K+ +  GK  +    ILE  D  +    +N       + SL  E
Sbjct: 835  KGELESKIKDLQKKTDKLTNEFGKKEKVFEGILEKRDQNLEALQVNIKKAEERIASLNSE 894

Query: 3043 KKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVK---------------IDQQSXXXXXX 3177
            K              +          EK  SF +               + + S      
Sbjct: 895  KNALIKESGEWKSKFQSHDNLISKMTEKLKSFSESYKELQNERDSLSRSLHEASSNSSNE 954

Query: 3178 XXVMENTTKLLALEE-----SNAKLIKEVENCTKVNETLS----SQLADMQVKLEPLEQE 3330
               ++N    L+ E+        +L+++V +     E+LS     + +D+ V++E L++ 
Sbjct: 955  LTALKNELATLSAEKVKLNSEKQELLEQVSSLNSSYESLSKRHQDETSDLNVEVEKLKET 1014

Query: 3331 INELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEK--------IK 3486
            ++ LK++V E +   +   E      L+ Q  + +G+I  +EA  K  EK         +
Sbjct: 1015 VSHLKVQVDELKTSRDQITENAN--NLQEQCKIFEGQIENQEAEKKEAEKRYMELKQNFQ 1072

Query: 3487 TLEEQLETVRTENAQLTD-------RFDRLKKQ---AHEKLDAAKTMQINLTTQINELNE 3636
                 LE +  E  +L D         ++LKK      +KL +       L   ++E   
Sbjct: 1073 VSTTDLEKLAKEKQELNDAKGSNEKELNKLKKDLEGKEQKLKSITERAQELEKTLDEQRN 1132

Query: 3637 TKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELE----KKVEDAK- 3801
            +  + E+ L++ I+        A   S+E   L  EL++  N    L+    K VE+ K 
Sbjct: 1133 SNADSERKLKENIKALEHQKKEAISNSKE---LENELDQLKNKHKSLDEQNTKSVEELKT 1189

Query: 3802 -----------------KFKNEIESLKSELQSV-KAYENSTVNSKIIKDLKESFKREKDE 3927
                             K +N+++     L+S+ K+ E++    K+++D  +S  +EK++
Sbjct: 1190 RVLEVEKERDEKHNNVQKIENKLQEESKSLESLQKSQESNKSKLKVLQDKLDSLLQEKND 1249

Query: 3928 LIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEA 4107
            L+ +                 +QRK + L   ++  N                     E 
Sbjct: 1250 LVSEKNNLKENFAKVKEDFEESQRKIHGLKESEKKKN--------------------HEL 1289

Query: 4108 EENLKK-RMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKEL 4284
             E  KK +  L  ++K  A +E+ R+ +++  +       L  D   V  + +  IEK  
Sbjct: 1290 HELQKKFKGELDVKQKQIADLERSREEVDKNLK------NLQVDVKNVSEENKKVIEKLE 1343

Query: 4285 REK--FNLELAEIKKKAFEEGKQQSMM------KSTLLERKLSKLESQTLSPTKNNDSN 4437
            +EK   +LEL +++K + E    +         K T L  +L++L ++    +K N  N
Sbjct: 1344 KEKEALSLELNKLRKSSKENLDDRDKKIKDLEGKETKLSSELNQLTNKFKEDSKKNQEN 1402

 Score = 33.5 bits (75), Expect = 6.6
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 1/89 (1%)
 Frame = +1

Query: 277  LVAREKLVSEKQKEFDSND-ALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLE 453
            L +   L+ EKQKEF+  +  +  E   +K +L+ ++ + +  +    K  N   +   E
Sbjct: 1896 LQSSNTLIEEKQKEFEEKEKRMKKESEQLKSELDKLRLEASEPKKENGKETNNTNEGSSE 1955

Query: 454  LQDSLTENSALKEQIGVFEGKLDSMTQEL 540
            + D +   S L E+   +  KL  +  EL
Sbjct: 1956 IDDLMLLVSDLDEKNAKYRAKLKELGVEL 1984

>NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_4.238
            YDL058W
          Length = 1914

 Score =  137 bits (345), Expect = 2e-31
 Identities = 280/1374 (20%), Positives = 546/1374 (39%), Gaps = 41/1374 (2%)
 Frame = +1

Query: 319  FDSNDALNSEITLIKYDLEAMQRD-HTTLEARERKTENV---LEQSKLELQDSLTENSAL 486
            F++ + +  +   +K +++ +Q    +++++ + K + +    E++   L+     NS L
Sbjct: 711  FETFEEIQLKCNDLKNEIQELQTSSRSSIDSLQLKLDTITKEFEETSGNLKTYELNNSNL 770

Query: 487  KEQIGVFEGKLDSMTQELWLANTENKKL-----QTGMKLLRENNLYLEIKCKETDKNKKL 651
            + ++   E +L+   + L   N E ++L     +   KL ++N    ++  K     ++L
Sbjct: 771  QAKLSQLESELNEAKETLKKVNDECRELNKLKNENLQKLEKDNKKIQDLDTKLHKVQQEL 830

Query: 652  YSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSK 831
              S+E   +  D +  +S +++ L  E   L+    SL  D++ K        +N +  K
Sbjct: 831  KISSEAKKKAHDDINKMSRDLIGLSREKQELEGKCGSLERDMKIK-------SNNFDQEK 883

Query: 832  QEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKE 1011
             +      L Q++ E                 SK +ET  KK    L +LK  + + EKE
Sbjct: 884  NK------LNQKIQE----------------KSKEIETLNKK----LEELKNNITSLEKE 917

Query: 1012 CNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQ 1191
             +     +  +         SKF +   L+  L  +L          +    SF +  ++
Sbjct: 918  KDGTALALQHWK--------SKFESHDALVPKLTEKL----------KSLATSFKLLEKE 959

Query: 1192 KLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQ 1371
            KL + + F +  S    +      ++ +  KERD+   E   L    S  ++ +D+L  +
Sbjct: 960  KLALENDFTKYRSEHSHQNAEFQKAIGDITKERDLLRSEKETLVANFSQLKELSDKLKTE 1019

Query: 1372 RSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKE 1551
             SD  H   Y  +  + +         L  K +  E  E D        ++L + +    
Sbjct: 1020 NSD--HSAAYEAVKNELEESMLHMNEQL--KELETEKAEGD--------QKLANLEEKLN 1067

Query: 1552 LQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKI 1731
            + +K +                +++QQ T       K+ E   +     +K + T E  I
Sbjct: 1068 MMKKQLE---------------DKDQQLT-------KLCEGEANN----KKQLVTAEETI 1101

Query: 1732 NIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELE 1911
            + +  +++++   +                     LE E+L  EL   K QH     E E
Sbjct: 1102 SSLKADKETFMEKLEASG-----------------LEVEKLQTELKDTKLQH----GEAE 1140

Query: 1912 NKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEK 2091
             ++  ++K      +   +   + +E      ++   +DK +   + LE+ L E E    
Sbjct: 1141 TRLTNMKKEHADKDIANNEKICSLEEDLKKQQIV---MDKEKANAEELEEKLNEKETELA 1197

Query: 2092 NLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSK-NKN-LEDKILTMTLSK--NLL 2259
            +++    N     K  EL+ + +KI  L+ E+  L  K N+N +E + L   L K  N  
Sbjct: 1198 DVLR---NKAAIEK--ELTESSEKIKTLNAELEALTEKLNQNEMEAEKLRENLLKDQNAS 1252

Query: 2260 DNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEE 2439
              ++  LE +L E    K TQ++ + K  +  ++   E  + +  + S+I  L+ E +E+
Sbjct: 1253 KEEISALENTLKELHSEKETQMEEKSKLESDIKSLETELDETKKKHASEIESLH-EQIEK 1311

Query: 2440 LQNQFRTLRRELKEVQEDLDMKTESHLK-LENKYTKVKNDLK---QATYKLASVYTTLEQ 2607
            +  + +  +  +++   +L  +TES LK L+ KYTK +  LK    A+ + A +    E 
Sbjct: 1312 INEETKDFKAIIEKAASNLK-RTESDLKVLKEKYTKNEEKLKIMEVASKEHAELKKKQES 1370

Query: 2608 KNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTT 2787
            +   L N +  L+                   L+  E E S  I  A  L     +E   
Sbjct: 1371 EYELLENRLKMLE--EDVKLKEKELSEHKKSLLEAQEQEKSSTIELA-KLKSAAADEKNK 1427

Query: 2788 FKDAFKHFKNSLSRLRQAINS----IQQQSLVIESNYNTEIDHANERLEEA----EVKMA 2943
             ++  K  K  L    QA       + + S  I   Y+ ++    ++LE      + K+ 
Sbjct: 1428 LEEEIKSCKVELKNKAQAFEKERKLLNEGSSSITKEYSEKVSELEDKLEAVNSAHQSKLE 1487

Query: 2944 SFDGKVTEI--LESYDGKILNT--AAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNK 3111
              D   T +  LE+ + + L    A+I  L  ++  +KK              + +  NK
Sbjct: 1488 ELDSLKTNMIELENKNSEQLKKEKASIVILEETISKQKKDIDNLHSEVEDSQEKCKNINK 1547

Query: 3112 NPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQL 3291
            +  +K     ++   S         ME T     +EE N     E+E  +K  E L  +L
Sbjct: 1548 DLTKKLR---EMQSASETYDSNLKRMEET-----IEEKNV----EIEKSSKSIEELEKEL 1595

Query: 3292 ADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKS 3471
               Q+KL+ L+ E  E                            ++++ K + +E     
Sbjct: 1596 GSQQLKLKDLQNENTE----------------------------VIKKNKDILDE----K 1623

Query: 3472 LEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNL 3651
            + +I  L+E+ E++  EN  L+   D+LK +  ++ +A K  +         ++E KV  
Sbjct: 1624 ISEIGNLKEKNESLSEENETLSKSADQLKSEVSKRDEALKISK-------KVIDEYKVKD 1676

Query: 3652 EK--SLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVED-AKKFKNEIE 3822
            E+   LQ ++ + N+  + +    E++ +   + E++    N  +K  ED  K+ + E+E
Sbjct: 1677 EQLSKLQSQLAQVNKEYSDSKQAMEDLQKRIGDAEENTKQFNNTKKDDEDKIKQLEKEVE 1736

Query: 3823 SLKSELQSVKAYENSTVN--------SKIIKDLKESFKREKDELIEQMXXXXXXXXXXXX 3978
             +K++L+     E+S  N         KII+D KE    EK+  + Q             
Sbjct: 1737 DMKAKLE---LSESSVANDQLKISELEKIIEDNKEILLAEKE--VNQKQEKSIQSLELEK 1791

Query: 3979 XTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPS-EEKI 4155
             T++ +++       +ESA                I K  T A+EN +++  L + +EK+
Sbjct: 1792 KTVVEEKRKLEEKLDEESAQ--------------HIKKTETFAKENEEQKDELETLKEKL 1837

Query: 4156 NAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEI 4317
              + E+      Q+F+ KL +     D   +VT+       E   K+ L+L E+
Sbjct: 1838 KTLEEQ-----NQKFKNKLEDKSELDDLMLLVTEL-----DEKNSKYRLKLEEL 1881

 Score =  111 bits (278), Expect = 1e-23
 Identities = 174/824 (21%), Positives = 346/824 (41%), Gaps = 40/824 (4%)
 Frame = +1

Query: 283  AREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQD 462
            A  +L + K++  D + A N +I  ++ DL+  Q      +A   + E  L + + EL D
Sbjct: 1139 AETRLTNMKKEHADKDIANNEKICSLEEDLKKQQIVMDKEKANAEELEEKLNEKETELAD 1198

Query: 463  SLTENSALK-------EQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIK 621
             L   +A++       E+I     +L+++T++L     E +KL+    LL++ N   E  
Sbjct: 1199 VLRNKAAIEKELTESSEKIKTLNAELEALTEKLNQNEMEAEKLREN--LLKDQNASKEEI 1256

Query: 622  CKETDKNKKLYSSAE----DASRLQDQLQIV-----------SSEILSLKSEIATLKYMN 756
                +  K+L+S  E    + S+L+  ++ +           +SEI SL  +I  +    
Sbjct: 1257 SALENTLKELHSEKETQMEEKSKLESDIKSLETELDETKKKHASEIESLHEQIEKINEET 1316

Query: 757  ESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKN 936
            +     +++    +K  + +L   K+++ K    K ++ E+   E A  KK+ E  +   
Sbjct: 1317 KDFKAIIEKAASNLKRTESDLKVLKEKYTKNEE-KLKIMEVASKEHAELKKKQE--SEYE 1373

Query: 937  LETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRR 1116
            L     K+++E V LKEK ++  K+        +K   I+  KL S   + K  +E    
Sbjct: 1374 LLENRLKMLEEDVKLKEKELSEHKKSLLEAQEQEKSSTIELAKLKSAAADEKNKLE---- 1429

Query: 1117 QLVKEKRHKDTLQRQVESFLVELEQKL------PMIDSFKERNSSLERELLRITSSLEET 1278
               + K  K  L+ + ++F  E E+KL       +   + E+ S LE +L  + S+ +  
Sbjct: 1430 --EEIKSCKVELKNKAQAF--EKERKLLNEGSSSITKEYSEKVSELEDKLEAVNSAHQSK 1485

Query: 1279 AKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLV 1458
             +E D     +  L+ K  N+EQ   E          +   ++L         E+  +  
Sbjct: 1486 LEELDSLKTNMIELENK--NSEQLKKE----------KASIVIL---------EETISKQ 1524

Query: 1459 KKIVSNENTENDTDSHKI------ISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXE 1620
            KK + N ++E +    K       ++K+L   Q+  E    N+                E
Sbjct: 1525 KKDIDNLHSEVEDSQEKCKNINKDLTKKLREMQSASETYDSNLKRME------------E 1572

Query: 1621 QEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXX 1800
              ++K + I  ++K +E       +LEK + + + K+  +  E                 
Sbjct: 1573 TIEEKNVEIEKSSKSIE-------ELEKELGSQQLKLKDLQNENTEV------------- 1612

Query: 1801 XXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKS--QLTSKMEVEKHA 1974
                       ++  E+++ E+ ++K+++  + EE E    TL KS  QL S++     A
Sbjct: 1613 ------IKKNKDILDEKIS-EIGNLKEKNESLSEENE----TLSKSADQLKSEVSKRDEA 1661

Query: 1975 LNFDE-MKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNL---ITGGVNNLEQSKIIE 2142
            L   + + D   +  E + KL++++  + ++ ++++   ++L   I     N +Q    +
Sbjct: 1662 LKISKKVIDEYKVKDEQLSKLQSQLAQVNKEYSDSKQAMEDLQKRIGDAEENTKQFNNTK 1721

Query: 2143 LSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQ 2322
                E KI  L+KE+ ++K+K          + LS++ + N   QL+ S  E+ +  N +
Sbjct: 1722 KD-DEDKIKQLEKEVEDMKAK----------LELSESSVAND--QLKISELEKIIEDNKE 1768

Query: 2323 IKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDM 2502
            I   EKE  ++Q  + +  +LE                      +T+  E ++++E LD 
Sbjct: 1769 ILLAEKEVNQKQEKSIQSLELEK---------------------KTVVEEKRKLEEKLDE 1807

Query: 2503 KTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSV 2634
            ++  H+K    + K   + K     L     TLE++N    N +
Sbjct: 1808 ESAQHIKKTETFAKENEEQKDELETLKEKLKTLEEQNQKFKNKL 1851

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 128/620 (20%), Positives = 247/620 (39%), Gaps = 43/620 (6%)
 Frame = +1

Query: 2719 NENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEI 2898
            N+N  +I NA   L    ++    K +F+ F+    +     N IQ+    ++++  + I
Sbjct: 687  NDNFHRIINA---LNHSPDDEPVAKLSFETFEEIQLKCNDLKNEIQE----LQTSSRSSI 739

Query: 2899 DHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXX 3078
            D    +L+    +     G     L++Y+    N  A    + S ++E K          
Sbjct: 740  DSLQLKLDTITKEFEETSGN----LKTYELNNSNLQAKLSQLESELNEAKETLKKVNDEC 795

Query: 3079 XXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENC 3258
                + +  N    EK    ++              + +  K  A ++ N K+ +++   
Sbjct: 796  RELNKLKNENLQKLEKDNKKIQDLDTKLHKVQQELKISSEAKKKAHDDIN-KMSRDLIGL 854

Query: 3259 TKVNETLSSQLA----DMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTI 3426
            ++  + L  +      DM++K    +QE N+L  K+ EK + +    ++LE  K    ++
Sbjct: 855  SREKQELEGKCGSLERDMKIKSNNFDQEKNKLNQKIQEKSKEIETLNKKLEELKNNITSL 914

Query: 3427 LQQ------------GKIVEEEAHMKSL-EKIKTLEEQLETVRTENAQLTDRFDRLKKQ- 3564
             ++             K    +A +  L EK+K+L    + +  E   L + F + + + 
Sbjct: 915  EKEKDGTALALQHWKSKFESHDALVPKLTEKLKSLATSFKLLEKEKLALENDFTKYRSEH 974

Query: 3565 AHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAE 3744
            +H+  +  K +  ++T + + L   K  L  +  Q  E +++     +D S     ++ E
Sbjct: 975  SHQNAEFQKAIG-DITKERDLLRSEKETLVANFSQLKELSDKLKTENSDHSAAYEAVKNE 1033

Query: 3745 LEKSNNFSNELEKKVEDAK--------KFKNEIESLKSEL-----QSVKAYENSTVNSKI 3885
            LE+S    NE  K++E  K          + ++  +K +L     Q  K  E    N K 
Sbjct: 1034 LEESMLHMNEQLKELETEKAEGDQKLANLEEKLNMMKKQLEDKDQQLTKLCEGEANNKKQ 1093

Query: 3886 IKDLKE---SFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXX 4056
            +   +E   S K +K+  +E++              +  + K+  L +G+    +     
Sbjct: 1094 LVTAEETISSLKADKETFMEKL-----EASGLEVEKLQTELKDTKLQHGEAETRLTNMKK 1148

Query: 4057 XXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNAD 4236
                   A   ++I   EE+LKK+  +  +EK NA      + LE++   K  EL   AD
Sbjct: 1149 EHADKDIA-NNEKICSLEEDLKKQQIVMDKEKANA------EELEEKLNEKETEL---AD 1198

Query: 4237 GNGVVTDTRAQIEKELREK------FNLELAEIKKKAFEEGKQQSMMKSTLL-ERKLSKL 4395
                V   +A IEKEL E        N EL  + +K  +   +   ++  LL ++  SK 
Sbjct: 1199 ----VLRNKAAIEKELTESSEKIKTLNAELEALTEKLNQNEMEAEKLRENLLKDQNASKE 1254

Query: 4396 ESQTLSPT--KNNDSNETQV 4449
            E   L  T  + +   ETQ+
Sbjct: 1255 EISALENTLKELHSEKETQM 1274

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 83/370 (22%), Positives = 171/370 (46%), Gaps = 30/370 (8%)
 Frame = +1

Query: 277  LVAREKLVSEKQKEFDSNDA-----------LNSEITLIKYDLEAMQRDHTTLEARERKT 423
            +V  E+ +S+++K+ D+  +           +N ++T     L  MQ    T ++  ++ 
Sbjct: 1514 IVILEETISKQKKDIDNLHSEVEDSQEKCKNINKDLTK---KLREMQSASETYDSNLKRM 1570

Query: 424  ENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENN 603
            E  +E+  +E++ S      L++++G  + KL  +  E    NTE         ++++N 
Sbjct: 1571 EETIEEKNVEIEKSSKSIEELEKELGSQQLKLKDLQNE----NTE---------VIKKNK 1617

Query: 604  LYLEIKCKET----DKNKKLYSSAEDASRLQDQLQIVSS---EILSL-KSEIATLKYMNE 759
              L+ K  E     +KN+ L    E  S+  DQL+   S   E L + K  I   K  +E
Sbjct: 1618 DILDEKISEIGNLKEKNESLSEENETLSKSADQLKSEVSKRDEALKISKKVIDEYKVKDE 1677

Query: 760  SLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHN-------EIASYKKQIE 918
             LS  LQ +L ++     +   + ++  K I   +   +  +N       +I   +K++E
Sbjct: 1678 QLSK-LQSQLAQVNKEYSDSKQAMEDLQKRIGDAEENTKQFNNTKKDDEDKIKQLEKEVE 1736

Query: 919  RLTSKNLETPEKKIIQELVDLKE--KLVNSEKECNELKSTVDKYINIDEKKLISKFGNPK 1092
             + +K LE  E  +  + + + E  K++   KE        +K +N  ++K I      K
Sbjct: 1737 DMKAK-LELSESSVANDQLKISELEKIIEDNKEI----LLAEKEVNQKQEKSIQSLELEK 1791

Query: 1093 KLIEILRRQLVKEKRHKDTLQ--RQVESFLVELEQKLPMIDSFKERNSSLERELLRITSS 1266
            K +   +R+L +EK  +++ Q  ++ E+F  E E++   +++ KE+  +LE +  +  + 
Sbjct: 1792 KTVVEEKRKL-EEKLDEESAQHIKKTETFAKENEEQKDELETLKEKLKTLEEQNQKFKNK 1850

Query: 1267 LEETAKERDI 1296
            LE+ ++  D+
Sbjct: 1851 LEDKSELDDL 1860

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1284

 Score =  136 bits (342), Expect = 3e-31
 Identities = 233/1181 (19%), Positives = 470/1181 (39%), Gaps = 78/1181 (6%)
 Frame = +1

Query: 268  SGYLVAREKLVSEKQKEFDS-NDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQS 444
            S Y +   +L+S  +   +     ++ +  ++++D E    D T L+    +  N+    
Sbjct: 12   SYYNIPTSELLSLNENILEQLKSKVDGDKIVLRHD-ENADNDSTDLQTLHEQLNNIT--- 67

Query: 445  KLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKC 624
             L+      E + L ++I   E KL+           E +K+      L   N  LE   
Sbjct: 68   -LKYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESKNRELESDL 126

Query: 625  KETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKD 804
               + N+      E     Q + Q ++ E+++LK++I  L+   + L          +K+
Sbjct: 127  SAMNDNENTLHDEE-----QYKNQCLNREVINLKNDILILETKYDKLLKGYNDTKDNLKE 181

Query: 805  LDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQE----- 969
                L +    F  E  LK  + E     IA+   +IE L ++ +      I  E     
Sbjct: 182  KISELLALDTSFKSETKLKDEIIEEKDYLIANLTNEIESLKNREINEHSSDINIEYGKNS 241

Query: 970  --LVD-------LKEKLVNSEK------ECNELKSTVDKYINIDEKKLISKFGNPKKLIE 1104
              +VD       L E L+N+EK      +   L +TV+++    + K    F +     +
Sbjct: 242  SIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEF----QSKTGINFVSTDDFCD 297

Query: 1105 --ILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEET 1278
              IL++++ K +  +D LQ ++E  + ELE   P +++  ++ + LE  L    S  + T
Sbjct: 298  FIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLL----SKEKNT 353

Query: 1279 AKERDIKDRELTNLQKKISNNEQFNDE----LLRQRSDLAHQVQYLLLCI----DNKSPF 1434
            ++      +E+ N +K I +  + +D+    L  + +DL +Q+Q++L+      D     
Sbjct: 354  SEHFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGEL 413

Query: 1435 TEKEATLVKKI--VSNENTENDT-DSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXX 1605
            TE E   +K +     E + N+  +S  IIS RL+ F++V  LQQKNM            
Sbjct: 414  TENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKK 473

Query: 1606 XXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXX 1785
                E E +      +N+ ++  AK   + +      L+ KI+ + Q+ ++ + +     
Sbjct: 474  LDNQEHELRAKWE-AENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKN 532

Query: 1786 XXXXXXXXXXXXXXXCELEKERLTNELSSMKQQ---------------HVKVLEELENKI 1920
                             L  + L N +    +Q               + K LE   +++
Sbjct: 533  GHESVLAENKLYTEGDRLILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLELTADRL 592

Query: 1921 KTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLI 2100
            K  Q   +T K +++     +D +  +N  LKE+++ +++ I+  ++ L           
Sbjct: 593  KAYQSRDITQK-KLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETL----------- 640

Query: 2101 TGGVNNLEQSKIIELSVAEQKISFLDK--EISNLKSKNKNL--EDKILTMTLSKNLLDNK 2268
               + N    K   LSV     S + K  E+  LK +   +  E K+    L   LL+ K
Sbjct: 641  NSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELKMEREQLKMELLNIK 700

Query: 2269 VLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYEN--LEEL 2442
             +Q+++ L   E   +   K  + E          R K + + D    ++  +N  L+  
Sbjct: 701  TVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQD----FISTKNRELDWY 756

Query: 2443 QNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFL 2622
            Q +F      LK V E  D   +  +K EN  +     L   + ++    T+ +++ S  
Sbjct: 757  QKKFDIFSTMLKRVAEGNDNNDDIPVKTENINSSDSFVLDNFSEQVEGDDTSSKER-SPS 815

Query: 2623 ANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAF 2802
             N++S  +                 + ++   N N++ + ++ +  +T  + N  F+  F
Sbjct: 816  CNNISVFR---------------VKDPMKPLSNNNTDNVTSSNINFKTSSDLNNDFELLF 860

Query: 2803 KHFKNSLSRLRQAINSI-------QQQSLVIESNYNTEIDHAN---------ERLEEAEV 2934
              +K     L +A N I       Q+   + E   + + +H++         E+L ++E 
Sbjct: 861  NEYKVIEKELEKAKNEIMRTSGDAQELEKLSELLLSRDQEHSSLMKSNRQLQEKLNDSEK 920

Query: 2935 KMASFDGKVTEILES---YDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYR 3105
             +   D ++ ++ +S   Y    LN  +   L+R+   E +              +   +
Sbjct: 921  HIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENKLKEASLQSDFKEKYEMK 980

Query: 3106 NKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSS 3285
            +K   E    F ++ +Q                      +NA+L    E    +NE +SS
Sbjct: 981  SKENDENIDRFNRLKKQ----------------------ANARLHSSKEEQNALNEQISS 1018

Query: 3286 ---QLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTI-LQQGKIVEE 3453
                LA++Q KLE   + + EL+ ++   E         +   K ++Q++  Q  K++ +
Sbjct: 1019 LKKDLAEVQSKLEVQSKTVQELETQIKSTEADSRSRSTSIP--KSQNQSLDKQDTKLITD 1076

Query: 3454 EAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEK 3576
            E      +  +  + +++ V+T +++++     LK  A E+
Sbjct: 1077 EDSNVIPQSTQEEDIKIKDVKTLDSEVSGSGVNLKNNAPEE 1117

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 237/1221 (19%), Positives = 489/1221 (40%), Gaps = 55/1221 (4%)
 Frame = +1

Query: 424  ENVLEQSKLELQ-------------DSLTENSALKEQIGVFEGKLDSMTQELWLANTENK 564
            EN+LEQ K ++              +  T+   L EQ+     K + +T E      +  
Sbjct: 26   ENILEQLKSKVDGDKIVLRHDENADNDSTDLQTLHEQLNNITLKYNRVTNEKTQLADKIS 85

Query: 565  KLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASR-LQDQLQIVSSEILSLKSEIAT 741
            +L+  ++  + NNL+ ++   E +K    Y+S E  +R L+  L  ++    +L  E   
Sbjct: 86   ELEVKLEQEKCNNLHTKL---ELEKMSITYNSLESKNRELESDLSAMNDNENTLHDEE-- 140

Query: 742  LKYMNESLSTD---LQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQ 912
             +Y N+ L+ +   L+  +  ++   D L     +   +  LK++++ELL  +  S+K  
Sbjct: 141  -QYKNQCLNREVINLKNDILILETKYDKLLKGYND--TKDNLKEKISELLALD-TSFKS- 195

Query: 913  IERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPK 1092
                        E K+  E+++ K+ L+ +    NE++S  ++ IN     +  ++G   
Sbjct: 196  ------------ETKLKDEIIEEKDYLIANLT--NEIESLKNREINEHSSDINIEYGKNS 241

Query: 1093 KLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLE 1272
             +I             K   QR +   L+  E+    ID +       + ++ R+T+++ 
Sbjct: 242  SIIV-----------DKQEYQRLLNEALINNEK----IDEY-------DLKVARLTATVN 279

Query: 1273 ETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEAT 1452
            E   +  I      +    I   ++   +L  QR  L  +++YL+  ++N +P    +  
Sbjct: 280  EFQSKTGINFVSTDDFCDFIILKKEIQ-KLEGQRDLLQEKLEYLIHELENHAPELNNQYD 338

Query: 1453 LVKKIVSNENTENDTDSH-KIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQ 1629
             + ++    + E +T  H K   K +       E ++KN+                  ++
Sbjct: 339  KINELELLLSKEKNTSEHFKTTIKEI-------ENEKKNIISRLKL----------SDDK 381

Query: 1630 QKTLRITDN---NKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXX 1800
             +TLR  +N   N+I     S S+  +K+ +  E++I  I   R+               
Sbjct: 382  IETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIKFIKALREK------------GT 429

Query: 1801 XXXXXXXXXXCELEKERLTN--ELSSMKQQHVKVLEELENKIKTL--QKSQLTSKMEVEK 1968
                       ++  +RL     + S++Q+++++++ L    K L  Q+ +L +K E E 
Sbjct: 430  ETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLDNQEHELRAKWEAEN 489

Query: 1969 HALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENE--LFEKNLITGGVNNLEQSKIIE 2142
              +  +E K+    +    DKL+ KI  L+Q L  N     EKN   G  + L ++K+  
Sbjct: 490  DDV-LNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKN---GHESVLAENKLY- 544

Query: 2143 LSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQ 2322
                E     LD+  +N+    K           + N++     QL TSL      KN +
Sbjct: 545  ---TEGDRLILDELKNNIPEFTKQ----------ASNIISMNFDQL-TSLYN----KNLE 586

Query: 2323 IKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDM 2502
            +  +  +  + +  T  +KKL+ + D    YL   N E+L+     ++  ++   E L+ 
Sbjct: 587  LTADRLKAYQSRDIT--QKKLDLLQDK-YDYLSISN-EKLKEHMEVIKDTIRRKDETLNS 642

Query: 2503 KTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXX 2682
               +H+  +     V ND+     K   +   L+ + S + N + +++            
Sbjct: 643  TIANHVDCKASLLSVTNDMNSLMTKYDEL-KYLKDQQSRITNEL-KMEREQLKMELLNIK 700

Query: 2683 XXXXTEKLQMAENENS--EKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQ 2856
                   L+ AE + S   KIN+  +    + ++  T +   + F ++ +R         
Sbjct: 701  TVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWY---- 756

Query: 2857 QQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKI-------------L 2997
            Q+   I S     +   N+  ++  VK  + +   + +L+++  ++              
Sbjct: 757  QKKFDIFSTMLKRVAEGNDNNDDIPVKTENINSSDSFVLDNFSEQVEGDDTSSKERSPSC 816

Query: 2998 NTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXX 3177
            N  ++  +   +                  + +   N +    F  +  I+++       
Sbjct: 817  NNISVFRVKDPMKPLSNNNTDNVTSSNINFKTSSDLNNDFELLFNEYKVIEKE--LEKAK 874

Query: 3178 XXVMENTTKLLALEESNAKLI---KEVENCTKVNETLSSQLADMQVKLEPLEQEINELKL 3348
              +M  +     LE+ +  L+   +E  +  K N  L  +L D +  +E ++ EI +L  
Sbjct: 875  NEIMRTSGDAQELEKLSELLLSRDQEHSSLMKSNRQLQEKLNDSEKHIEQMDMEIKKLND 934

Query: 3349 KVAEKEQH-LNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTEN 3525
             + E +++ LNI           S+  L + +  E E  +K        +E+ E    EN
Sbjct: 935  SILEYQKNTLNIT----------SEITLLRNRCKELENKLKEASLQSDFKEKYEMKSKEN 984

Query: 3526 AQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELN------ETKVNLEKSLQQEIEKNN 3687
             +  DRF+RLKKQA+ +L ++K  Q  L  QI+ L       ++K+ ++    QE+E   
Sbjct: 985  DENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEVQSKTVQELETQI 1044

Query: 3688 QSGNGAADESEEIIRLRAELEKSNNFSNELEKKV---EDAKKFKNEIESLKSELQSVKAY 3858
            +S      E++   R  +  +  N   ++ + K+   ED+       +    +++ VK  
Sbjct: 1045 KS-----TEADSRSRSTSIPKSQNQSLDKQDTKLITDEDSNVIPQSTQEEDIKIKDVKTL 1099

Query: 3859 ENSTVNSKIIKDLKESFKREK 3921
            ++    S +  +LK +   EK
Sbjct: 1100 DSEVSGSGV--NLKNNAPEEK 1118

>KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {ON}
            Anc_4.238 YDL058W
          Length = 2220

 Score =  136 bits (342), Expect = 4e-31
 Identities = 261/1345 (19%), Positives = 535/1345 (39%), Gaps = 162/1345 (12%)
 Frame = +1

Query: 874  ELLHNEIASYKKQIERLTSKNLETPE------KKIIQELVDLKEKLVNSEKECNELKSTV 1035
            E L  + +  +K IE L S+++ + E       K+ +E  ++ E+     +E + L   +
Sbjct: 707  EQLQEKCSVLEKNIEALQSESVSSTEVLTSKLNKLSKEHTEVVEEYGKLTEEHSVL---L 763

Query: 1036 DKYINIDEK-----KLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLP 1200
            DKY +IDE+     + + +    K+ +++L++++V     KD+   +++     L  KL 
Sbjct: 764  DKYNDIDEQLEDITEKLEQMTKEKERLDLLQKEMVVNLETKDSHLEELDESTKALNDKLK 823

Query: 1201 MIDSFKERN----SSLERELL-----------RITSSLEETAKERDIKDRELTNLQKKIS 1335
             +   KE+     + + REL            +I    ++ AKE + + +E+  L   IS
Sbjct: 824  QMTVMKEKAEEGINKMSRELFALNRNNQTLDEKIKQQAKDQAKENEKRLKEIKTLNDTIS 883

Query: 1336 NNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDS--HK 1509
            +    N +L  +  +L  Q ++L           ++  T++K++   ++     DS   K
Sbjct: 884  SKNSENSKLNNKIKELETQKKFL----------EDERTTILKELAEWKSKFQSHDSLVPK 933

Query: 1510 IISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTL-RITDNNKIVESAKST 1686
            +  K      N K+L+ +N                  +EQ K L  ++D N+ +ES + T
Sbjct: 934  LTEKLKSLANNYKDLEIENTNIKTRL----------NEEQSKHLSEVSDLNEKIESLERT 983

Query: 1687 SVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNEL 1866
             + L +  K LE+K++ +  E +S+K                      C  EK+ L  ++
Sbjct: 984  EISLTEEKKDLETKLSSLEHEINSFK------------GDHDTKIEQLC-TEKDGLEQQI 1030

Query: 1867 SSMKQQHVKVLEELENKIKTLQKSQLTS-----KMEVEKHALNFDEMKDNNNL----LKE 2019
              +     K  EE EN    L  + LT+     K E E+  + F+E++ N       + E
Sbjct: 1031 EQLTNSLKKSDEEKEN--ARLAVTDLTTRLDGMKKEYEEREVTFEELEKNAQTEAAQISE 1088

Query: 2020 YVDKLENKIKTLEQ---------DLAENELFE-KNLITGGVNNLEQ--SKIIELSVAEQK 2163
             + K E  +  LE           L EN + + K  ITG    +EQ   +I +     ++
Sbjct: 1089 KLKKAEEDVAALENTKAKLFSEIKLQENAIEKSKETITGHEGTIEQLNGRIADYEGTIEE 1148

Query: 2164 ISFL----DKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERE-----LPKN 2316
            ++ +    ++ I  L S   + E  I  +  S N L++++++L+ +  E E       K 
Sbjct: 1149 LNGIIKSHEETIQELSSSIDDREKNIQKLNTSINELNSEIVELKETNQELEECVSRHEKT 1208

Query: 2317 TQIKNEEKEPAKQQTYTFE------RKKLESVNDSDISY-LYYENLEE----LQNQFRTL 2463
                NE+ E +     ++E      ++K+ S  D   S  L Y+ L+E    L+ +  T 
Sbjct: 1209 VTELNEKIEKSDPIISSYEAEIKDLKQKISSSEDKITSQELKYKELQEKVTLLEKEIETF 1268

Query: 2464 RRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQL 2643
            + + ++ ++ +    E  + L  K        K  + +L SV+   E+  + L+   S++
Sbjct: 1269 KTKREDFEKTILQSKELGVSLNEKN-------KSLSEELVSVHKLQEKCQAELSKKKSKV 1321

Query: 2644 QGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAI-------VLLQTMVEENTTFKDAF 2802
            +G                +K++    +  EK +N I        L + ++  N   +   
Sbjct: 1322 EGLRGSIEKLSTEKESSEKKVEQLLKQIEEKDSNIISLTDEKQALNKNLLISNQKIQKLN 1381

Query: 2803 KHFKNSLS---RLRQAINSIQQQSLVIESNY-------NTEIDHANERLEEAEVKMASFD 2952
            K+  +S S   RL++ ++ +++   V E  Y        TEI+   +   E +V +    
Sbjct: 1382 KNVADSTSEQVRLQEELSQLKETINVNEKTYEQNTALLKTEIEKFQKERTEKDVLVTELR 1441

Query: 2953 GKVT----EILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPR 3120
             K +    ++ E+    +     +   ++SL  EK               +A     N +
Sbjct: 1442 AKASKLEKQVSETEQENVQKVQTLNEQIKSLKEEK--------------NKACSEAGNLQ 1487

Query: 3121 EKFPS----FVKIDQQSXXXXXXXXVMENTTKLLA--LEESNAKLIKEVENCTKVNETLS 3282
             KF +    F  + ++          + N  K+ +   + SN + +   +    +   L 
Sbjct: 1488 SKFETNNVEFESLRKEHDLACERLESIANDLKIASAKADASNTENVAAQQRIDILKADLG 1547

Query: 3283 SQ-------LADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELER----WKLRSQTIL 3429
             Q        A+++  +   E+ + ELK   A  E+     +EE+++     K+++Q   
Sbjct: 1548 EQDKKIRENEANIETLINEKEKLLLELKRVKANMEKSGKEHKEEMQKLKTDLKVKTQEFE 1607

Query: 3430 QQGKIVEEEAH---MKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQ 3600
            ++ K++ E +     K  +K+  LEE+LE    +     +  + +K    ++L+A + + 
Sbjct: 1608 KERKMLNEGSSSITQKYSDKVTELEEKLEKSDNDIKSKLEIIEEMKTDFDKRLEAQQKLA 1667

Query: 3601 INLTTQIN------------------ELNETKVNLEKSLQQ-EIEKNNQSGNGAADESEE 3723
             +   ++                   EL  TK   EK L + +++ +      +A E   
Sbjct: 1668 DDQVKEVEELKLIISSKSSKLDAKEAELKNTKDTNEKLLSELKLQISTLENKISAKEKAL 1727

Query: 3724 IIRLRAELEKSNNFSNELEKKVED----AKKFKNEIESLKSELQSVK--AYENSTVNSKI 3885
                    EK    +++LE   E+     KK K+ +  L+++L  VK      +  NSK+
Sbjct: 1728 AETESTGKEKEKQLNSQLEALQEEVKLAGKKAKDSVSGLETQLNLVKKDVESKNNENSKL 1787

Query: 3886 IKD-------------LKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQ 4026
            + D             +KE    EK+ +++ +                  ++  ++ + +
Sbjct: 1788 VADNKTLQLENSKLLAIKEKIIEEKNGIVDDLAEARTVADKLKDECAATSKELQLIKSSE 1847

Query: 4027 ESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQ---E 4197
            E                 L+L+        L+K +      + ++++E+ R  LE+   E
Sbjct: 1848 EETKTEISAMEKSKNQLELLLESFKAKVSGLEKDL-----SQKDSILEETRLALEKYTSE 1902

Query: 4198 FETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMK----- 4362
             E+K ++L  +      +   + ++  E+ E+  L   +  +K  E   Q S +K     
Sbjct: 1903 NESKQKDLEAHVK---QLESEKDRLASEIEEERKLATEKSNQKIIELESQLSTLKLQYEK 1959

Query: 4363 -----STLLERKLSKLESQTLSPTK 4422
                  T LE K+S+L  +  S TK
Sbjct: 1960 DVNEVQTKLETKISQLSDELDSITK 1984

 Score =  135 bits (339), Expect = 8e-31
 Identities = 313/1452 (21%), Positives = 569/1452 (39%), Gaps = 93/1452 (6%)
 Frame = +1

Query: 328  NDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVF 507
            ND L     + +   E + +    L A  R  + + E+ K + +D   EN    ++I   
Sbjct: 819  NDKLKQMTVMKEKAEEGINKMSRELFALNRNNQTLDEKIKQQAKDQAKENEKRLKEIKTL 878

Query: 508  EGKLDSMTQELWLANTENKKLQTGMKLLRENNLYL---------------EIKCKETDKN 642
               + S   E    N + K+L+T  K L +    +                +  K T+K 
Sbjct: 879  NDTISSKNSENSKLNNKIKELETQKKFLEDERTTILKELAEWKSKFQSHDSLVPKLTEKL 938

Query: 643  KKLYSSAEDA--------SRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRI 798
            K L ++ +D         +RL ++     SE+  L  +I +L+    SL+ + +    ++
Sbjct: 939  KSLANNYKDLEIENTNIKTRLNEEQSKHLSEVSDLNEKIESLERTEISLTEEKKDLETKL 998

Query: 799  KDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQEL-- 972
              L+  +NS K +   +I       E L  E    ++QIE+LT+   ++ E+K    L  
Sbjct: 999  SSLEHEINSFKGDHDTKI-------EQLCTEKDGLEQQIEQLTNSLKKSDEEKENARLAV 1051

Query: 973  VDLKEKLVNSEKECNELKST---VDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHK 1143
             DL  +L   +KE  E + T   ++K    +  ++  K    ++ +  L     K     
Sbjct: 1052 TDLTTRLDGMKKEYEEREVTFEELEKNAQTEAAQISEKLKKAEEDVAALENTKAKLFSEI 1111

Query: 1144 DTLQRQVESFLVELEQKLPMIDSFKERNSSLE---RELLRITSSLEETAKE--RDIKDRE 1308
               +  +E     +      I+    R +  E    EL  I  S EET +E    I DRE
Sbjct: 1112 KLQENAIEKSKETITGHEGTIEQLNGRIADYEGTIEELNGIIKSHEETIQELSSSIDDRE 1171

Query: 1309 LTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCID-NKSPFTEKEATLVKK--IVSNE 1479
              N+QK  ++  + N E++    +L    Q L  C+  ++   TE    + K   I+S+ 
Sbjct: 1172 -KNIQKLNTSINELNSEIV----ELKETNQELEECVSRHEKTVTELNEKIEKSDPIISSY 1226

Query: 1480 NTENDTDSHKIIS---KRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRIT 1650
              E      KI S   K        KELQ+K                  E E  KT R  
Sbjct: 1227 EAEIKDLKQKISSSEDKITSQELKYKELQEK------------VTLLEKEIETFKTKR-E 1273

Query: 1651 DNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXX 1830
            D  K +  +K   V L +  K+L  ++  + + ++  +  +                   
Sbjct: 1274 DFEKTILQSKELGVSLNEKNKSLSEELVSVHKLQEKCQAELSKKKSKVEGLRG------- 1326

Query: 1831 CELEKERLTNELSSMK-QQHVKVLEELENKI-------KTLQKSQLTSKMEVEKHALNFD 1986
              +EK     E S  K +Q +K +EE ++ I       + L K+ L S  +++K   N  
Sbjct: 1327 -SIEKLSTEKESSEKKVEQLLKQIEEKDSNIISLTDEKQALNKNLLISNQKIQKLNKNVA 1385

Query: 1987 EMKDNNNLLKEYVDKLENKI----KTLEQDLA----ENELFEKNLITGGVNNLE---QSK 2133
            +       L+E + +L+  I    KT EQ+ A    E E F+K      V   E   ++ 
Sbjct: 1386 DSTSEQVRLQEELSQLKETINVNEKTYEQNTALLKTEIEKFQKERTEKDVLVTELRAKAS 1445

Query: 2134 IIELSVAE------QKISFLDKEISNLK-SKNK------NLEDKILTMTLSKNLL----D 2262
             +E  V+E      QK+  L+++I +LK  KNK      NL+ K  T  +    L    D
Sbjct: 1446 KLEKQVSETEQENVQKVQTLNEQIKSLKEEKNKACSEAGNLQSKFETNNVEFESLRKEHD 1505

Query: 2263 NKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYE-NLEE 2439
                +LE+  ++ ++       +  +  A QQ     +  L    + D      E N+E 
Sbjct: 1506 LACERLESIANDLKIASAKADASNTENVAAQQRIDILKADL---GEQDKKIRENEANIET 1562

Query: 2440 LQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSF 2619
            L N+   L  ELK V+ +++   + H   + +  K+K DLK  T +       L + +S 
Sbjct: 1563 LINEKEKLLLELKRVKANMEKSGKEH---KEEMQKLKTDLKVKTQEFEKERKMLNEGSSS 1619

Query: 2620 LANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDA 2799
            +    S                    EKL+ ++N+   K+         ++EE  T  D 
Sbjct: 1620 ITQKYSD-------------KVTELEEKLEKSDNDIKSKLE--------IIEEMKT--DF 1656

Query: 2800 FKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILES 2979
             K  +         +  +++  L+I S  ++++D     L+  +        ++   + +
Sbjct: 1657 DKRLEAQQKLADDQVKEVEELKLIISSK-SSKLDAKEAELKNTKDTNEKLLSELKLQIST 1715

Query: 2980 YDGKI-LNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNP---REKFPSFVKI 3147
             + KI     A+     +   ++K             + A  + K+     E   + VK 
Sbjct: 1716 LENKISAKEKALAETESTGKEKEKQLNSQLEALQEEVKLAGKKAKDSVSGLETQLNLVKK 1775

Query: 3148 DQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQ 3327
            D +S        V +N T    L+  N+KL+   E   +    +   LA+ +   + L+ 
Sbjct: 1776 DVESKNNENSKLVADNKT----LQLENSKLLAIKEKIIEEKNGIVDDLAEARTVADKLKD 1831

Query: 3328 EI----NELKL-KVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEK-IKT 3489
            E      EL+L K +E+E    I    +E+ K + + +L+  K     A +  LEK +  
Sbjct: 1832 ECAATSKELQLIKSSEEETKTEI--SAMEKSKNQLELLLESFK-----AKVSGLEKDLSQ 1884

Query: 3490 LEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQ 3669
             +  LE  R    + T   +  +K     +   ++ +  L ++I E  E K+  EKS Q+
Sbjct: 1885 KDSILEETRLALEKYTSENESKQKDLEAHVKQLESEKDRLASEIEE--ERKLATEKSNQK 1942

Query: 3670 EIEKNNQSGNGAADESEEIIRLRAELE-KSNNFSNELEKKVEDAKKFKNEIESLKSELQS 3846
             IE  +Q         +++  ++ +LE K +  S+EL+   ++  + +N++ SL  E +S
Sbjct: 1943 IIELESQLSTLKLQYEKDVNEVQTKLETKISQLSDELDSITKEKMEVQNKLHSLTEENES 2002

Query: 3847 VKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQ 4026
            +K   ++T N+K I+ L E  K  + +  E                 + +  + I A G+
Sbjct: 2003 IKE-ASTTANNKEIEKLHEEIKFSEKKAAESRKVLQDEYDAK-----VKKLADEIKALGK 2056

Query: 4027 ESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAV---IEKRRKVLEQE 4197
            E                    +R  E E   K +    SE+K+N+V   +  R + L+ E
Sbjct: 2057 E--------------------RREREGELTTKLK---TSEDKLNSVQDELSARIEALQAE 2093

Query: 4198 ---FETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKST 4368
                  K  +    AD     +++  + E E  +K N  L E  K   E   +Q+  +  
Sbjct: 2094 KSDLAAKQEKDSKAADDKQAASESILKEEIEKLKKENRALLEKSKLESENVAKQACAEVE 2153

Query: 4369 LLERKLSKLESQ 4404
             L++K  +L S+
Sbjct: 2154 QLKKKNEELTSK 2165

 Score =  121 bits (303), Expect = 1e-26
 Identities = 240/1285 (18%), Positives = 506/1285 (39%), Gaps = 68/1285 (5%)
 Frame = +1

Query: 289  EKLVSEKQKEFDSNDA---LNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQ 459
            EK+ S ++ E    +    L ++++ +++++ + + DH T   +    ++ LEQ   +L 
Sbjct: 975  EKIESLERTEISLTEEKKDLETKLSSLEHEINSFKGDHDTKIEQLCTEKDGLEQQIEQLT 1034

Query: 460  DSLTENSALKEQIGV----FEGKLDSMTQELWL-----------ANTENKKLQTGMKLLR 594
            +SL ++   KE   +       +LD M +E              A TE  ++   +K   
Sbjct: 1035 NSLKKSDEEKENARLAVTDLTTRLDGMKKEYEEREVTFEELEKNAQTEAAQISEKLKKAE 1094

Query: 595  EN---------NLYLEIKCKET--DKNKKLYSSAEDA-----SRLQDQLQIVSSEILSLK 726
            E+          L+ EIK +E   +K+K+  +  E        R+ D    +      +K
Sbjct: 1095 EDVAALENTKAKLFSEIKLQENAIEKSKETITGHEGTIEQLNGRIADYEGTIEELNGIIK 1154

Query: 727  SEIATLKYMNESLS-------------TDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQR 867
            S   T++ ++ S+               +L  ++  +K+ +  L        K +T    
Sbjct: 1155 SHEETIQELSSSIDDREKNIQKLNTSINELNSEIVELKETNQELEECVSRHEKTVTELNE 1214

Query: 868  VNELLHNEIASYKKQIERLTSKNLETPEKKIIQEL--VDLKEKLVNSEKECNELKSTVDK 1041
              E     I+SY+ +I+ L  K   + +K   QEL   +L+EK+   EKE    K+  + 
Sbjct: 1215 KIEKSDPIISSYEAEIKDLKQKISSSEDKITSQELKYKELQEKVTLLEKEIETFKTKRED 1274

Query: 1042 Y-------------INIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVE 1182
            +             +N   K L  +  +  KL E  + +L K+K   + L+  +E    E
Sbjct: 1275 FEKTILQSKELGVSLNEKNKSLSEELVSVHKLQEKCQAELSKKKSKVEGLRGSIEKLSTE 1334

Query: 1183 LEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDEL 1362
             E     ++   ++    +  ++ +T   +   K   I ++++  L K ++++      L
Sbjct: 1335 KESSEKKVEQLLKQIEEKDSNIISLTDEKQALNKNLLISNQKIQKLNKNVADSTSEQVRL 1394

Query: 1363 LRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKI--VSNENTENDTDSHKIISKRLLHF 1536
              + S L   +        N+  + +  A L  +I     E TE D    ++ +K     
Sbjct: 1395 QEELSQLKETINV------NEKTYEQNTALLKTEIEKFQKERTEKDVLVTELRAKASKLE 1448

Query: 1537 QNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKT 1716
            + V E +Q+N+                  EQ K+L+   N      A S + +L+   +T
Sbjct: 1449 KQVSETEQENVQKVQTL-----------NEQIKSLKEEKN-----KACSEAGNLQSKFET 1492

Query: 1717 LESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKV 1896
               +   + +E D     +                     +  ++  + L +   +  K 
Sbjct: 1493 NNVEFESLRKEHDLACERLESIANDLKIASAKADASNTENVAAQQRIDILKADLGEQDKK 1552

Query: 1897 LEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAEN 2076
            + E E  I+TL   +    +E+++   N   M+ +    KE + KL+  +K   Q+  + 
Sbjct: 1553 IRENEANIETLINEKEKLLLELKRVKAN---MEKSGKEHKEEMQKLKTDLKVKTQEFEK- 1608

Query: 2077 ELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNL 2256
               E+ ++  G +++ Q    +++  E+K   L+K  +++KSK + +E+           
Sbjct: 1609 ---ERKMLNEGSSSITQKYSDKVTELEEK---LEKSDNDIKSKLEIIEEMKTDF------ 1656

Query: 2257 LDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLE 2436
              +K L+ +  L++ ++ +      E K     ++   + K+ E  N  D +    + L 
Sbjct: 1657 --DKRLEAQQKLADDQVKE----VEELKLIISSKSSKLDAKEAELKNTKDTN---EKLLS 1707

Query: 2437 ELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNS 2616
            EL+ Q  TL  ++   ++ L  +TES  K + K    + +  Q   KLA           
Sbjct: 1708 ELKLQISTLENKISAKEKAL-AETESTGKEKEKQLNSQLEALQEEVKLA---------GK 1757

Query: 2617 FLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLL-QTMVEENTTFK 2793
               +SVS L+                  KL +A+N+  +  N+ ++ + + ++EE     
Sbjct: 1758 KAKDSVSGLETQLNLVKKDVESKNNENSKL-VADNKTLQLENSKLLAIKEKIIEEKNGIV 1816

Query: 2794 DAFKHFKNSLSRLRQAINSIQQQSLVIESN---YNTEIDHANERLEEAEVKMASFDGKVT 2964
            D     +    +L+    +  ++  +I+S+     TEI    +   + E+ + SF  KV+
Sbjct: 1817 DDLAEARTVADKLKDECAATSKELQLIKSSEEETKTEISAMEKSKNQLELLLESFKAKVS 1876

Query: 2965 EILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVK 3144
             + +    K            S++ E ++               +Y ++N  ++      
Sbjct: 1877 GLEKDLSQK-----------DSILEETRLAL------------EKYTSENESKQKDLEAH 1913

Query: 3145 IDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLE 3324
            + Q           +E   K LA E+SN K+I+           L SQL+ ++++    E
Sbjct: 1914 VKQLESEKDRLASEIEEERK-LATEKSNQKIIE-----------LESQLSTLKLQ---YE 1958

Query: 3325 QEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQL 3504
            +++NE++ K+  K   L+   + + + K+  Q  L    + EE   +K            
Sbjct: 1959 KDVNEVQTKLETKISQLSDELDSITKEKMEVQNKLH--SLTEENESIKE----------- 2005

Query: 3505 ETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKN 3684
             +    N ++    + +K    +  ++ K +Q     ++ +L +    L K  ++     
Sbjct: 2006 ASTTANNKEIEKLHEEIKFSEKKAAESRKVLQDEYDAKVKKLADEIKALGKERRER---- 2061

Query: 3685 NQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYEN 3864
                     E E   +L+   +K N+  +EL  ++E  +  K+++ + K E  S  A + 
Sbjct: 2062 ---------EGELTTKLKTSEDKLNSVQDELSARIEALQAEKSDL-AAKQEKDSKAADDK 2111

Query: 3865 STVNSKIIKDLKESFKREKDELIEQ 3939
               +  I+K+  E  K+E   L+E+
Sbjct: 2112 QAASESILKEEIEKLKKENRALLEK 2136

 Score =  100 bits (250), Expect = 2e-20
 Identities = 192/878 (21%), Positives = 363/878 (41%), Gaps = 116/878 (13%)
 Frame = +1

Query: 286  REKLVSEKQKEFDSNDALNSEITLIK---YDLEAMQRDH----TTLEARERKTENVLEQS 444
            REK +   QK   S + LNSEI  +K    +LE     H    T L  +  K++ ++   
Sbjct: 1170 REKNI---QKLNTSINELNSEIVELKETNQELEECVSRHEKTVTELNEKIEKSDPIISSY 1226

Query: 445  KLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYL-EIK 621
            + E++D   + S+ +++I   E K   + +++ L   E +  +T  +   +  L   E+ 
Sbjct: 1227 EAEIKDLKQKISSSEDKITSQELKYKELQEKVTLLEKEIETFKTKREDFEKTILQSKELG 1286

Query: 622  CKETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTD-------LQ 780
                +KNK L        +LQ++ Q   +E+   KS++  L+   E LST+       ++
Sbjct: 1287 VSLNEKNKSLSEELVSVHKLQEKCQ---AELSKKKSKVEGLRGSIEKLSTEKESSEKKVE 1343

Query: 781  RKLFRIKDLDDN---LNSSKQEFAKEITLK-QRVNELLHNEIASYKKQI---ERLTS--K 933
            + L +I++ D N   L   KQ   K + +  Q++ +L  N   S  +Q+   E L+   +
Sbjct: 1344 QLLKQIEEKDSNIISLTDEKQALNKNLLISNQKIQKLNKNVADSTSEQVRLQEELSQLKE 1403

Query: 934  NLETPEKKIIQELVDLKEKLVNSEKECNELK----------STVDKYINIDEKKLISKFG 1083
             +   EK   Q    LK ++   +KE  E            S ++K ++  E++ + K  
Sbjct: 1404 TINVNEKTYEQNTALLKTEIEKFQKERTEKDVLVTELRAKASKLEKQVSETEQENVQKVQ 1463

Query: 1084 NPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITS 1263
               + I+ L+ +  K       LQ + E+  VE E      D   ER  S+  +L   ++
Sbjct: 1464 TLNEQIKSLKEEKNKACSEAGNLQSKFETNNVEFESLRKEHDLACERLESIANDLKIASA 1523

Query: 1264 SLEETAKER-------DIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDN 1422
              + +  E        DI   +L    KKI  NE   + L+ ++       + LLL +  
Sbjct: 1524 KADASNTENVAAQQRIDILKADLGEQDKKIRENEANIETLINEK-------EKLLLELKR 1576

Query: 1423 KSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXX 1602
                 EK     K+ +    T+    + +   +R +  +    + QK             
Sbjct: 1577 VKANMEKSGKEHKEEMQKLKTDLKVKTQEFEKERKMLNEGSSSITQKYSDKVT------- 1629

Query: 1603 XXXXXEQEQQKTLRITDNN-----KIVESAKSTSVDLEKHIKTLESKINIISQERDSYKL 1767
                   E ++ L  +DN+     +I+E  K+   D +K ++  +   +   +E +  KL
Sbjct: 1630 -------ELEEKLEKSDNDIKSKLEIIEEMKT---DFDKRLEAQQKLADDQVKEVEELKL 1679

Query: 1768 LVXXXXXXXXXXXXXXXXXXXCELEKERLTNE--LSSMKQQHVKVLEELENKIKTLQKSQ 1941
            ++                    EL+  + TNE  LS +K Q   +  ++  K K L +++
Sbjct: 1680 IISSKSSKLDAKE--------AELKNTKDTNEKLLSELKLQISTLENKISAKEKALAETE 1731

Query: 1942 LTSKMEVEKHALNF------DEMKDNNNLLKEYVDKLENKIKTLEQDL-AENELFEKNLI 2100
             T K E EK  LN       +E+K      K+ V  LE ++  +++D+ ++N    K + 
Sbjct: 1732 STGK-EKEKQ-LNSQLEALQEEVKLAGKKAKDSVSGLETQLNLVKKDVESKNNENSKLVA 1789

Query: 2101 TGGVNNLEQSKIIELS--VAEQKISFLD--------------------KEISNLKSKNKN 2214
                  LE SK++ +   + E+K   +D                    KE+  +KS  + 
Sbjct: 1790 DNKTLQLENSKLLAIKEKIIEEKNGIVDDLAEARTVADKLKDECAATSKELQLIKSSEEE 1849

Query: 2215 LEDKILTMTLSKNLLD-------NKVLQLETSLSERE-LPKNTQIKNEE---KEPAKQQT 2361
             + +I  M  SKN L+        KV  LE  LS+++ + + T++  E+   +  +KQ+ 
Sbjct: 1850 TKTEISAMEKSKNQLELLLESFKAKVSGLEKDLSQKDSILEETRLALEKYTSENESKQKD 1909

Query: 2362 YTFERKKLESVNDSDISYLYYEN----------LEELQNQFRTLRRE------------- 2472
                 K+LES  D   S +  E           + EL++Q  TL+ +             
Sbjct: 1910 LEAHVKQLESEKDRLASEIEEERKLATEKSNQKIIELESQLSTLKLQYEKDVNEVQTKLE 1969

Query: 2473 --LKEVQEDLDMKTESHLKLENK---YTKVKNDLKQAT 2571
              + ++ ++LD  T+  ++++NK    T+    +K+A+
Sbjct: 1970 TKISQLSDELDSITKEKMEVQNKLHSLTEENESIKEAS 2007

 Score = 99.0 bits (245), Expect = 9e-20
 Identities = 163/789 (20%), Positives = 332/789 (42%), Gaps = 83/789 (10%)
 Frame = +1

Query: 289  EKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSL 468
            + L  EK K       L S+      + E+++++H     R     N L+ +  +   S 
Sbjct: 1470 KSLKEEKNKACSEAGNLQSKFETNNVEFESLRKEHDLACERLESIANDLKIASAKADASN 1529

Query: 469  TENSALKEQIGVFEGKLDSMTQEL--------WLANTENKKLQTGMKLLREN-------- 600
            TEN A +++I + +  L    +++         L N E +KL   +K ++ N        
Sbjct: 1530 TENVAAQQRIDILKADLGEQDKKIRENEANIETLIN-EKEKLLLELKRVKANMEKSGKEH 1588

Query: 601  -------NLYLEIKCKETDKNKKLYS--SAEDASRLQDQLQIVSSEILSLKSEIATLKYM 753
                      L++K +E +K +K+ +  S+    +  D++  +  ++    ++I +   +
Sbjct: 1589 KEEMQKLKTDLKVKTQEFEKERKMLNEGSSSITQKYSDKVTELEEKLEKSDNDIKSKLEI 1648

Query: 754  NESLSTDLQRKLFRIKDLDDNLNSSKQEF------------AKEITLK-------QRVNE 876
             E + TD  ++L   + L D+     +E             AKE  LK       + ++E
Sbjct: 1649 IEEMKTDFDKRLEAQQKLADDQVKEVEELKLIISSKSSKLDAKEAELKNTKDTNEKLLSE 1708

Query: 877  L------LHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVD 1038
            L      L N+I++ +K +    S   E  EK++  +L  L+E++  + K+  +  S ++
Sbjct: 1709 LKLQISTLENKISAKEKALAETESTGKE-KEKQLNSQLEALQEEVKLAGKKAKDSVSGLE 1767

Query: 1039 KYINIDEKKLISKFGNPKKLI---EILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMID 1209
              +N+ +K + SK     KL+   + L+ +  K    K+ +  +    + +L +   + D
Sbjct: 1768 TQLNLVKKDVESKNNENSKLVADNKTLQLENSKLLAIKEKIIEEKNGIVDDLAEARTVAD 1827

Query: 1210 SFKERNSSLERELLRITSSLEETAKERDIKDR--------------ELTNLQKKISNN-- 1341
              K+  ++  +EL  I SS EET  E    ++              +++ L+K +S    
Sbjct: 1828 KLKDECAATSKELQLIKSSEEETKTEISAMEKSKNQLELLLESFKAKVSGLEKDLSQKDS 1887

Query: 1342 ---------EQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTEND 1494
                     E++  E   ++ DL   V+ L    D  +   E+E  L  +  + +  E +
Sbjct: 1888 ILEETRLALEKYTSENESKQKDLEAHVKQLESEKDRLASEIEEERKLATEKSNQKIIELE 1947

Query: 1495 TDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLR-ITDNNKIVE 1671
            +   ++ + +L + ++V E+Q K                  + E Q  L  +T+ N+ ++
Sbjct: 1948 S---QLSTLKLQYEKDVNEVQTKLETKISQLSDELDSITKEKMEVQNKLHSLTEENESIK 2004

Query: 1672 SAKSTSVDLEKHIKTLESKINIISQE-RDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKE 1848
             A +T+ +  K I+ L  +I    ++  +S K+L                       E+E
Sbjct: 2005 EASTTANN--KEIEKLHEEIKFSEKKAAESRKVLQDEYDAKVKKLADEIKALGKERRERE 2062

Query: 1849 -RLTNELSSMKQQHVKVLEELENKIKTLQ--KSQLTSKMEVEKHALNFDEMKDNNNLLKE 2019
              LT +L + + +   V +EL  +I+ LQ  KS L +K E +  A + D+   + ++LKE
Sbjct: 2063 GELTTKLKTSEDKLNSVQDELSARIEALQAEKSDLAAKQEKDSKAAD-DKQAASESILKE 2121

Query: 2020 YVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLK 2199
             ++KL+ + + L                     LE+SK+   +VA+Q  +    E+  LK
Sbjct: 2122 EIEKLKKENRAL---------------------LEKSKLESENVAKQACA----EVEQLK 2156

Query: 2200 SKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERK 2379
             KN+ L  K     L+     ++++ L T L E     NT+ + + +E   + +   E +
Sbjct: 2157 KKNEELTSK-----LNDRTEIDELMLLVTDLDE----TNTKYREKLEELGVELSSAEEDE 2207

Query: 2380 KLESVNDSD 2406
              + V++ D
Sbjct: 2208 DDDEVDEDD 2216

>YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essential
            protein involved in the vesicle-mediated ER to Golgi
            transport step of secretion; binds membranes and
            functions during vesicle docking to the Golgi; required
            for assembly of the ER-to-Golgi SNARE complex
          Length = 1790

 Score =  133 bits (335), Expect = 2e-30
 Identities = 236/1132 (20%), Positives = 453/1132 (40%), Gaps = 30/1132 (2%)
 Frame = +1

Query: 1099 IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEET 1278
            +E L+RQ  K K    +LQ + ES    L +KL  + +    +  L+ +   + SS    
Sbjct: 732  VEKLQRQCTKLKGEITSLQTETESTHENLTEKLIALTN---EHKELDEKYQILNSSHSSL 788

Query: 1279 AKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLV 1458
             +   I + EL N++  +    Q  D L  +  +             N++   E ++T+ 
Sbjct: 789  KENFSILETELKNVRDSLDEMTQLRDVLETKDKE-------------NQTALLEYKSTIH 835

Query: 1459 KKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKT 1638
            K+           DS K + K L    + K+  +  +                 +E  K 
Sbjct: 836  KQ----------EDSIKTLEKGLETILSQKKKAEDGINKMGKDLFALSREMQAVEENCKN 885

Query: 1639 LRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXX 1818
            L+   +   V   K T   L++ I    ++I  I++  +  K+                 
Sbjct: 886  LQKEKDKSNVNHQKETK-SLKEDIAAKITEIKAINENLEEMKI----------------- 927

Query: 1819 XXXXCELEKERLTNELSSMK---QQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDE 1989
                   EKE ++ EL   K   Q H  ++ +L  K+K+L  +    + E E      +E
Sbjct: 928  QCNNLSKEKEHISKELVEYKSRFQSHDNLVAKLTEKLKSLANNYKDMQAENESLIKAVEE 987

Query: 1990 MKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKIS 2169
             K+ +++    +  L+NKI ++ Q   E E F+                IE    E+ I 
Sbjct: 988  SKNESSI---QLSNLQNKIDSMSQ---EKENFQ----------------IERGSIEKNIE 1025

Query: 2170 FLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPA 2349
             L K IS+L+   + +        +SK+       + + SL + +L   T   +E     
Sbjct: 1026 QLKKTISDLEQTKEEI--------ISKSDSSKDEYESQISLLKEKLETATTANDENVNKI 1077

Query: 2350 KQQTYTFERKKLESVNDSDISYLYYENLE-ELQNQFRTLRRELKEVQEDLDMKTESHLKL 2526
             + T T  R++LE+          Y+NL+ EL+ +  T  + LKEV+E+ +   E  ++L
Sbjct: 1078 SELTKT--REELEA------ELAAYKNLKNELETKLETSEKALKEVKENEEHLKEEKIQL 1129

Query: 2527 ENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKL 2706
            E + T+ K  L      L S    LE+++  LA  + + +                 E++
Sbjct: 1130 EKEATETKQQLNSLRANLES----LEKEHEDLAAQLKKYE-----------------EQI 1168

Query: 2707 QMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNY 2886
               E + +E+I+     + +  +EN + K      +  +  ++   ++ ++QS + +S  
Sbjct: 1169 ANKERQYNEEISQLNDEITSTQQENESIKKKNDELEGEVKAMK---STSEEQSNLKKS-- 1223

Query: 2887 NTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXX 3066
              EID  N +++E + K  + +  + E ++S + + +        ++ L  E        
Sbjct: 1224 --EIDALNLQIKELKKKNETNEASLLESIKSVESETVK-------IKELQDEC------- 1267

Query: 3067 XXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKE 3246
                           N +EK                   V E   KL A E+ N+K ++ 
Sbjct: 1268 ---------------NFKEK------------------EVSELEDKLKASEDKNSKYLEL 1294

Query: 3247 VENCTKVNETLSSQLADMQVKLEPL----------EQEINELKLKVAEKEQHLNICQEEL 3396
             +   K+ E L ++  +++++LE +          E E++ LK   +E+ ++    +E+L
Sbjct: 1295 QKESEKIKEELDAKTTELKIQLEKITNLSKAKEKSESELSRLKKTSSEERKN---AEEQL 1351

Query: 3397 ERWK----LRSQTILQQGKIVEEEAH---MKSLEKIKTLEEQLETVRTENAQLTDRFDRL 3555
            E+ K    +++Q   ++ K++ E +     +  EKI TLE++L  ++ EN       D  
Sbjct: 1352 EKLKNEIQIKNQAFEKERKLLNEGSSTITQEYSEKINTLEDELIRLQNENELKAKEIDNT 1411

Query: 3556 KKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRL 3735
            + +  EK+  +           +EL E K N  KSLQ EI                    
Sbjct: 1412 RSEL-EKVSLSN----------DELLEEKQNTIKSLQDEI-------------------- 1440

Query: 3736 RAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKR 3915
               L   +  +   EK +   +  K ++ESLK +L++  A E+     + +K L+E   +
Sbjct: 1441 ---LSYKDKITRNDEKLLSIERDNKRDLESLKEQLRA--AQESKAKVEEGLKKLEEESSK 1495

Query: 3916 EKDEL---------IEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXX 4068
            EK EL         +E               TI  ++ +  L   ++SA           
Sbjct: 1496 EKAELEKSKEMMKKLESTIESNETELKSSMETI--RKSDEKLEQSKKSAE---EDIKNLQ 1550

Query: 4069 XXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGV 4248
               + ++ RI E+E+++++   L S+ +I A      + ++QE      ++ +NA+ N V
Sbjct: 1551 HEKSDLISRINESEKDIEE---LKSKLRIEAKSGSELETVKQELNNAQEKIRINAEENTV 1607

Query: 4249 VTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ 4404
            +      IE+EL++K     AEIK    E+    S +K   LE++L   + +
Sbjct: 1608 LKSKLEDIERELKDK----QAEIKSNQEEKELLTSRLKE--LEQELDSTQQK 1653

 Score =  115 bits (288), Expect = 7e-25
 Identities = 220/1068 (20%), Positives = 439/1068 (41%), Gaps = 31/1068 (2%)
 Frame = +1

Query: 289  EKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSL 468
            E ++S+K+K  D  + +  ++  +  +++A++ +   L+ +E+   NV  Q         
Sbjct: 849  ETILSQKKKAEDGINKMGKDLFALSREMQAVEENCKNLQ-KEKDKSNVNHQK-------- 899

Query: 469  TENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKK 648
             E  +LKE I                      K+ T +K + EN   ++I+C    K K+
Sbjct: 900  -ETKSLKEDIAA--------------------KI-TEIKAINENLEEMKIQCNNLSKEKE 937

Query: 649  LYSS--AEDASRLQDQLQIVSSEILSLKSEIATLKYM---NESLSTDLQRKLFRIKDLDD 813
              S    E  SR Q    +V+     LKS     K M   NESL          IK +++
Sbjct: 938  HISKELVEYKSRFQSHDNLVAKLTEKLKSLANNYKDMQAENESL----------IKAVEE 987

Query: 814  NLNSSKQEFAK---EITLKQRVNELLHNEIASYKKQIERL--TSKNLETPEKKIIQELVD 978
            + N S  + +    +I    +  E    E  S +K IE+L  T  +LE  +++II +   
Sbjct: 988  SKNESSIQLSNLQNKIDSMSQEKENFQIERGSIEKNIEQLKKTISDLEQTKEEIISKSDS 1047

Query: 979  LKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQR 1158
             K++    E + + LK  ++     +++  ++K     K  E L  +L   K  K+ L+ 
Sbjct: 1048 SKDEY---ESQISLLKEKLETATTANDEN-VNKISELTKTREELEAELAAYKNLKNELET 1103

Query: 1159 QVESFLVELEQKLPMIDSFKERNSSLERE-------LLRITSSLEETAKERDIKDRELTN 1317
            ++E+    L++     +  KE    LE+E       L  + ++LE   KE +    +L  
Sbjct: 1104 KLETSEKALKEVKENEEHLKEEKIQLEKEATETKQQLNSLRANLESLEKEHEDLAAQLKK 1163

Query: 1318 LQKKISNNE-QFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTEND 1494
             +++I+N E Q+N+E+ +   ++    Q      +N+S   +K   L  ++ + ++T  +
Sbjct: 1164 YEEQIANKERQYNEEISQLNDEITSTQQ------ENES-IKKKNDELEGEVKAMKSTSEE 1216

Query: 1495 TDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVES 1674
              + K      L+ Q +KEL++KN                           T+   ++ES
Sbjct: 1217 QSNLKKSEIDALNLQ-IKELKKKNE--------------------------TNEASLLES 1249

Query: 1675 AKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERL 1854
             KS   +  K IK L+ + N   +E       V                    + E E++
Sbjct: 1250 IKSVESETVK-IKELQDECNFKEKE-------VSELEDKLKASEDKNSKYLELQKESEKI 1301

Query: 1855 TNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKL 2034
              EL + K   +K+  E   KI  L K++  S+ E+ +      E + N    +E ++KL
Sbjct: 1302 KEELDA-KTTELKIQLE---KITNLSKAKEKSESELSRLKKTSSEERKN---AEEQLEKL 1354

Query: 2035 ENKIKTLEQDLAENELFEKN--LITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKN 2208
            +N+I+       +N+ FEK   L+  G + + Q          +KI+ L+ E+  L+++N
Sbjct: 1355 KNEIQI------KNQAFEKERKLLNEGSSTITQEY-------SEKINTLEDELIRLQNEN 1401

Query: 2209 KNLEDKILTMTLSKNLLDNKVLQLE-TSLSERELPKNTQIKNEEKEPAKQQTYTFERKKL 2385
            +          L    +DN   +LE  SLS  EL     ++ ++      Q      K  
Sbjct: 1402 E----------LKAKEIDNTRSELEKVSLSNDEL-----LEEKQNTIKSLQDEILSYKDK 1446

Query: 2386 ESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQ 2565
             + ND  +  +  +N  +L++    L+ +L+  QE      E   KLE + +K K +L++
Sbjct: 1447 ITRNDEKLLSIERDNKRDLES----LKEQLRAAQESKAKVEEGLKKLEEESSKEKAELEK 1502

Query: 2566 ATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINN 2745
            +   +  + +T+E   + L +S+  ++                 + LQ  +++   +IN 
Sbjct: 1503 SKEMMKKLESTIESNETELKSSMETIRKSDEKLEQSKKSAEEDIKNLQHEKSDLISRINE 1562

Query: 2746 AIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEE 2925
            +    +  +EE  +         + L  ++Q +N+ Q++ + I +  NT +     +LE+
Sbjct: 1563 S----EKDIEELKSKLRIEAKSGSELETVKQELNNAQEK-IRINAEENTVL---KSKLED 1614

Query: 2926 AEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYR 3105
             E ++     K  EI  + + K L T+ +  L + L   ++             R+ +  
Sbjct: 1615 IERELKD---KQAEIKSNQEEKELLTSRLKELEQELDSTQQKAQKSEEERRAEVRKFQVE 1671

Query: 3106 NKNPREKF----PSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNE 3273
                 EK       +  +  +          ++ TT   +  +   KL KE++N    N 
Sbjct: 1672 KSQLDEKAMLLETKYNDLVNKEQAWKRDEDTVKKTTD--SQRQEIEKLAKELDNLKAENS 1729

Query: 3274 TLS------SQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELE 3399
             L       S++ D+ + +  L+++  + + K+ +    ++  +E+ E
Sbjct: 1730 KLKEANEDRSEIDDLMLLVTDLDEKNAKYRSKLKDLGVEISSDEEDDE 1777

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 165/857 (19%), Positives = 346/857 (40%), Gaps = 41/857 (4%)
 Frame = +1

Query: 2002 NNLLKEYVDKLENKIKTLEQDLA----ENELFEKNLITGGVNNLEQSKIIE--LSVAEQK 2163
            N +  E V+KL+ +   L+ ++     E E   +NL    +    + K ++    +    
Sbjct: 725  NKISFEEVEKLQRQCTKLKGEITSLQTETESTHENLTEKLIALTNEHKELDEKYQILNSS 784

Query: 2164 ISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKE 2343
             S L +  S L+++ KN+ D +  MT  +++L+ K  + +T+L E +   + Q  + +  
Sbjct: 785  HSSLKENFSILETELKNVRDSLDEMTQLRDVLETKDKENQTALLEYKSTIHKQEDSIKTL 844

Query: 2344 PAKQQTYTFERKKLES-VNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHL 2520
                +T   ++KK E  +N         ++L  L  + + +    K +Q++ D    +H 
Sbjct: 845  EKGLETILSQKKKAEDGINKMG------KDLFALSREMQAVEENCKNLQKEKDKSNVNHQ 898

Query: 2521 KLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTE 2700
            K E K   +K D+     ++ ++   LE+                               
Sbjct: 899  K-ETK--SLKEDIAAKITEIKAINENLEEM------------------------------ 925

Query: 2701 KLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIES 2880
            K+Q   N + EK        + + +E   +K  F+   N +++L + + S+      +++
Sbjct: 926  KIQ-CNNLSKEK--------EHISKELVEYKSRFQSHDNLVAKLTEKLKSLANNYKDMQA 976

Query: 2881 NYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXX 3060
               + I    E   E+ +++++   K+  + +  +   +   +I   +  L   KK    
Sbjct: 977  ENESLIKAVEESKNESSIQLSNLQNKIDSMSQEKENFQIERGSIEKNIEQL---KKTISD 1033

Query: 3061 XXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLI 3240
                      ++   +K+  E   S +K   ++        V + +      EE  A+L 
Sbjct: 1034 LEQTKEEIISKSD-SSKDEYESQISLLKEKLETATTANDENVNKISELTKTREELEAELA 1092

Query: 3241 --KEVENCTKVN-ETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKL 3411
              K ++N  +   ET    L +++   E L++E  +L+ +  E +Q LN  +  LE  + 
Sbjct: 1093 AYKNLKNELETKLETSEKALKEVKENEEHLKEEKIQLEKEATETKQQLNSLRANLESLEK 1152

Query: 3412 RSQTILQQGKIVEEEAHMKSL---EKIKTLEEQLETVRTENAQLTDRFDRLK------KQ 3564
              + +  Q K  EE+   K     E+I  L +++ + + EN  +  + D L+      K 
Sbjct: 1153 EHEDLAAQLKKYEEQIANKERQYNEEISQLNDEITSTQQENESIKKKNDELEGEVKAMKS 1212

Query: 3565 AHEKLDAAKTMQIN-LTTQINEL---NETK----VNLEKSLQQEIEKNNQSGNGAADESE 3720
              E+    K  +I+ L  QI EL   NET     +   KS++ E  K  +  +    + +
Sbjct: 1213 TSEEQSNLKKSEIDALNLQIKELKKKNETNEASLLESIKSVESETVKIKELQDECNFKEK 1272

Query: 3721 EIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIES----LKSELQSV----KAYENSTVN 3876
            E+  L  +L+ S + +++  +  ++++K K E+++    LK +L+ +    KA E S   
Sbjct: 1273 EVSELEDKLKASEDKNSKYLELQKESEKIKEELDAKTTELKIQLEKITNLSKAKEKSESE 1332

Query: 3877 SKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXT--ILAQRKNNILANGQESANIXXX 4050
               +K      ++  +E +E++                +L +  + I     E  N    
Sbjct: 1333 LSRLKKTSSEERKNAEEQLEKLKNEIQIKNQAFEKERKLLNEGSSTITQEYSEKINTLED 1392

Query: 4051 XXXXXXXXXALILKRITEAEENLKKRMRLPS----EEKINAVIEKRRKVLEQEFETKLRE 4218
                      L  K I      L+K + L +    EEK N +   + ++L  + +    +
Sbjct: 1393 ELIRLQNENELKAKEIDNTRSELEK-VSLSNDELLEEKQNTIKSLQDEILSYKDKITRND 1451

Query: 4219 LGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLE 4398
              L +    +  D +  +E  L+E+  L  A+  K   EEG ++   +S+  + +L K +
Sbjct: 1452 EKLLS----IERDNKRDLES-LKEQ--LRAAQESKAKVEEGLKKLEEESSKEKAELEKSK 1504

Query: 4399 SQTLSPTKNNDSNETQV 4449
                      +SNET++
Sbjct: 1505 EMMKKLESTIESNETEL 1521

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1928

 Score =  132 bits (332), Expect = 5e-30
 Identities = 237/1195 (19%), Positives = 493/1195 (41%), Gaps = 98/1195 (8%)
 Frame = +1

Query: 1144 DTLQRQVESFLVELEQKLPMIDSFKERNS-------SLERELLRITSSLEETAKERDIKD 1302
            D+LQ Q+++   E E     + S K  +S       +++ EL  +T+SL++  +ERD  D
Sbjct: 728  DSLQNQLKTISGEYEDSSTELASLKTEHSLLSDKYDTIKVELSDMTTSLKQITEERDTLD 787

Query: 1303 RELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNEN 1482
                  + KI  NE+   E   +  ++  Q+Q ++L    K    E    + +++ +   
Sbjct: 788  ALKKENENKIEKNEELLKEYKEKLQNIETQLQTIILA---KQKAEEGVNKMNRELFALSR 844

Query: 1483 TENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNK 1662
             + + + ++ I+        +K+LQ+K                  ++++Q + ++ +  K
Sbjct: 845  EKQELEGNQKIA--------LKDLQKKT-------------AVLEKEKRQLSDKLNEKEK 883

Query: 1663 IVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXC--E 1836
             +         LE  +K+LES+ N   +E + +K                         E
Sbjct: 884  DITRLNEELATLENTVKSLESEKNEKRKEVEEWKSKFQNHDNLVPKLTDKLKSLATSFKE 943

Query: 1837 LEKER--LTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKME-------VEKHALNFDE 1989
            LEKER  L  +L+ ++  ++    EL+N IK + ++ +T   E       +    L  D 
Sbjct: 944  LEKERDSLQEQLTELESANLSHETELKNNIKQMTENNVTLTTENKGLISKISNLELTIDN 1003

Query: 1990 MKDNNNL----LKEYVDKLENKIKTLEQDL----AENELFEK--NLITGGVNNLEQ---S 2130
            +K +N+       +  ++LE  I  L + L    AE E+ E+  N + G +N+++     
Sbjct: 1004 LKKSNDAKSAQFSDDKNELEESIMHLNEQLNEIEAEKEINERKVNDLEGQLNSVKSELTK 1063

Query: 2131 KIIELSVAEQKISFLDKEISNLKSK-----------NKNLEDKILTMTLSKNLLDNKVLQ 2277
             + E+++ + K+  ++++++  K K           +K LE+    M  S N L+   L+
Sbjct: 1064 NMDEITLLKTKLDTVNEDLTTSKQKLIESENEKRELSKLLENSKNAMIDSNNKLEESTLK 1123

Query: 2278 LETSLSERE-LPKNTQIKNEE-KEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQ 2451
             +T L + + L KN Q   +   +   +     + K+L+            +N++ +Q Q
Sbjct: 1124 YDTLLKKYDSLEKNGQANEKSFHDQVDELKLQLQEKELQYTTLETSIEEKEKNIQSIQTQ 1183

Query: 2452 FRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKN----SF 2619
              +L  E + +Q   +  +E  + LEN+   +   L             L +KN    S 
Sbjct: 1184 LESLAAEKERIQGIANTSSEEVVSLENRIKDLNEQLDSVRELYEKSKQELNKKNEEHQSM 1243

Query: 2620 LANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENE---NSEKINNAIVLLQTMV----EE 2778
            LA   S L                   ++++ +NE   N EK   A+ +L+  +    EE
Sbjct: 1244 LAKYESDLADSLAKADTATSTNVELESQIKVMKNELDLNKEKHTEALEILKKEIKNIEEE 1303

Query: 2779 NTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGK 2958
              + K      KN  ++ ++ +  + Q+S  I    + E+ +  + L+ +   M  ++  
Sbjct: 1304 CESTKSDTVVAKNEFAKSQKELKKL-QESFSINEKKSEELQNELQELQRSVQTMKEWEEA 1362

Query: 2959 VTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSF 3138
            + +     + KI  T      +     +KK+                 + ++  EK    
Sbjct: 1363 MVKKSTDLETKISKTE-----LELSKEKKKLQNVEESKRKVVSELESVKKESGEEKKKLV 1417

Query: 3139 VKIDQQSXXXXXXXXVMENTTKLL---------ALEESNAKLIKEVENCTKVNETLSSQL 3291
             +I Q            E   KLL            E  +KL + ++     NE+  +++
Sbjct: 1418 QEIIQIKADLKIKIHDFEKERKLLNEGSSSITQEYSEKISKLEERLDEAKFENESKGAEV 1477

Query: 3292 ADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKL----RSQTI--LQQGKIVEE 3453
              ++   +  E E  ++   + EK+  +   +E +   +     RSQTI  L   K  E 
Sbjct: 1478 EKIKKASKNSEMETQKI---IEEKDTQITTLRETITSKEKDLDERSQTIKNLISEKEQEL 1534

Query: 3454 EAHMKSLEKIKT----LEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQI 3621
             A  ++LE++K     ++E+L++ + E A    + D +    ++ L + K    +    I
Sbjct: 1535 SASNQNLEELKNQISEIKEELKSSKEEMA----KKDMMLIDLNKTLASLKGDVKDKVLAI 1590

Query: 3622 NELNETKVNLEKSLQQE---IEKNNQSGNGAADESEEIIRLRAELEK-----SNNFSNEL 3777
             +LNET  +L+ +++ +   IEK  ++ N   D+ ++  +   +L+K      + F   +
Sbjct: 1591 EKLNETLASLKGNIKDKDLAIEKLEKTLNSLKDDIKDKDQTIEDLKKKKASEESEFKITI 1650

Query: 3778 E---KKVEDAK-KFKNEIESLKSELQSVKAYENSTV--NSKIIKDLKESFKREKDELIEQ 3939
            E   K++ D K K + ++E  K  L+  K  ++  +  +SK+ ++L+      +D L EQ
Sbjct: 1651 EGKDKELTDLKNKLQTQLEKEKDSLKKQKEQDDKLIEKSSKLEEELRNKSNNYED-LKEQ 1709

Query: 3940 MXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENL 4119
            +             T + Q K +I +   +   +               L+++ E+++  
Sbjct: 1710 L--EKCQMTKLNLETEIVQLKESISSTDADMKRLSSEHDEDKEKINT--LEKVIESQKTN 1765

Query: 4120 KKRMRLPSEEKINAVIEKRRKVLEQEFETKLREL-GLNADGNGVVTDTRAQIEKELREKF 4296
             K+ +    +   A+++K  ++     +TK+ E+   + + + V+   + + EK  +E+ 
Sbjct: 1766 MKKSQSTITKFEEAILQKDEEL--AAIKTKITEIENRDKNNSNVIEQLKLETEKLKQEQT 1823

Query: 4297 N---------LELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDS 4434
            N          ++ E KKK  EE KQ+ +++   L  KL KLE +     K  D+
Sbjct: 1824 NDREDYQVKATKMEEAKKKCDEE-KQEQIIELQKLREKLEKLEHEREEHAKAADN 1877

 Score =  132 bits (332), Expect = 5e-30
 Identities = 242/1184 (20%), Positives = 488/1184 (41%), Gaps = 95/1184 (8%)
 Frame = +1

Query: 289  EKLVSEKQKEFDSNDALNSEITLI---KYDLEAMQRDHTTLEARERKTENVLEQSKLELQ 459
            + ++  KQK  +  + +N E+  +   K +LE  Q+    L+  ++KT  VLE+ K +L 
Sbjct: 819  QTIILAKQKAEEGVNKMNRELFALSREKQELEGNQK--IALKDLQKKTA-VLEKEKRQLS 875

Query: 460  DSLTEN----SALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCK 627
            D L E     + L E++   E  + S+  E    N + K+++      + ++    +  K
Sbjct: 876  DKLNEKEKDITRLNEELATLENTVKSLESE---KNEKRKEVEEWKSKFQNHD---NLVPK 929

Query: 628  ETDKNKKLYSSAEDASRLQDQLQIVSSEILS--------LKSEIATLKYMNESLSTDLQR 783
             TDK K L +S ++  + +D LQ   +E+ S        LK+ I  +   N +L+T+ + 
Sbjct: 930  LTDKLKSLATSFKELEKERDSLQEQLTELESANLSHETELKNNIKQMTENNVTLTTENKG 989

Query: 784  KLFRIKDLD---DNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEK 954
             + +I +L+   DNL  S    AK        NEL    I    +Q+  + ++  E  E+
Sbjct: 990  LISKISNLELTIDNLKKSND--AKSAQFSDDKNEL-EESIMHLNEQLNEIEAEK-EINER 1045

Query: 955  KIIQ---ELVDLKEKLVNSEKECNELKS---TVDKYINIDEKKLISKFGNPKKLIEILRR 1116
            K+     +L  +K +L  +  E   LK+   TV++ +   ++KLI      ++L ++L  
Sbjct: 1046 KVNDLEGQLNSVKSELTKNMDEITLLKTKLDTVNEDLTTSKQKLIESENEKRELSKLLEN 1105

Query: 1117 QLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDI 1296
                 K        ++E   ++ +  L   DS ++   + E+        L+   +E+++
Sbjct: 1106 S----KNAMIDSNNKLEESTLKYDTLLKKYDSLEKNGQANEKSFHDQVDELKLQLQEKEL 1161

Query: 1297 KDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSN 1476
               + T L+  I   E+    +  Q   LA + + +    +  S          +++VS 
Sbjct: 1162 ---QYTTLETSIEEKEKNIQSIQTQLESLAAEKERIQGIANTSS----------EEVVSL 1208

Query: 1477 ENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLR---- 1644
            EN   D +  ++ S R L+ ++ +EL +KN                  +E Q  L     
Sbjct: 1209 ENRIKDLNE-QLDSVRELYEKSKQELNKKN------------------EEHQSMLAKYES 1249

Query: 1645 -ITDNNKIVESAKSTSVDLEKHIKTLESKINIISQER-DSYKLLVXXXXXXXXXXXXXXX 1818
             + D+    ++A ST+V+LE  IK +++++++  ++  ++ ++L                
Sbjct: 1250 DLADSLAKADTATSTNVELESQIKVMKNELDLNKEKHTEALEILKKEIKNIEEECESTKS 1309

Query: 1819 XXXXCELEKERLTNELSSMKQQ---HVKVLEELENKIKTLQKSQLTSK------------ 1953
                 + E  +   EL  +++    + K  EEL+N+++ LQ+S  T K            
Sbjct: 1310 DTVVAKNEFAKSQKELKKLQESFSINEKKSEELQNELQELQRSVQTMKEWEEAMVKKSTD 1369

Query: 1954 --MEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENEL--------------- 2082
               ++ K  L   + K     ++E   K+ +++++++++  E +                
Sbjct: 1370 LETKISKTELELSKEKKKLQNVEESKRKVVSELESVKKESGEEKKKLVQEIIQIKADLKI 1429

Query: 2083 ----FEKN--LITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTL 2244
                FEK   L+  G +++ Q          +KIS L++ +   K +N   E K   +  
Sbjct: 1430 KIHDFEKERKLLNEGSSSITQEY-------SEKISKLEERLDEAKFEN---ESKGAEVEK 1479

Query: 2245 SKNLLDNKVLQLETSLSERELPKNT---QIKNEEKE-PAKQQTYTFERKKLESVNDSDIS 2412
             K    N  ++ +  + E++    T    I ++EK+   + QT     K L S  + ++S
Sbjct: 1480 IKKASKNSEMETQKIIEEKDTQITTLRETITSKEKDLDERSQTI----KNLISEKEQELS 1535

Query: 2413 YLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLK-------QAT 2571
                +NLEEL+NQ   ++ ELK  +E++  K    + L      +K D+K       +  
Sbjct: 1536 -ASNQNLEELKNQISEIKEELKSSKEEMAKKDMMLIDLNKTLASLKGDVKDKVLAIEKLN 1594

Query: 2572 YKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENE-------NS 2730
              LAS+   ++ K+  +      L                  +K    E+E         
Sbjct: 1595 ETLASLKGNIKDKDLAIEKLEKTLNSLKDDIKDKDQTIEDLKKKKASEESEFKITIEGKD 1654

Query: 2731 EKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHAN 2910
            +++ +    LQT +E+    KD+ K  K    +L +  + ++++     +NY    +   
Sbjct: 1655 KELTDLKNKLQTQLEKE---KDSLKKQKEQDDKLIEKSSKLEEELRNKSNNY----EDLK 1707

Query: 2911 ERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXR 3090
            E+LE+ ++   + + ++ ++ ES    I +T A                          +
Sbjct: 1708 EQLEKCQMTKLNLETEIVQLKES----ISSTDA------------------------DMK 1739

Query: 3091 RARYRNKNPREKFPSFVKI--DQQSXXXXXXXXVMENTTKLLALEESNAKL---IKEVEN 3255
            R    +   +EK  +  K+   Q++        + +    +L  +E  A +   I E+EN
Sbjct: 1740 RLSSEHDEDKEKINTLEKVIESQKTNMKKSQSTITKFEEAILQKDEELAAIKTKITEIEN 1799

Query: 3256 CTKVNETLSSQLADMQVKLEPLEQE----INELKLKVAEKEQHLNICQEELERWKLRSQT 3423
              K N  +  QL   +++ E L+QE      + ++K  + E+    C EE          
Sbjct: 1800 RDKNNSNVIEQL---KLETEKLKQEQTNDREDYQVKATKMEEAKKKCDEE---------- 1846

Query: 3424 ILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRL 3555
              +Q +I+E       L+K++   E+LE  R E+A+  D    L
Sbjct: 1847 --KQEQIIE-------LQKLREKLEKLEHEREEHAKAADNKSEL 1881

 Score =  103 bits (257), Expect = 3e-21
 Identities = 175/904 (19%), Positives = 380/904 (42%), Gaps = 51/904 (5%)
 Frame = +1

Query: 1852 LTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDK 2031
            L  EL ++   +   ++ L+N++KT+         E E  +     +K  ++LL +  D 
Sbjct: 712  LKEELETLHHDNKASIDSLQNQLKTISG-------EYEDSSTELASLKTEHSLLSDKYDT 764

Query: 2032 LENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNK 2211
            ++ ++  +   L +        IT   + L+  K       E KI   ++ +   K K +
Sbjct: 765  IKVELSDMTTSLKQ--------ITEERDTLDALK----KENENKIEKNEELLKEYKEKLQ 812

Query: 2212 NLEDKILTMTLSK-------NLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTF 2370
            N+E ++ T+ L+K       N ++ ++  L     E E  +   +K+ +K+ A  +    
Sbjct: 813  NIETQLQTIILAKQKAEEGVNKMNRELFALSREKQELEGNQKIALKDLQKKTAVLEKEKR 872

Query: 2371 ERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVK 2550
            +     +  + DI+ L  E L  L+N  ++L  E  E +++++         +N   K+ 
Sbjct: 873  QLSDKLNEKEKDITRL-NEELATLENTVKSLESEKNEKRKEVEEWKSKFQNHDNLVPKLT 931

Query: 2551 NDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENS 2730
            + LK     LA+ +  LE++   L   +++L+                        +  +
Sbjct: 932  DKLK----SLATSFKELEKERDSLQEQLTELESANL--------------------SHET 967

Query: 2731 EKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTE----- 2895
            E  NN    ++ M E N T     K   + +S L   I+++++ +    + ++ +     
Sbjct: 968  ELKNN----IKQMTENNVTLTTENKGLISKISNLELTIDNLKKSNDAKSAQFSDDKNELE 1023

Query: 2896 --IDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSL--IHEKKMXXXX 3063
              I H NE+L E E +    + KV ++    +G++   +    L +++  I   K     
Sbjct: 1024 ESIMHLNEQLNEIEAEKEINERKVNDL----EGQL--NSVKSELTKNMDEITLLKTKLDT 1077

Query: 3064 XXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAK--- 3234
                    ++    ++N + +    ++  + +        ++++  KL   EES  K   
Sbjct: 1078 VNEDLTTSKQKLIESENEKRELSKLLENSKNA--------MIDSNNKL---EESTLKYDT 1126

Query: 3235 LIKEVENCTK---VNE-TLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELER 3402
            L+K+ ++  K    NE +   Q+ +++++L+  E +   L+  + EKE+++   Q +LE 
Sbjct: 1127 LLKKYDSLEKNGQANEKSFHDQVDELKLQLQEKELQYTTLETSIEEKEKNIQSIQTQLES 1186

Query: 3403 WKLRSQTILQQGKIVEEEAHMKSLE-KIKTLEEQLETVR--------------TENAQLT 3537
                 + I  QG        + SLE +IK L EQL++VR               E+  + 
Sbjct: 1187 LAAEKERI--QGIANTSSEEVVSLENRIKDLNEQLDSVRELYEKSKQELNKKNEEHQSML 1244

Query: 3538 DRFDRLKKQAHEKLDAAKTMQINLTTQINEL-NETKVNLEKS------LQQEIEKNNQSG 3696
             +++     +  K D A +  + L +QI  + NE  +N EK       L++EI+   +  
Sbjct: 1245 AKYESDLADSLAKADTATSTNVELESQIKVMKNELDLNKEKHTEALEILKKEIKNIEEEC 1304

Query: 3697 NGAADES----EEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYEN 3864
                 ++     E  + + EL+K     +  EKK E+    +NE++ L+  +Q++K +E 
Sbjct: 1305 ESTKSDTVVAKNEFAKSQKELKKLQESFSINEKKSEE---LQNELQELQRSVQTMKEWEE 1361

Query: 3865 STVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIX 4044
            + V  K   DL+    + + EL ++                  ++  N+  + ++  +  
Sbjct: 1362 AMV--KKSTDLETKISKTELELSKE-----------------KKKLQNVEESKRKVVSEL 1402

Query: 4045 XXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELG 4224
                         +++ I + + +LK  +++   EK   ++ +    + QE+  K+ +L 
Sbjct: 1403 ESVKKESGEEKKKLVQEIIQIKADLK--IKIHDFEKERKLLNEGSSSITQEYSEKISKLE 1460

Query: 4225 LNADGNGVVTDTR-AQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLE- 4398
               D      +++ A++EK  +   N E+ E +K   E+  Q + ++ T+  ++    E 
Sbjct: 1461 ERLDEAKFENESKGAEVEKIKKASKNSEM-ETQKIIEEKDTQITTLRETITSKEKDLDER 1519

Query: 4399 SQTL 4410
            SQT+
Sbjct: 1520 SQTI 1523

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 160/802 (19%), Positives = 338/802 (42%), Gaps = 69/802 (8%)
 Frame = +1

Query: 2239 TLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYL 2418
            +L   + DN    L  +L E  LPK     +   +   +  Y  +   + S ++  IS +
Sbjct: 639  SLFSKVKDNDFDILNAALDETGLPK-VYFSSYFVQLINENFYRIKNAFVHSPDEEPISKI 697

Query: 2419 YYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASV--- 2589
             +E  EELQN+   L+ EL+ +  D     +S   L+N+   +  + + ++ +LAS+   
Sbjct: 698  SFEAFEELQNRCIALKEELETLHHDNKASIDS---LQNQLKTISGEYEDSSTELASLKTE 754

Query: 2590 -------YTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNA 2748
                   Y T++ + S +  S+ Q+                  EK +    E  EK+ N 
Sbjct: 755  HSLLSDKYDTIKVELSDMTTSLKQITEERDTLDALKKENENKIEKNEELLKEYKEKLQNI 814

Query: 2749 IVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEA 2928
               LQT++        A +  +  ++++ + + ++ ++   +E N    +    ++    
Sbjct: 815  ETQLQTIIL-------AKQKAEEGVNKMNRELFALSREKQELEGNQKIALKDLQKKTAVL 867

Query: 2929 EVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRN 3108
            E +      K+ E  +         A + + V+SL  EK               +++++N
Sbjct: 868  EKEKRQLSDKLNEKEKDITRLNEELATLENTVKSLESEKNEKRKEVEEW-----KSKFQN 922

Query: 3109 KNP---------REKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESN-AKLIKEVENC 3258
             +          +    SF +++++         + E  T+L +   S+  +L   ++  
Sbjct: 923  HDNLVPKLTDKLKSLATSFKELEKE------RDSLQEQLTELESANLSHETELKNNIKQM 976

Query: 3259 TKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERW---------KL 3411
            T+ N TL+++   +  K+  LE  I+ LK     K    +  + ELE           ++
Sbjct: 977  TENNVTLTTENKGLISKISNLELTIDNLKKSNDAKSAQFSDDKNELEESIMHLNEQLNEI 1036

Query: 3412 RSQTILQQGKIVEEEAHM--------KSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQA 3567
             ++  + + K+ + E  +        K++++I  L+ +L+TV   N  LT    +L +  
Sbjct: 1037 EAEKEINERKVNDLEGQLNSVKSELTKNMDEITLLKTKLDTV---NEDLTTSKQKLIESE 1093

Query: 3568 HEKLDAAKTMQINLTTQI---NELNETKVNLEKSLQQ--EIEKNNQSGNGAADESEEIIR 3732
            +EK + +K ++ +    I   N+L E+ +  +  L++   +EKN Q+   +  +  + ++
Sbjct: 1094 NEKRELSKLLENSKNAMIDSNNKLEESTLKYDTLLKKYDSLEKNGQANEKSFHDQVDELK 1153

Query: 3733 LRAELEKSNNFS---NELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKI-----I 3888
            L+ + EK   ++     +E+K ++ +  + ++ESL +E + ++   N++    +     I
Sbjct: 1154 LQLQ-EKELQYTTLETSIEEKEKNIQSIQTQLESLAAEKERIQGIANTSSEEVVSLENRI 1212

Query: 3889 KDL-------KESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNIL-----ANGQES 4032
            KDL       +E +++ K EL ++              ++LA+ ++++      A+   S
Sbjct: 1213 KDLNEQLDSVRELYEKSKQELNKK---------NEEHQSMLAKYESDLADSLAKADTATS 1263

Query: 4033 ANIXXXXXXXXXXXXA-LILKRITEAEENLKKRMRLPSEE----KINAVIEKRRKVLEQE 4197
             N+              L  ++ TEA E LKK ++   EE    K + V+ K      Q+
Sbjct: 1264 TNVELESQIKVMKNELDLNKEKHTEALEILKKEIKNIEEECESTKSDTVVAKNEFAKSQK 1323

Query: 4198 FETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKK--KAFEEGKQQSMMKSTL 4371
               KL+E                 I ++  E+   EL E+++  +  +E ++  + KST 
Sbjct: 1324 ELKKLQE--------------SFSINEKKSEELQNELQELQRSVQTMKEWEEAMVKKSTD 1369

Query: 4372 LERKLSKLESQTLSPTKNNDSN 4437
            LE K+SK E + LS  K    N
Sbjct: 1370 LETKISKTELE-LSKEKKKLQN 1390

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 115/531 (21%), Positives = 208/531 (39%), Gaps = 44/531 (8%)
 Frame = +1

Query: 3202 KLLALEESNAKLIKEVENCTKV----NETLSSQLADMQVKLEPLEQEINELKLKVAEKEQ 3369
            +L  L   N   I  ++N  K      E  S++LA ++ +   L  + + +K+++++   
Sbjct: 715  ELETLHHDNKASIDSLQNQLKTISGEYEDSSTELASLKTEHSLLSDKYDTIKVELSDMTT 774

Query: 3370 HLNICQEELERWKLRSQTILQQGKIVEEEAHMKSL-EKIKTLEEQLETVRTENAQLTDRF 3546
             L    EE  R  L +     + KI + E  +K   EK++ +E QL+T+     +  +  
Sbjct: 775  SLKQITEE--RDTLDALKKENENKIEKNEELLKEYKEKLQNIETQLQTIILAKQKAEEGV 832

Query: 3547 DRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEI 3726
            +++ ++        + ++ N    + +L +    LEK  +Q  +K N       ++ ++I
Sbjct: 833  NKMNRELFALSREKQELEGNQKIALKDLQKKTAVLEKEKRQLSDKLN-------EKEKDI 885

Query: 3727 IRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENSTVN-SKIIKDLKE 3903
             RL  EL    N    LE +  + +K   E+E  KS+ Q+   ++N     +  +K L  
Sbjct: 886  TRLNEELATLENTVKSLESEKNEKRK---EVEEWKSKFQN---HDNLVPKLTDKLKSLAT 939

Query: 3904 SFK---REKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXX 4074
            SFK   +E+D L EQ+                 + KNNI    + +  +           
Sbjct: 940  SFKELEKERDSLQEQLTELESANLSHE-----TELKNNIKQMTENNVTLTTENKG----- 989

Query: 4075 XALILKRITEAE---ENLKKRMRLPS-------EEKINAVIEKRRKVLEQEFETKLRELG 4224
               ++ +I+  E   +NLKK     S        E   +++    ++ E E E ++ E  
Sbjct: 990  ---LISKISNLELTIDNLKKSNDAKSAQFSDDKNELEESIMHLNEQLNEIEAEKEINERK 1046

Query: 4225 LNADGNGVVTDTRAQIEKELRE---------KFNLELAEIKKKAFEEGKQQSMMKSTLLE 4377
            +N D  G +   ++++ K + E           N +L   K+K  E   ++  +   L  
Sbjct: 1047 VN-DLEGQLNSVKSELTKNMDEITLLKTKLDTVNEDLTTSKQKLIESENEKRELSKLLEN 1105

Query: 4378 RK------LSKLESQTL----------SPTKNNDSNETQVXXXXXXXXXXXXXXXXGEKV 4509
             K       +KLE  TL          S  KN  +NE                    EK 
Sbjct: 1106 SKNAMIDSNNKLEESTLKYDTLLKKYDSLEKNGQANEKSFHDQVDELKLQLQ-----EKE 1160

Query: 4510 LQLNYGANVVAETDNDDNPFTLQSGKDETLLTKRSADNEIIQDIIKRPKEE 4662
            LQ         ET  ++    +QS   +T L   +A+ E IQ I     EE
Sbjct: 1161 LQY-----TTLETSIEEKEKNIQS--IQTQLESLAAEKERIQGIANTSSEE 1204

>Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W
            (REAL)
          Length = 1795

 Score =  126 bits (316), Expect = 4e-28
 Identities = 243/1134 (21%), Positives = 461/1134 (40%), Gaps = 61/1134 (5%)
 Frame = +1

Query: 685  DQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEF-AKEITLK 861
            ++++ +  +   LKSE++ L+   ES + +L  KL  +    + L    +   +  I+LK
Sbjct: 731  EEVEELQKQCSKLKSELSFLQKETESTNGNLTEKLKNLSQEHEELVERYRLLDSSHISLK 790

Query: 862  QRVNELLHNEIASYKKQIERLTS-KN-LETPEKKIIQELVDLKEKLVNSEKECNELKSTV 1035
            +  + L   E+ + K  ++ +T  KN LET +K+ +  L + K  +   E     L+  +
Sbjct: 791  KNFSNL-ETELKNIKGSLDEMTQLKNVLETKDKENLAALQEYKGTIHKQEDTIKTLEKEL 849

Query: 1036 DKYINIDEKKL--ISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMI- 1206
            +   +  +K    I+K G  K L  + R     E+++K+ LQR+ +      ++++ ++ 
Sbjct: 850  ETTFSQKKKAEDGINKMG--KDLFALSREMQSVEEKYKN-LQREKDKSDSNYQKEVKLLK 906

Query: 1207 -DSFKERNSS--LERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRS 1377
             D+ K+      L   L++  +     +KE++   RELT  + +  +++    +L  +  
Sbjct: 907  EDTVKKMTEIKILNENLIKTKTEHNNLSKEKENISRELTEYRSRFQSHDSLVTKLTDKLK 966

Query: 1378 DLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDS-----HKIISKRLLHFQN 1542
             LA+   Y  +  +N+S     E T  +K +     +++ DS        +++R    Q+
Sbjct: 967  SLAN--DYKNMQSENESLIKAVEETKSEKTMQLSALQDEIDSLSRQKENFLTERESLEQS 1024

Query: 1543 VKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRI-------TDNNK---------IVES 1674
            +K+L++                   +   +  L +       T N K         ++++
Sbjct: 1025 IKQLRETISAIEKAKEEAISRFNSSKDNYESQLGLLREQLENTRNAKDESVNRISELIQN 1084

Query: 1675 AKSTSVDLE--KHIKT-LESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEK 1845
            +K+   +LE  +H+K  LE+KI    +  D  K                       + EK
Sbjct: 1085 SKNLEAELETCRHLKDGLEAKIETFEKALDVIK-----------------KSEQHLKEEK 1127

Query: 1846 ERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYV 2025
             +L  E++  KQQ     E L + +K+L+K    S   +EK+  +  + +   N   E  
Sbjct: 1128 MQLEKEVTDTKQQ----TEILRSNLKSLEKEHEDSIALIEKYKKHIIDKEGEYN---ERA 1180

Query: 2026 DKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSK 2205
             +L ++I +L+Q+  E    + + + G +  ++ +  ++ +  E +I  L+ +I  L+ K
Sbjct: 1181 SELNDEINSLQQE-KETIRLKSDKLEGDIKEMKNTLGVQSNSKESEIRALNMQIKELEEK 1239

Query: 2206 NKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKL 2385
            ++  E  +L           K L+ ET+   REL +   +K ++    +++    E K  
Sbjct: 1240 SQKNEANLLQSV--------KSLESETT-KVRELQEECDLKRKKIGELEKKIKASEDK-- 1288

Query: 2386 ESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVK----N 2553
                +S IS L  E+ EE + +      E+K   E +    E   K + ++T++K     
Sbjct: 1289 ----NSQISELQKES-EETKRELEAKTAEVKNQLEKISNLNELKEKSDIEFTRLKKTWSE 1343

Query: 2554 DLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSE 2733
            D K    +L  V   ++ KN         L                  E       E SE
Sbjct: 1344 DKKNMEEQLDKVKNEMQIKNQAFEKERKLL-----------------NEGSSTITQEYSE 1386

Query: 2734 KINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANE 2913
            KIN     L  +  EN +        +N L R   + + + ++        N EI    E
Sbjct: 1387 KINMLEDKLMILQNENESKTKQIDAVRNDLERATLSKDELLEEKRNEIKILNDEILSYKE 1446

Query: 2914 RLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRR 3093
            +L E    + S + +  + +ES              +R  +   K              +
Sbjct: 1447 KLSETNKGLLSKERENKQNIES--------------LREQLRTLKESKTKVEEGLKVIEQ 1492

Query: 3094 ARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALE-ESNAKLIKE----VENC 3258
                 K   EK    VK              +E+T K    E +S+ K++KE    +E C
Sbjct: 1493 KSATQKAELEKSKETVK-------------TLESTIKCNEKELKSSMKVMKESDEKLEQC 1539

Query: 3259 TKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQG 3438
             K  E    ++ ++Q +   LE +I E K ++ E E+ L I        + +S T L+  
Sbjct: 1540 RKSAE---EEIKNLQNEKSTLETQIKESKKEIEELERKLKI--------EAKSTTELE-- 1586

Query: 3439 KIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQ 3618
              +E++        +    E+L   R E+A L  +   L+++  EK       Q+ +   
Sbjct: 1587 -TIEQQ--------LSKANEKLNVNRKEDALLKSKLKDLERELKEK-------QVKIKNN 1630

Query: 3619 INELNETKVNLEKSLQQEIEKNNQSGNGAADESE-EIIRLRAELEKSNNFSNELE----- 3780
            I E  E   +  K+L+QE++   Q      +ES+ E+ +L+AE  +S+    +LE     
Sbjct: 1631 IEE-KELLTSQLKTLEQELDNAQQKTQKCEEESKIEVRKLQAEKTESDERVVQLETKYNN 1689

Query: 3781 --------KKVEDA-----KKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKE 3903
                    KK EDA        K EIE L  EL+ +K  ENS +  ++ KD  E
Sbjct: 1690 LVAKEENWKKDEDAINKTTDSQKTEIEKLVIELEKLKT-ENSKL-KEVNKDRSE 1741

 Score =  113 bits (282), Expect = 4e-24
 Identities = 190/891 (21%), Positives = 378/891 (42%), Gaps = 122/891 (13%)
 Frame = +1

Query: 280  VAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQ 459
            ++RE  ++E +  F S+D+L   +T +   L+++  D+  +++        +E++K E  
Sbjct: 940  ISRE--LTEYRSRFQSHDSL---VTKLTDKLKSLANDYKNMQSENESLIKAVEETKSEKT 994

Query: 460  DSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKET-- 633
              L   SAL+++I       DS++++     TE + L+  +K LRE    +E K KE   
Sbjct: 995  MQL---SALQDEI-------DSLSRQKENFLTERESLEQSIKQLRETISAIE-KAKEEAI 1043

Query: 634  ---DKNKKLYSSA--------EDASRLQDQLQIVSSEIL----SLKSEIATLKYMNESLS 768
               + +K  Y S         E+    +D+     SE++    +L++E+ T +++ + L 
Sbjct: 1044 SRFNSSKDNYESQLGLLREQLENTRNAKDESVNRISELIQNSKNLEAELETCRHLKDGLE 1103

Query: 769  TDLQ---RKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS------------- 900
              ++   + L  IK  + +L   K +  KE+T  ++  E+L + + S             
Sbjct: 1104 AKIETFEKALDVIKKSEQHLKEEKMQLEKEVTDTKQQTEILRSNLKSLEKEHEDSIALIE 1163

Query: 901  -YKKQI--------ERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINI 1053
             YKK I        ER +  N E    +  +E + LK   +  E +  E+K+T+    N 
Sbjct: 1164 KYKKHIIDKEGEYNERASELNDEINSLQQEKETIRLKSDKL--EGDIKEMKNTLGVQSNS 1221

Query: 1054 DEKKLISKFGNPKKLIEILRR------QLVKEKRHKDTLQRQVESF-------LVELEQK 1194
             E ++ +     K+L E  ++      Q VK    + T  R+++         + ELE+K
Sbjct: 1222 KESEIRALNMQIKELEEKSQKNEANLLQSVKSLESETTKVRELQEECDLKRKKIGELEKK 1281

Query: 1195 LPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISN----NEQFNDEL 1362
            +   +    + S L++E        EET +E + K  E+ N  +KISN     E+ + E 
Sbjct: 1282 IKASEDKNSQISELQKES-------EETKRELEAKTAEVKNQLEKISNLNELKEKSDIEF 1334

Query: 1363 LR-------QRSDLAHQVQYLLLCIDNKSPFTEKEATLVKK------------------- 1464
             R        + ++  Q+  +   +  K+   EKE  L+ +                   
Sbjct: 1335 TRLKKTWSEDKKNMEEQLDKVKNEMQIKNQAFEKERKLLNEGSSTITQEYSEKINMLEDK 1394

Query: 1465 --IVSNEN---------TENDTDSHKIISKRLLHFQ--NVKELQQKNMXXXXXXXXXXXX 1605
              I+ NEN           ND +   +    LL  +   +K L  + +            
Sbjct: 1395 LMILQNENESKTKQIDAVRNDLERATLSKDELLEEKRNEIKILNDEILSYKEKLSETNKG 1454

Query: 1606 XXXXEQEQQKTL---------------RITDNNKIVESAKST-SVDLEKH---IKTLESK 1728
                E+E ++ +               ++ +  K++E   +T   +LEK    +KTLES 
Sbjct: 1455 LLSKERENKQNIESLREQLRTLKESKTKVEEGLKVIEQKSATQKAELEKSKETVKTLEST 1514

Query: 1729 INIISQE-RDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEE 1905
            I    +E + S K++                     + EK  L  ++   K    K +EE
Sbjct: 1515 IKCNEKELKSSMKVMKESDEKLEQCRKSAEEEIKNLQNEKSTLETQIKESK----KEIEE 1570

Query: 1906 LENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELF 2085
            LE K+K   KS  T+++E  +  L+    K N N  ++ +  L++K+K LE++L E ++ 
Sbjct: 1571 LERKLKIEAKS--TTELETIEQQLSKANEKLNVNRKEDAL--LKSKLKDLERELKEKQVK 1626

Query: 2086 EKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLED----KILTMTLSKN 2253
             K       NN+E+ +++       ++  L++E+ N + K +  E+    ++  +   K 
Sbjct: 1627 IK-------NNIEEKELL-----TSQLKTLEQELDNAQQKTQKCEEESKIEVRKLQAEKT 1674

Query: 2254 LLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENL 2433
              D +V+QLET  +     +    K+E+   A  +T   ++ ++E +       +  E L
Sbjct: 1675 ESDERVVQLETKYNNLVAKEENWKKDED---AINKTTDSQKTEIEKL------VIELEKL 1725

Query: 2434 EELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLAS 2586
            +   ++ + + ++  E+ + + + T+    L+ K TK ++ LK    +++S
Sbjct: 1726 KTENSKLKEVNKDRSEIDDLMLLVTD----LDEKNTKYRSKLKDLGVEISS 1772

 Score =  102 bits (255), Expect = 5e-21
 Identities = 191/919 (20%), Positives = 368/919 (40%), Gaps = 60/919 (6%)
 Frame = +1

Query: 1834 ELEKE--RLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNN 2007
            EL+K+  +L +ELS ++++       L  K+K L +     +  VE++ L    +  ++ 
Sbjct: 735  ELQKQCSKLKSELSFLQKETESTNGNLTEKLKNLSQEH---EELVERYRL----LDSSHI 787

Query: 2008 LLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQK--ISFLDK 2181
             LK+    LE ++K ++  L E    +  L T    NL   +  + ++ +Q+  I  L+K
Sbjct: 788  SLKKNFSNLETELKNIKGSLDEMTQLKNVLETKDKENLAALQEYKGTIHKQEDTIKTLEK 847

Query: 2182 EISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQT 2361
            E+    S+ K  ED I  M      L  ++  +E      +  K+    N +KE    + 
Sbjct: 848  ELETTFSQKKKAEDGINKMGKDLFALSREMQSVEEKYKNLQREKDKSDSNYQKEVKLLKE 907

Query: 2362 YTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYT 2541
             T   KK+  +       +  ENL + + +   L +E + +  +L          ++  T
Sbjct: 908  DTV--KKMTEIK------ILNENLIKTKTEHNNLSKEKENISRELTEYRSRFQSHDSLVT 959

Query: 2542 KVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAEN 2721
            K+ + LK     LA+ Y  ++ +N  L  +V + +                T +L   ++
Sbjct: 960  KLTDKLKS----LANDYKNMQSENESLIKAVEETKSEK-------------TMQLSALQD 1002

Query: 2722 ENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEID 2901
            E    I++     +  + E  + + + K  + ++S + +A      +    + NY +++ 
Sbjct: 1003 E----IDSLSRQKENFLTERESLEQSIKQLRETISAIEKAKEEAISRFNSSKDNYESQLG 1058

Query: 2902 HANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXX 3081
               E+LE           +++E++++            HL   L  E K+          
Sbjct: 1059 LLREQLENTRNAKDESVNRISELIQNSKNLEAELETCRHLKDGL--EAKIETF------- 1109

Query: 3082 XXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCT 3261
                         EK    +K  +Q                   L+E   +L KEV +  
Sbjct: 1110 -------------EKALDVIKKSEQH------------------LKEEKMQLEKEVTDTK 1138

Query: 3262 KVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNI----CQEELERWKLRSQTI- 3426
            +  E L S L  ++ + E     I + K  + +KE   N       +E+   +   +TI 
Sbjct: 1139 QQTEILRSNLKSLEKEHEDSIALIEKYKKHIIDKEGEYNERASELNDEINSLQQEKETIR 1198

Query: 3427 LQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQIN 3606
            L+  K+  +   MK+   +++  ++ E +R  N Q+ +  ++ +K     L + K+++  
Sbjct: 1199 LKSDKLEGDIKEMKNTLGVQSNSKESE-IRALNMQIKELEEKSQKNEANLLQSVKSLESE 1257

Query: 3607 LTTQINELNET------KVN-LEKSLQQEIEKNNQSGNGAADESEEIIR--------LRA 3741
             TT++ EL E       K+  LEK ++   +KN+Q       ESEE  R        ++ 
Sbjct: 1258 -TTKVRELQEECDLKRKKIGELEKKIKASEDKNSQISE-LQKESEETKRELEAKTAEVKN 1315

Query: 3742 ELEKSNNFSNELEKK------------VEDAKKFKNEIESLKSELQ-SVKAYEN-----S 3867
            +LEK +N  NEL++K             ED K  + +++ +K+E+Q   +A+E      +
Sbjct: 1316 QLEKISNL-NELKEKSDIEFTRLKKTWSEDKKNMEEQLDKVKNEMQIKNQAFEKERKLLN 1374

Query: 3868 TVNSKIIKDLKESFKREKDELI----EQMXXXXXXXXXXXXXTILAQRKNNILANGQESA 4035
              +S I ++  E     +D+L+    E                     K+ +L   +   
Sbjct: 1375 EGSSTITQEYSEKINMLEDKLMILQNENESKTKQIDAVRNDLERATLSKDELLEEKRNEI 1434

Query: 4036 NIXXXXXXXXXXXXALILKRITEAE-------ENLKKRMRLPSEEKINAVIEKRRKVLEQ 4194
             I            +   K +   E       E+L++++R   E K    +E+  KV+EQ
Sbjct: 1435 KILNDEILSYKEKLSETNKGLLSKERENKQNIESLREQLRTLKESKTK--VEEGLKVIEQ 1492

Query: 4195 EFETKLRELGLNADGNGVVTDTRAQIEKELREKFNL------ELAEIKKKAFEEGKQQSM 4356
            +  T+  EL  + +    +  T    EKEL+    +      +L + +K A EE K    
Sbjct: 1493 KSATQKAELEKSKETVKTLESTIKCNEKELKSSMKVMKESDEKLEQCRKSAEEEIKNLQN 1552

Query: 4357 MKSTL-LERKLSKLESQTL 4410
             KSTL  + K SK E + L
Sbjct: 1553 EKSTLETQIKESKKEIEEL 1571

 Score = 95.9 bits (237), Expect = 7e-19
 Identities = 189/904 (20%), Positives = 357/904 (39%), Gaps = 56/904 (6%)
 Frame = +1

Query: 1861 ELSSMKQQHVKVLEEL----ENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVD 2028
            E+  +K+  VK + E+    EN IKT  +    SK E E  +    E +         V 
Sbjct: 901  EVKLLKEDTVKKMTEIKILNENLIKTKTEHNNLSK-EKENISRELTEYRSRFQSHDSLVT 959

Query: 2029 KLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKN 2208
            KL +K+K+L  D    +   ++LI   V   +  K ++LS  + +I  L ++  N  ++ 
Sbjct: 960  KLTDKLKSLANDYKNMQSENESLIKA-VEETKSEKTMQLSALQDEIDSLSRQKENFLTER 1018

Query: 2209 KNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPA--KQQTYTFERKK 2382
            ++LE  I         L   +  +E +  E     N+   N E +    ++Q       K
Sbjct: 1019 ESLEQSI-------KQLRETISAIEKAKEEAISRFNSSKDNYESQLGLLREQLENTRNAK 1071

Query: 2383 LESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLK 2562
             ESVN   IS L  +N + L+ +  T R     +++ L+ K E+  K  +   K +  LK
Sbjct: 1072 DESVNR--ISELI-QNSKNLEAELETCRH----LKDGLEAKIETFEKALDVIKKSEQHLK 1124

Query: 2563 QATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKIN 2742
            +   +L    T  +Q+   L +++  L+                    +   NE + ++N
Sbjct: 1125 EEKMQLEKEVTDTKQQTEILRSNLKSLEKEHEDSIALIEKYKKHIIDKEGEYNERASELN 1184

Query: 2743 NAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESN-YNTEIDHANERL 2919
            + I  LQ   +E  T +      +  +  ++  +  +Q  S   E    N +I    E+ 
Sbjct: 1185 DEINSLQ---QEKETIRLKSDKLEGDIKEMKNTLG-VQSNSKESEIRALNMQIKELEEKS 1240

Query: 2920 EEAEVKMA----SFDGKVTEILESYDGKILNTAAIGHLVRSL--IHEKKMXXXXXXXXXX 3081
            ++ E  +     S + + T++ E  +   L    IG L + +    +K            
Sbjct: 1241 QKNEANLLQSVKSLESETTKVRELQEECDLKRKKIGELEKKIKASEDKNSQISELQKESE 1300

Query: 3082 XXRRARYRN----KNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEV 3249
              +R         KN  EK  +  ++ ++S           +  K   +EE   K+  E+
Sbjct: 1301 ETKRELEAKTAEVKNQLEKISNLNELKEKSDIEFTRLKKTWSEDKK-NMEEQLDKVKNEM 1359

Query: 3250 ENCTK--------VNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERW 3405
            +   +        +NE  S+   +   K+  LE ++  L+ +   K + ++  + +LER 
Sbjct: 1360 QIKNQAFEKERKLLNEGSSTITQEYSEKINMLEDKLMILQNENESKTKQIDAVRNDLERA 1419

Query: 3406 KLRSQTILQQG----KIVEEEA-----------------HMKSLEKIKTLEEQLETVRTE 3522
             L    +L++     KI+ +E                    ++ + I++L EQL T++  
Sbjct: 1420 TLSKDELLEEKRNEIKILNDEILSYKEKLSETNKGLLSKERENKQNIESLREQLRTLKES 1479

Query: 3523 NAQLTDRFDRLK-KQAHEKLDAAKTMQ----INLTTQINELNETKVNLEKSLQQEIEKNN 3687
              ++ +    ++ K A +K +  K+ +    +  T + NE  E K ++ K +++  EK  
Sbjct: 1480 KTKVEEGLKVIEQKSATQKAELEKSKETVKTLESTIKCNE-KELKSSM-KVMKESDEKLE 1537

Query: 3688 QSGNGAADE----SEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKA 3855
            Q    A +E      E   L  ++++S     ELE+K++   K   E+E+++ +L   KA
Sbjct: 1538 QCRKSAEEEIKNLQNEKSTLETQIKESKKEIEELERKLKIEAKSTTELETIEQQLS--KA 1595

Query: 3856 YENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESA 4035
             E   VN K    LK   K  + EL E+              T   +     L N Q+  
Sbjct: 1596 NEKLNVNRKEDALLKSKLKDLERELKEKQVKIKNNIEEKELLTSQLKTLEQELDNAQQKT 1655

Query: 4036 NIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLR 4215
                          + I  R  +AE       +  S+E++  +  K   ++ +E   K  
Sbjct: 1656 Q--------KCEEESKIEVRKLQAE-------KTESDERVVQLETKYNNLVAKEENWKKD 1700

Query: 4216 ELGLNADGNGVVTD-TRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSK 4392
            E  +N   +   T+  +  IE E  +  N +L E+ K   E      M+  T L+ K +K
Sbjct: 1701 EDAINKTTDSQKTEIEKLVIELEKLKTENSKLKEVNKDRSE--IDDLMLLVTDLDEKNTK 1758

Query: 4393 LESQ 4404
              S+
Sbjct: 1759 YRSK 1762

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 83/415 (20%), Positives = 174/415 (41%), Gaps = 40/415 (9%)
 Frame = +1

Query: 3322 EQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEE---------AH---- 3462
            ++E+  LK    +K   + I  E L + K     + ++ + +  E         +H    
Sbjct: 899  QKEVKLLKEDTVKKMTEIKILNENLIKTKTEHNNLSKEKENISRELTEYRSRFQSHDSLV 958

Query: 3463 MKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETK 3642
             K  +K+K+L    + +++EN  L    +  K +   +L A +    +L+ Q       +
Sbjct: 959  TKLTDKLKSLANDYKNMQSENESLIKAVEETKSEKTMQLSALQDEIDSLSRQKENFLTER 1018

Query: 3643 VNLEKSLQQ------EIEKNNQSG----NGAADESE-EIIRLRAELEKSNNFS----NEL 3777
             +LE+S++Q       IEK  +      N + D  E ++  LR +LE + N      N +
Sbjct: 1019 ESLEQSIKQLRETISAIEKAKEEAISRFNSSKDNYESQLGLLREQLENTRNAKDESVNRI 1078

Query: 3778 EKKVEDAKKFKNEIES---LKSELQS-VKAYENSTVNSKIIKDLKESFKREKDELIEQMX 3945
             + ++++K  + E+E+   LK  L++ ++ +E +     +IK  ++  K EK +L +++ 
Sbjct: 1079 SELIQNSKNLEAELETCRHLKDGLEAKIETFEKAL---DVIKKSEQHLKEEKMQLEKEV- 1134

Query: 3946 XXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENL-- 4119
                         IL     ++    ++S  +                +R +E  + +  
Sbjct: 1135 -----TDTKQQTEILRSNLKSLEKEHEDSIALIEKYKKHIIDKEGEYNERASELNDEINS 1189

Query: 4120 ----KKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELR 4287
                K+ +RL S +K+   I++ +  L  +  +K  E+        +    +   EK  +
Sbjct: 1190 LQQEKETIRLKS-DKLEGDIKEMKNTLGVQSNSKESEI------RALNMQIKELEEKSQK 1242

Query: 4288 EKFNLELAEIKKKAFEEGKQQSMMKSTLLER-KLSKLESQ-TLSPTKNNDSNETQ 4446
             + NL L  +K    E  K + + +   L+R K+ +LE +   S  KN+  +E Q
Sbjct: 1243 NEANL-LQSVKSLESETTKVRELQEECDLKRKKIGELEKKIKASEDKNSQISELQ 1296

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score =  125 bits (314), Expect = 4e-28
 Identities = 182/917 (19%), Positives = 368/917 (40%), Gaps = 65/917 (7%)
 Frame = +1

Query: 421  TENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLREN 600
            ++N +  S + L+    EN++LK +I     K + +         EN       +L+R+ 
Sbjct: 2    SKNEISFSSISLEK---ENNSLKREIKRLSDKYNLL---------ENNYKWLNERLVRDQ 49

Query: 601  NLYL----EIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLS 768
              YL    ++K    + NK LY+S      LQ +  I  +E LS +    ++++ ++  S
Sbjct: 50   KNYLIDTHDVKYSSKNDNK-LYNSHNKLLELQKEFLISHNEKLSDRLNENSIEFNDKFNS 108

Query: 769  TDLQRKLFRIKDLDDNLNSSKQE--FAKEITLKQRVNELLHNEIASYKKQIERLTSKNLE 942
              +           DNLN+ K    F K++ L   +NE     I   K  I+   + +  
Sbjct: 109  VVI-----------DNLNNEKNLILFEKKLNL---LNERYSIIIKDQKDVIDNDINNSKY 154

Query: 943  TPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDE--KKLISKFGNPKKLIEILRR 1116
               K + ++++     + + E +  +L + +  +I+I+E   +  +K+       ++L++
Sbjct: 155  LEFKSLNEKIIKQNSNMKSMESKIEKLNAIIHNFIDINEFDNENTNKYSLDLNDNKVLKK 214

Query: 1117 QLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDI 1296
             LV EK     LQ ++ S L+EL  KLP + S KE+N  L+     I SS EE  ++   
Sbjct: 215  LLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQQFHS 274

Query: 1297 KDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPF---TEKEATLVKKI 1467
               ++ ++  KI + EQ   +LL QR++L   +  LL  I+  S +   +E E  L++ +
Sbjct: 275  NTDKIASMNNKIVDYEQSLKQLLSQRTNLISYILNLLNVINLNSKYLNLSESEGCLIQNL 334

Query: 1468 VSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRI 1647
             +NE  +                   + LQ+KN+                  +   T+ I
Sbjct: 335  FNNERIQ-------------------RFLQEKNLTLTEIF------------DNLNTVDI 363

Query: 1648 TDNN------KIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXX 1809
            T NN      K++   +S S   ++ I   +++I ++    D+YK+++            
Sbjct: 364  TFNNFNRSDIKVLPPTESAS---KEEIINYKNEIILLENNCDAYKMILYNNGITEDLDEK 420

Query: 1810 XXXXXXXCELEKERLT--NELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNF 1983
                         R+T  NE +S  Q     ++EL + +  L +        + K+  + 
Sbjct: 421  LKIE------SSSRMTELNEKNSRIQMLESKIDELNSIVTKLNEKNSRFMASINKNNSSE 474

Query: 1984 DEMKDNNNLLKEYVDKLENKIKTLEQDLAEN-------------ELFEKNLITGGVNNLE 2124
              + +  NLL +    L    K+L+ +  +N             ++ E       +N+  
Sbjct: 475  STILEKYNLLNQSYKTLLEAYKSLKSNATDNKKAVLTSTLDDTKKIVEFKSTINYLNSTI 534

Query: 2125 QSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDN--------KVLQL 2280
            +S   +L   ++    L  E   +K +N NL   +  +   KN + N        ++L+L
Sbjct: 535  KSLSAKLVSIQESNDLLADENQKIKMENSNLSSLLNKINTDKNSISNELSDLHSKEILEL 594

Query: 2281 ETSLSE--RELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQF 2454
            ET  ++   +L +  +   E  E   +Q   F+  K+++ N+      +      L+N +
Sbjct: 595  ETEKTKLLEQLEEGERKLKETNEKHNEQIKWFQ-NKIDNFNEETTKNQFN---NALKNDY 650

Query: 2455 RTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSV 2634
              L++  +E  ++++   +   +L+ +  +  N  K    +L+    +LE + +     +
Sbjct: 651  ENLKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHI 710

Query: 2635 SQLQG---------XXXXXXXXXXXXXXXTEK------------LQMAENENSEKINNAI 2751
            S+L+                         TE+            LQ+ E+   EK+ N  
Sbjct: 711  SKLEVDINNLNNALVEAEKKLSEENLKYETERQTGSTLRLKIDDLQLNEDNLKEKVKN-- 768

Query: 2752 VLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYN--TEIDHANERLEE 2925
                 + E  +T KD  K  + +   L   I+ +Q   ++++   N        N  L +
Sbjct: 769  -----LEENESTLKDKIKMIEGNEDDLMGKISVLQSNEILLKDKLNDLNSKSSNNSELVD 823

Query: 2926 AEVKMASFDGKVTEILE 2976
             E     ++ + + I+E
Sbjct: 824  VEGLKKDWEKEYSHIIE 840

 Score =  121 bits (304), Expect = 6e-27
 Identities = 195/939 (20%), Positives = 370/939 (39%), Gaps = 94/939 (10%)
 Frame = +1

Query: 1912 NKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFE- 2088
            NK+  LQK  L S  E     LN + ++ N+      +D L N+   +  +   N L E 
Sbjct: 74   NKLLELQKEFLISHNEKLSDRLNENSIEFNDKFNSVVIDNLNNEKNLILFEKKLNLLNER 133

Query: 2089 --------KNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLE-------- 2220
                    K++I   +NN   SK +E     +KI    K+ SN+KS    +E        
Sbjct: 134  YSIIIKDQKDVIDNDINN---SKYLEFKSLNEKII---KQNSNMKSMESKIEKLNAIIHN 187

Query: 2221 -------DKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERK 2379
                   D   T   S +L DNKVL+    L   E  KN+ +K +E+  +      F+  
Sbjct: 188  FIDINEFDNENTNKYSLDLNDNKVLK---KLLVHE--KNSNLKLQEELNSILLELNFKLP 242

Query: 2380 KLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDL 2559
             L S+ + +          ELQ+ F  +    +E+ +     T+    + NK    +  L
Sbjct: 243  SLTSLKEKN---------HELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSL 293

Query: 2560 KQATYKLASVYT-TLEQKNSFLANS----VSQLQGXXXXXXXXXXXXXXXTEKLQMAENE 2724
            KQ   +  ++ +  L   N    NS    +S+ +G                ++  +   E
Sbjct: 294  KQLLSQRTNLISYILNLLNVINLNSKYLNLSESEGCLIQNLFNNERIQRFLQEKNLTLTE 353

Query: 2725 NSEKINNAIVL--------LQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQ------- 2859
              + +N   +         ++ +    +  K+   ++KN +  L    ++ +        
Sbjct: 354  IFDNLNTVDITFNNFNRSDIKVLPPTESASKEEIINYKNEIILLENNCDAYKMILYNNGI 413

Query: 2860 -----QSLVIESNYN-TEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHL 3021
                 + L IES+   TE++  N R++  E K+   +  VT++ E  + + + +    + 
Sbjct: 414  TEDLDEKLKIESSSRMTELNEKNSRIQMLESKIDELNSIVTKLNEK-NSRFMASINKNNS 472

Query: 3022 VRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKFPSFVKIDQ-------QSXXXXXXX 3180
              S I EK               ++   N    +K      +D        +S       
Sbjct: 473  SESTILEKYNLLNQSYKTLLEAYKSLKSNATDNKKAVLTSTLDDTKKIVEFKSTINYLNS 532

Query: 3181 XVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAE 3360
             +   + KL++++ESN  L  E +     N  LSS L  +      +  E+++L  K   
Sbjct: 533  TIKSLSAKLVSIQESNDLLADENQKIKMENSNLSSLLNKINTDKNSISNELSDLHSK--- 589

Query: 3361 KEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENA---- 3528
                  I + E E+ KL  Q  L++G+   +E + K  E+IK  + +++    E      
Sbjct: 590  -----EILELETEKTKLLEQ--LEEGERKLKETNEKHNEQIKWFQNKIDNFNEETTKNQF 642

Query: 3529 -----------------------QLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNET 3639
                                   +  D+F RLK+QA+E+L+A+KT Q  L+  +  L + 
Sbjct: 643  NNALKNDYENLKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDE 702

Query: 3640 KVNLEKSLQQ-EIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNE 3816
            + N ++ + + E++ NN + N   +  +++     + E      + L  K++D +   NE
Sbjct: 703  RTNFKEHISKLEVDINNLN-NALVEAEKKLSEENLKYETERQTGSTLRLKIDDLQ--LNE 759

Query: 3817 IESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQ 3996
             ++LK ++++++       N   +KD  +  +  +D+L+ ++              +L  
Sbjct: 760  -DNLKEKVKNLEE------NESTLKDKIKMIEGNEDDLMGKI------SVLQSNEILLKD 806

Query: 3997 RKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKINAVIEKR 4176
            + N++ +    ++ +                       E LKK      E++ + +IEKR
Sbjct: 807  KLNDLNSKSSNNSELVDV--------------------EGLKKDW----EKEYSHIIEKR 842

Query: 4177 RKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSM 4356
             +  E + E +L                ++++E+E+ +K  +    ++ K FE GK  S 
Sbjct: 843  IEYAEMQLEKRL----------------KSEMEREMDDKMKV----VEMKGFESGKASSE 882

Query: 4357 MKSTLLERKLSKLESQ---------TLSPTKNNDSNETQ 4446
                LLE KLS LE Q         TL  ++NN  N+TQ
Sbjct: 883  KTLNLLEHKLSLLEKQNNEKSNKINTLIESENN--NKTQ 919

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 178/972 (18%), Positives = 374/972 (38%), Gaps = 85/972 (8%)
 Frame = +1

Query: 124  KAYDLMKENS------FVSAAIDDIKH-----VYEGKINTISQKYFXXXXXXXXXXXXXS 270
            K  D + ENS      F S  ID++ +     ++E K+N ++++Y               
Sbjct: 90   KLSDRLNENSIEFNDKFNSVVIDNLNNEKNLILFEKKLNLLNERY--------------- 134

Query: 271  GYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENV------ 432
                    ++ + QK+   ND  NS+    K   E + + ++ +++ E K E +      
Sbjct: 135  -------SIIIKDQKDVIDNDINNSKYLEFKSLNEKIIKQNSNMKSMESKIEKLNAIIHN 187

Query: 433  -----------LEQSKLELQDS----------LTENSALKEQIGVFEGKLDSMTQELWLA 549
                         +  L+L D+             N  L+E++     +L+     L   
Sbjct: 188  FIDINEFDNENTNKYSLDLNDNKVLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSL 247

Query: 550  NTENKKLQTGMK-LLRENNLYLEIKCKETDK----NKKLYSSAEDASRLQDQLQIVSSEI 714
              +N +LQ+  + ++  N   L+     TDK    N K+    +   +L  Q   + S I
Sbjct: 248  KEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSLKQLLSQRTNLISYI 307

Query: 715  LSLKSEI-ATLKYM---------------NESLSTDLQRKLFRIKDLDDNLNSSKQEF-- 840
            L+L + I    KY+               NE +   LQ K   + ++ DNLN+    F  
Sbjct: 308  LNLLNVINLNSKYLNLSESEGCLIQNLFNNERIQRFLQEKNLTLTEIFDNLNTVDITFNN 367

Query: 841  --AKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELV--DLKEKL-VNSE 1005
                +I +          EI +YK +I  L   N +  +  +    +  DL EKL + S 
Sbjct: 368  FNRSDIKVLPPTESASKEEIINYKNEI-ILLENNCDAYKMILYNNGITEDLDEKLKIESS 426

Query: 1006 KECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVEL 1185
                EL    +  I + E K+        KL E   R +    ++  +    +E + +  
Sbjct: 427  SRMTELNEK-NSRIQMLESKIDELNSIVTKLNEKNSRFMASINKNNSSESTILEKYNLLN 485

Query: 1186 EQKLPMIDSFKE-RNSSLERELLRITSSLEETAKERDIK------DRELTNLQKKISNNE 1344
            +    +++++K  ++++ + +   +TS+L++T K  + K      +  + +L  K+ + +
Sbjct: 486  QSYKTLLEAYKSLKSNATDNKKAVLTSTLDDTKKIVEFKSTINYLNSTIKSLSAKLVSIQ 545

Query: 1345 QFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKR 1524
            + ND L  +   +  +   L   ++  +      +  +  + S E  E +T+  K++ + 
Sbjct: 546  ESNDLLADENQKIKMENSNLSSLLNKINTDKNSISNELSDLHSKEILELETEKTKLLEQL 605

Query: 1525 LLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAK-----STS 1689
                + +KE  +K+                   EQ K  +   +N   E+ K     +  
Sbjct: 606  EEGERKLKETNEKH------------------NEQIKWFQNKIDNFNEETTKNQFNNALK 647

Query: 1690 VDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELS 1869
             D E   K+ E K   + +  D +  L                     +  ++ L++ + 
Sbjct: 648  NDYENLKKSFEEKSKEVEEANDKFSRL----------KRQANERLNASKTTQKELSDNVK 697

Query: 1870 SMKQQHVKVLE---ELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKL-- 2034
            S++ +     E   +LE  I  L  + + ++ ++ +  L ++  +   + L+  +D L  
Sbjct: 698  SLEDERTNFKEHISKLEVDINNLNNALVEAEKKLSEENLKYETERQTGSTLRLKIDDLQL 757

Query: 2035 -ENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNK 2211
             E+ +K   ++L ENE   K+ I   +   E   + ++SV +     L  ++++L SK+ 
Sbjct: 758  NEDNLKEKVKNLEENESTLKDKIK-MIEGNEDDLMGKISVLQSNEILLKDKLNDLNSKSS 816

Query: 2212 NLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLES 2391
            N  + +    L K+        +E  +   E+    ++K+E +     +    E K  ES
Sbjct: 817  NNSELVDVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRLKSEMEREMDDKMKVVEMKGFES 876

Query: 2392 VNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQAT 2571
               S       + L  L+++   L ++  E    ++   ES  +  NK  K+        
Sbjct: 877  GKASS-----EKTLNLLEHKLSLLEKQNNEKSNKINTLIES--ENNNKTQKIN------- 922

Query: 2572 YKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKI-NNA 2748
                  ++++E K S L ++ + ++                TE     E E+S +I   +
Sbjct: 923  ---PFTFSSVEPKISNLVSNDTIIEFSKAPAVSNNEGKETITESNSQIEGESSHQIPTKS 979

Query: 2749 IVLLQTMVEENT 2784
            +  + + ++ NT
Sbjct: 980  VEAIDSQLKRNT 991

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
            (REAL)
          Length = 1782

 Score =  124 bits (312), Expect = 1e-27
 Identities = 246/1156 (21%), Positives = 464/1156 (40%), Gaps = 45/1156 (3%)
 Frame = +1

Query: 601  NLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQ 780
            +L  E K    D  +KL + +++   L ++ Q ++S  +SLK  +++L+   +S++  L 
Sbjct: 746  SLQTETKTTNEDLTEKLGTLSKEHEELVEKYQSLTSSHMSLKENVSSLEIELKSITESLN 805

Query: 781  -----RKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLET 945
                 R     KD D++   + QE+   I  ++     L  E+ +   Q      K  E 
Sbjct: 806  EMTKLRDALETKDKDNSF--ALQEYKSTIHKQEEAIRTLEKELETISSQ-----KKKAED 858

Query: 946  PEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLIS-KFGNPKKLIEI--LRR 1116
               K+ ++L  L  +    E++   L+   DK  +  +K+  S K    KK+IEI  L  
Sbjct: 859  GINKMGKDLFALSREKQAVEEKQRSLQKEKDKSNSDHQKETKSLKDEITKKIIEIKTLNE 918

Query: 1117 QLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKE-RD 1293
             LVK K     L  + E    EL +       +K R  S +  + ++T  L+  A   RD
Sbjct: 919  NLVKTKTQHSALSEEKEQISKELVE-------YKSRFQSHDNLVAKLTEKLKSLANNYRD 971

Query: 1294 IKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATL-----V 1458
            ++ +   +L + I   +  ND  L    D     ++  L  + +S  TEKE        +
Sbjct: 972  LQAKH-ESLMQSIEVTKSENDTQLSNLQD-----KFDSLSREKESFQTEKEHLTDDIKEL 1025

Query: 1459 KKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKT 1638
            K+ +S    +N+  + +  S +  +   + +L+++                  ++  + +
Sbjct: 1026 KETISRLEHKNEETTSRYTSAKDDYESQINQLKEQ------LETATTTQDDNMDKISELS 1079

Query: 1639 LRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXX 1818
              I +   ++E+ KS+  DL+  ++  E  +  + +  +  K                  
Sbjct: 1080 KNIRNLEMLLETCKSSKHDLQTKLEASEKTLAEMHENEERLKE----------------- 1122

Query: 1819 XXXXCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKD 1998
                   EK +L  E+ + K++   + E  E+  K   K  +T   E EK     D+ K+
Sbjct: 1123 -------EKAQLEKEVVNTKKELSTLRENFESLEKE-HKDSVTQVGEYEKQIT--DKAKE 1172

Query: 1999 NNNLLKEYVDKLENKIKTLEQDLAENELFEKNL--ITGGVNNLEQSKIIELSVAEQKISF 2172
             N    E + KL + I++++Q   ENE   KN   + G V  ++Q+   + ++ E  +  
Sbjct: 1173 YN----ENISKLNDDIRSIQQ---ENEALCKNNDNLKGEVEQVKQTLEEQSNLRESTVEA 1225

Query: 2173 LDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAK 2352
            L+ +I +L+ KN++ E K+     +K +   K++         EL K    + EE    +
Sbjct: 1226 LNTQIKDLEVKNQSSEAKLSESVKNKEIETEKMI---------ELQKECNSRKEEISELE 1276

Query: 2353 QQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLEN 2532
            ++  T E                 EN   L+     L +EL+E + +L+++T        
Sbjct: 1277 EKLKTSE----------------VENSHNLE-----LLKELEEDKRELEIRTNEVKNQSE 1315

Query: 2533 KYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQM 2712
            K   +    ++   +L  +  T   + S L   + +L+                  K++ 
Sbjct: 1316 KIANLDKLREKTEAELCRLKKTSTDEKSNLEEQLGKLRNEI---------------KIKS 1360

Query: 2713 AENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLS-RLRQAINSIQQQSLVIESNYN 2889
               E   K+ N         E ++T    +    N L  +L +  N  + ++ +I+++ N
Sbjct: 1361 QAFEKERKLLN---------EGSSTITQEYSEKINMLEDQLNKLENENESKTRLIDTSKN 1411

Query: 2890 TEIDHA----NERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXX 3057
             E++ A    +E LEE   ++ S   ++     SY  KI N A    L     HE     
Sbjct: 1412 -ELEKATLSHDEILEEKRNEIKSMKDEIL----SYKEKI-NEANTKLLSTERDHES---- 1461

Query: 3058 XXXXXXXXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKL 3237
                           R+ + +E+  +     Q+S          E   K+  +EE +A  
Sbjct: 1462 ---------------RSNSLKEQLEAV----QESKA--------EVERKMNEMEEESAHY 1494

Query: 3238 IKEVENCTKVNETLSSQLADMQVKLEPLEQEINEL--KLKVAEKEQHLNICQEELERWKL 3411
              E+    ++ E L S + + + KLE L +   E   KLK   K   ++I + + E+  L
Sbjct: 1495 KSELNKSKEIVENLKSDIENNEKKLELLVESGKESDEKLKQYTKNSQIDIKELQNEKTDL 1554

Query: 3412 RSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKL---D 3582
             SQ I  + KI  EE H     K+K   E          +LT   ++++    EKL    
Sbjct: 1555 ESQIIEFKKKI--EELH----GKLKDEAESNSKTEAIQQELTSAHEKIRVNEEEKLLLNS 1608

Query: 3583 AAKTMQINLTTQINELNETKVNLE------KSLQQEIEKNNQSGNGAADESE-EIIRLRA 3741
              K ++ NL     E   TK   +      K L+Q++    Q      ++S+ EI +L+A
Sbjct: 1609 KLKDLECNLRDNQEEAQSTKEKNDSLNSHLKELEQKLTDAQQKAKECDEKSKMEIEQLQA 1668

Query: 3742 ELEKSNNFSNELEKKVED-----------AKKFKNEIESLKSELQS-VKAYENSTVNSKI 3885
            E  +S   + +LE K  D            +  K   +S K+E++  V+  E     +  
Sbjct: 1669 ETSQSQEKAKQLEIKYNDLATKEQAWQRNEEAIKRSTDSQKTEIERLVEELERLNSENAR 1728

Query: 3886 IKDLKESFKREKDELI 3933
            +K+  E+ + E D+L+
Sbjct: 1729 LKEANEN-RSEIDDLM 1743

 Score =  124 bits (310), Expect = 2e-27
 Identities = 185/921 (20%), Positives = 387/921 (42%), Gaps = 34/921 (3%)
 Frame = +1

Query: 292  KLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLT 471
            K + E +  F S+D L +++T     L+++  ++  L+A+       +E +K       +
Sbjct: 939  KELVEYKSRFQSHDNLVAKLT---EKLKSLANNYRDLQAKHESLMQSIEVTK-------S 988

Query: 472  ENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKL 651
            EN     Q+   + K DS+++E     TE + L   +K L+E    LE K +ET      
Sbjct: 989  ENDT---QLSNLQDKFDSLSREKESFQTEKEHLTDDIKELKETISRLEHKNEETTSR--- 1042

Query: 652  YSSAED-----ASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDN 816
            Y+SA+D      ++L++QL+  ++       +I+ L     +L   L+       DL   
Sbjct: 1043 YTSAKDDYESQINQLKEQLETATTTQDDNMDKISELSKNIRNLEMLLETCKSSKHDLQTK 1102

Query: 817  LNSSKQEFAKEITLKQRVNE---LLHNEIASYKKQIERLTS--KNLETPEKKIIQELVDL 981
            L +S++  A+    ++R+ E    L  E+ + KK++  L    ++LE   K  + ++ + 
Sbjct: 1103 LEASEKTLAEMHENEERLKEEKAQLEKEVVNTKKELSTLRENFESLEKEHKDSVTQVGEY 1162

Query: 982  KEKLVNSEKECNELKSTVD---KYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTL 1152
            ++++ +  KE NE  S ++   + I  + + L     N K  +E +++ L ++   +++ 
Sbjct: 1163 EKQITDKAKEYNENISKLNDDIRSIQQENEALCKNNDNLKGEVEQVKQTLEEQSNLREST 1222

Query: 1153 QRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKI 1332
               + + + +LE K    ++ K   S   +E+   T  + E  KE + +  E++ L++K+
Sbjct: 1223 VEALNTQIKDLEVKNQSSEA-KLSESVKNKEIE--TEKMIELQKECNSRKEEISELEEKL 1279

Query: 1333 SNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENT-----ENDT 1497
              +E  N   L    +L    + L +  +     +EK A L K     E       +  T
Sbjct: 1280 KTSEVENSHNLELLKELEEDKRELEIRTNEVKNQSEKIANLDKLREKTEAELCRLKKTST 1339

Query: 1498 DSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESA 1677
            D    + ++L   +N  +++ +                   ++++K L         E +
Sbjct: 1340 DEKSNLEEQLGKLRNEIKIKSQAF-----------------EKERKLLN--------EGS 1374

Query: 1678 KSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLT 1857
             + + +  + I  LE ++N +  E +S   L+                        +   
Sbjct: 1375 STITQEYSEKINMLEDQLNKLENENESKTRLI------------------------DTSK 1410

Query: 1858 NELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEK-----------HALNFDEMKDNN 2004
            NEL      H ++LEE  N+IK+++   L+ K ++ +           H    + +K+  
Sbjct: 1411 NELEKATLSHDEILEEKRNEIKSMKDEILSYKEKINEANTKLLSTERDHESRSNSLKEQL 1470

Query: 2005 NLLKEYVDKLENKIKTLEQDLA--ENELFE-KNLITGGVNNLEQS-KIIELSVAEQKISF 2172
              ++E   ++E K+  +E++ A  ++EL + K ++    +++E + K +EL V   K   
Sbjct: 1471 EAVQESKAEVERKMNEMEEESAHYKSELNKSKEIVENLKSDIENNEKKLELLVESGK--- 1527

Query: 2173 LDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAK 2352
              +    LK   KN +  I  +   K  L++++++ +  + E       + ++  K  A 
Sbjct: 1528 --ESDEKLKQYTKNSQIDIKELQNEKTDLESQIIEFKKKIEELHGKLKDEAESNSKTEAI 1585

Query: 2353 QQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLK-LE 2529
            QQ  T   +K+  VN+ +   L    L++L+   R  + E +  +E  D    SHLK LE
Sbjct: 1586 QQELTSAHEKIR-VNEEE-KLLLNSKLKDLECNLRDNQEEAQSTKEKND-SLNSHLKELE 1642

Query: 2530 NKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQ 2709
             K T  +   K+   K       L+ + S       QL+                 E ++
Sbjct: 1643 QKLTDAQQKAKECDEKSKMEIEQLQAETSQSQEKAKQLEIKYNDLATKEQAWQRNEEAIK 1702

Query: 2710 MAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYN 2889
             + +    +I   +  L+ +  EN   K+A ++ ++ +  L   +  + +++    S   
Sbjct: 1703 RSTDSQKTEIERLVEELERLNSENARLKEANEN-RSEIDDLMLLVTDLDEKNTKYRS--- 1758

Query: 2890 TEIDHANERLEEAEVKMASFD 2952
                    +LEE  V+ +S D
Sbjct: 1759 --------KLEELGVEFSSED 1771

 Score =  109 bits (273), Expect = 4e-23
 Identities = 190/941 (20%), Positives = 392/941 (41%), Gaps = 52/941 (5%)
 Frame = +1

Query: 304  EKQKEFDSNDALNSE--ITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTEN 477
            EK+ E  S+    +E  I  +  DL A+ R+   +E ++R  +   ++S     D   E 
Sbjct: 843  EKELETISSQKKKAEDGINKMGKDLFALSREKQAVEEKQRSLQKEKDKSN---SDHQKET 899

Query: 478  SALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYS 657
             +LK++I     ++ ++ + L    T++  L    + +           KE  + K  + 
Sbjct: 900  KSLKDEITKKIIEIKTLNENLVKTKTQHSALSEEKEQIS----------KELVEYKSRFQ 949

Query: 658  SAED-ASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQ 834
            S ++  ++L ++L+ +++    L+++  +L    E   ++   +L  ++D  D+L+  K+
Sbjct: 950  SHDNLVAKLTEKLKSLANNYRDLQAKHESLMQSIEVTKSENDTQLSNLQDKFDSLSREKE 1009

Query: 835  EFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKEC 1014
             F  E        E L ++I   K+ I RL  KN ET  +    +  D  E  +N  KE 
Sbjct: 1010 SFQTE-------KEHLTDDIKELKETISRLEHKNEETTSRYTSAK--DDYESQINQLKEQ 1060

Query: 1015 NELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQK 1194
             E  +T       D    IS+     + +E+L       K    T     E  L E+ + 
Sbjct: 1061 LETATTTQD----DNMDKISELSKNIRNLEMLLETCKSSKHDLQTKLEASEKTLAEMHEN 1116

Query: 1195 LPMIDSFKERNSSLERELLRITSSLEETAK-----ERDIKD---------RELTNLQKKI 1332
                +  KE  + LE+E++     L    +     E++ KD         +++T+  K+ 
Sbjct: 1117 E---ERLKEEKAQLEKEVVNTKKELSTLRENFESLEKEHKDSVTQVGEYEKQITDKAKEY 1173

Query: 1333 SNN-----------EQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNE 1479
            + N           +Q N+ L +   +L  +V+ +   ++ +S   E     +   + + 
Sbjct: 1174 NENISKLNDDIRSIQQENEALCKNNDNLKGEVEQVKQTLEEQSNLRESTVEALNTQIKDL 1233

Query: 1480 NTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNN 1659
              +N +   K+           KE++ + M                 +E+ KT  + +N+
Sbjct: 1234 EVKNQSSEAKLSES-----VKNKEIETEKMIELQKECNSRKEEISELEEKLKTSEV-ENS 1287

Query: 1660 KIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCEL 1839
              +E  K    +LE+  + LE + N +  + +    L                    C L
Sbjct: 1288 HNLELLK----ELEEDKRELEIRTNEVKNQSEKIANL---------DKLREKTEAELCRL 1334

Query: 1840 EKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKE 2019
            +K   T+E S++++Q  K+  E++ K +  +K +   K+  E  +    E  +  N+L++
Sbjct: 1335 KKTS-TDEKSNLEEQLGKLRNEIKIKSQAFEKER---KLLNEGSSTITQEYSEKINMLED 1390

Query: 2020 YVDKLENK--IKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDK-EIS 2190
             ++KLEN+   KT   D ++NEL +  L    +  LE+ +    S+ ++ +S+ +K   +
Sbjct: 1391 QLNKLENENESKTRLIDTSKNELEKATLSHDEI--LEEKRNEIKSMKDEILSYKEKINEA 1448

Query: 2191 NLK---------SKNKNLEDKILTMTLSKNLLDNKVLQLETSLS--ERELPKNTQIKNEE 2337
            N K         S++ +L++++  +  SK  ++ K+ ++E   +  + EL K+ +I    
Sbjct: 1449 NTKLLSTERDHESRSNSLKEQLEAVQESKAEVERKMNEMEEESAHYKSELNKSKEIVENL 1508

Query: 2338 KEPAKQQTYTFERKKLESVNDSDISYLYYE-----NLEELQNQFRTLRRELKEVQ---ED 2493
            K   +      E   +ES  +SD     Y      +++ELQN+   L  ++ E +   E+
Sbjct: 1509 KSDIENNEKKLELL-VESGKESDEKLKQYTKNSQIDIKELQNEKTDLESQIIEFKKKIEE 1567

Query: 2494 LDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXX 2673
            L  K +   +  +K   ++ +L  A  K+       E++   L + +  L+         
Sbjct: 1568 LHGKLKDEAESNSKTEAIQQELTSAHEKIR----VNEEEKLLLNSKLKDLE--------- 1614

Query: 2674 XXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSI 2853
                    E+ Q  + +N    ++   L Q + +     K+  +  K  + +L+   +  
Sbjct: 1615 -CNLRDNQEEAQSTKEKNDSLNSHLKELEQKLTDAQQKAKECDEKSKMEIEQLQAETSQS 1673

Query: 2854 QQQSLVIESNYN--TEIDHANERLEEAEVKMASFDGKVTEI 2970
            Q+++  +E  YN     + A +R EEA  +  S D + TEI
Sbjct: 1674 QEKAKQLEIKYNDLATKEQAWQRNEEAIKR--STDSQKTEI 1712

 Score =  106 bits (264), Expect = 5e-22
 Identities = 264/1346 (19%), Positives = 529/1346 (39%), Gaps = 75/1346 (5%)
 Frame = +1

Query: 595  ENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIV----SSEI------LSLKSEIATL 744
            E N   E   +E   N++  S A D + L+  L  V     +E+      L   ++I   
Sbjct: 460  EENDTSEKADEEESANEETISGATDGNLLKANLFEVLLNYDTELNLNPFKLFFTTDIFMF 519

Query: 745  KYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEI--ASYKKQIE 918
             +  +  S++  R++ R     +NL+   +E  K I   Q ++ELL   +  A  +  I 
Sbjct: 520  LFQQDHKSSEELREITRNVTTGNNLDD--EEPLKAI---QTISELLTTSLTAADIRIPIS 574

Query: 919  RLT-----------SKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKK 1065
             LT           + N    +K +I+ L+    ++   + E   +K  V   + +  + 
Sbjct: 575  YLTFLIYWLFGDFKATNDFLSDKSVIKSLLSFSYQI---QDEDITIKCLVTMLLGVAYEF 631

Query: 1066 LISKFGNPKK-LIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLER 1242
               +   P+K   E + + L K+       Q + +SF  E++Q    I + +   + L +
Sbjct: 632  SSKESPFPRKEYFEFVTKSLGKDNYASRIKQFKKDSFFSEIDQNEDSILTPELDETGLPK 691

Query: 1243 -------------ELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDL 1383
                          + RI ++L     E  I          KIS  E   +EL +Q + L
Sbjct: 692  VYFSAYFIHLFNENMYRIRTALSHNPDEEPIS---------KISFEEV--EELQKQCAKL 740

Query: 1384 AHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQK 1563
              ++  L      ++  T ++ T     +S E+ E       + S  +   +NV  L+ +
Sbjct: 741  KSELGSL----QTETKTTNEDLTEKLGTLSKEHEELVEKYQSLTSSHMSLKENVSSLEIE 796

Query: 1564 NMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIIS 1743
                              E + +      DN+  ++  KST    E+ I+TLE ++  IS
Sbjct: 797  LKSITESLNEMTKLRDALETKDK------DNSFALQEYKSTIHKQEEAIRTLEKELETIS 850

Query: 1744 QER----DSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTN----ELSSMKQQHVKVL 1899
             ++    D    +                     + EK++  +    E  S+K +  K +
Sbjct: 851  SQKKKAEDGINKMGKDLFALSREKQAVEEKQRSLQKEKDKSNSDHQKETKSLKDEITKKI 910

Query: 1900 EEL----ENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDL 2067
             E+    EN +KT  +    S+ E E+ +    E K         V KL  K+K+L  + 
Sbjct: 911  IEIKTLNENLVKTKTQHSALSE-EKEQISKELVEYKSRFQSHDNLVAKLTEKLKSLANNY 969

Query: 2068 AENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLS 2247
             + +   ++L+   +   +     +LS  + K   L +E  + +++ ++L D I  +  +
Sbjct: 970  RDLQAKHESLMQ-SIEVTKSENDTQLSNLQDKFDSLSREKESFQTEKEHLTDDIKELKET 1028

Query: 2248 KNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYE 2427
             + L++K  +  +  +  +    +QI N+ KE  +  T T +   ++ +++   +    E
Sbjct: 1029 ISRLEHKNEETTSRYTSAKDDYESQI-NQLKEQLETAT-TTQDDNMDKISELSKNIRNLE 1086

Query: 2428 NL--------EELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLA 2583
             L         +LQ +     + L E+ E+ +   E   +LE +    K +L      L 
Sbjct: 1087 MLLETCKSSKHDLQTKLEASEKTLAEMHENEERLKEEKAQLEKEVVNTKKELS----TLR 1142

Query: 2584 SVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQ 2763
              + +LE+++      V + +                T+K +   NEN  K+N+ I  +Q
Sbjct: 1143 ENFESLEKEHKDSVTQVGEYE-------------KQITDKAK-EYNENISKLNDDIRSIQ 1188

Query: 2764 TMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMA 2943
               +EN        + K  + +++Q   ++++QS + ES     ++  N ++++ EVK  
Sbjct: 1189 ---QENEALCKNNDNLKGEVEQVKQ---TLEEQSNLREST----VEALNTQIKDLEVKNQ 1238

Query: 2944 SFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPRE 3123
            S + K++E +                                             KN   
Sbjct: 1239 SSEAKLSESV---------------------------------------------KNKEI 1253

Query: 3124 KFPSFVKIDQQSXXXXXXXXVMENTTKLLALEES-NAKLIKEVENCTKVNETLSSQLADM 3300
            +    +++ ++          +E   K   +E S N +L+KE+E   +  E  ++++ + 
Sbjct: 1254 ETEKMIELQKECNSRKEEISELEEKLKTSEVENSHNLELLKELEEDKRELEIRTNEVKNQ 1313

Query: 3301 QVKLEPLEQ-----EINELKLKVAEKEQHLNICQEELERW----KLRSQTILQQGKIVEE 3453
              K+  L++     E    +LK    ++  N+ +E+L +     K++SQ   ++ K++ E
Sbjct: 1314 SEKIANLDKLREKTEAELCRLKKTSTDEKSNL-EEQLGKLRNEIKIKSQAFEKERKLLNE 1372

Query: 3454 EAH---MKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQIN 3624
             +     +  EKI  LE+QL  +  EN   T   D  K +  +            T   +
Sbjct: 1373 GSSTITQEYSEKINMLEDQLNKLENENESKTRLIDTSKNELEK-----------ATLSHD 1421

Query: 3625 ELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKK 3804
            E+ E K N  KS++ EI    +  N      E   +L +      + SN L++++E  ++
Sbjct: 1422 EILEEKRNEIKSMKDEILSYKEKIN------EANTKLLSTERDHESRSNSLKEQLEAVQE 1475

Query: 3805 FKNEIESLKSELQSVKAYENSTVN--SKIIKDLKESFKREKDELIEQMXXXXXXXXXXXX 3978
             K E+E   +E++   A+  S +N   +I+++LK   +  + +L   +            
Sbjct: 1476 SKAEVERKMNEMEEESAHYKSELNKSKEIVENLKSDIENNEKKLELLVESGKESDEKLKQ 1535

Query: 3979 XTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEAEENLKKRMRLPSEEKIN 4158
             T  +Q     L N  E  ++             L  K   EAE N K       ++++ 
Sbjct: 1536 YTKNSQIDIKELQN--EKTDLESQIIEFKKKIEELHGKLKDEAESNSKTE---AIQQELT 1590

Query: 4159 AVIEKRRKVLEQE---FETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKA 4329
            +  EK R V E+E     +KL++L  N   N       AQ  KE  +  N  L E+++K 
Sbjct: 1591 SAHEKIR-VNEEEKLLLNSKLKDLECNLRDN----QEEAQSTKEKNDSLNSHLKELEQK- 1644

Query: 4330 FEEGKQQSMMKSTLLERKLSKLESQT 4407
              + +Q++       + ++ +L+++T
Sbjct: 1645 LTDAQQKAKECDEKSKMEIEQLQAET 1670

 Score =  103 bits (257), Expect = 3e-21
 Identities = 209/1091 (19%), Positives = 441/1091 (40%), Gaps = 63/1091 (5%)
 Frame = +1

Query: 859  KQRVNELLHNEIASYKKQIERLTSK--NLETPEKKIIQELVDLKEKLVNSEKECNELKST 1032
            ++ ++++   E+   +KQ  +L S+  +L+T E K   E  DL EKL    KE  EL   
Sbjct: 719  EEPISKISFEEVEELQKQCAKLKSELGSLQT-ETKTTNE--DLTEKLGTLSKEHEEL--- 772

Query: 1033 VDKYINIDEKKLISKFGNPKKLIEI--LRRQLVKEKRHKDTLQRQVESFLVELEQKLPMI 1206
            V+KY ++    +  K       IE+  +   L +  + +D L+ + +     L++    I
Sbjct: 773  VEKYQSLTSSHMSLKENVSSLEIELKSITESLNEMTKLRDALETKDKDNSFALQEYKSTI 832

Query: 1207 DSFKERNSSLERELLRITSSLE--ETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSD 1380
               +E   +LE+EL  I+S  +  E    +  KD    + +K+    +Q + +  + +S+
Sbjct: 833  HKQEEAIRTLEKELETISSQKKKAEDGINKMGKDLFALSREKQAVEEKQRSLQKEKDKSN 892

Query: 1381 LAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQ 1560
              HQ +   L    K   T+K   +++    NEN       H  +S+        KE   
Sbjct: 893  SDHQKETKSL----KDEITKK---IIEIKTLNENLVKTKTQHSALSEE-------KEQIS 938

Query: 1561 KNMXXXXXXXXXXXXXXXXEQEQQKTLRIT------DNNKIVESAKSTSVDLEKHIKTLE 1722
            K +                  E+ K+L          +  +++S + T  + +  +  L+
Sbjct: 939  KELVEYKSRFQSHDNLVAKLTEKLKSLANNYRDLQAKHESLMQSIEVTKSENDTQLSNLQ 998

Query: 1723 SKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLE 1902
             K + +S+E++S++                       E + E  T+  +S K  +   + 
Sbjct: 999  DKFDSLSREKESFQT---EKEHLTDDIKELKETISRLEHKNEETTSRYTSAKDDYESQIN 1055

Query: 1903 ELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENEL 2082
            +L+ +++T   +Q  +  ++ + + N   ++      K     L+ K++  E+ LAE   
Sbjct: 1056 QLKEQLETATTTQDDNMDKISELSKNIRNLEMLLETCKSSKHDLQTKLEASEKTLAEMHE 1115

Query: 2083 FEKNLITGGVNNLEQSKII---ELSVAEQKISFLDKE----ISNLKSKNKNLEDKILTMT 2241
             E+ L       LE+  +    ELS   +    L+KE    ++ +    K + DK     
Sbjct: 1116 NEERLKEEKAQ-LEKEVVNTKKELSTLRENFESLEKEHKDSVTQVGEYEKQITDKAKEYN 1174

Query: 2242 LSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLY 2421
             + + L++ +  ++       L KN      E E  KQ   T E +   ++ +S +  L 
Sbjct: 1175 ENISKLNDDIRSIQQE--NEALCKNNDNLKGEVEQVKQ---TLEEQS--NLRESTVEALN 1227

Query: 2422 YENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTL 2601
             + +++L+ + ++   +L E  ++ +++TE  ++L+ +    K ++ +   KL     T 
Sbjct: 1228 TQ-IKDLEVKNQSSEAKLSESVKNKEIETEKMIELQKECNSRKEEISELEEKLK----TS 1282

Query: 2602 EQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEEN 2781
            E +NS     + +L+                +EK+   +    +       L +T  +E 
Sbjct: 1283 EVENSHNLELLKELEEDKRELEIRTNEVKNQSEKIANLDKLREKTEAELCRLKKTSTDEK 1342

Query: 2782 TTFKDAFKHFKNSLSRLRQAINS----IQQQSLVIESNYNTEIDHANERLEEAEVKMASF 2949
            +  ++     +N +    QA       + + S  I   Y+ +I+   ++L + E +  S 
Sbjct: 1343 SNLEEQLGKLRNEIKIKSQAFEKERKLLNEGSSTITQEYSEKINMLEDQLNKLENENES- 1401

Query: 2950 DGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXXXXRRARYRNKNPREKF 3129
                T ++++   + L  A + H    ++ EK                 R   K+ +++ 
Sbjct: 1402 ---KTRLIDTSKNE-LEKATLSH--DEILEEK-----------------RNEIKSMKDEI 1438

Query: 3130 PSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVK 3309
             S+ +                       + E+N KL+    +    + +L  QL  +Q  
Sbjct: 1439 LSYKE----------------------KINEANTKLLSTERDHESRSNSLKEQLEAVQES 1476

Query: 3310 LEPLEQEINELKLKVAEKEQHLNICQE-------ELERWKLRSQTILQQGKIVEEEAHMK 3468
               +E+++NE++ + A  +  LN  +E       ++E  + + + +++ GK  E +  +K
Sbjct: 1477 KAEVERKMNEMEEESAHYKSELNKSKEIVENLKSDIENNEKKLELLVESGK--ESDEKLK 1534

Query: 3469 SLEKIKTLE-EQLETVRTENAQLTDRFDRLKKQAHEKL-------DAAKTMQINLTTQIN 3624
               K   ++ ++L+  +T+       F +  ++ H KL          + +Q  LT+   
Sbjct: 1535 QYTKNSQIDIKELQNEKTDLESQIIEFKKKIEELHGKLKDEAESNSKTEAIQQELTSAHE 1594

Query: 3625 EL--NETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDA 3798
            ++  NE +  L  S  +++E N        D  EE    + + +  N+   ELE+K+ DA
Sbjct: 1595 KIRVNEEEKLLLNSKLKDLECN------LRDNQEEAQSTKEKNDSLNSHLKELEQKLTDA 1648

Query: 3799 --------KKFKNEIESLKSELQ---------SVKAYENSTV------NSKIIKDLKESF 3909
                    +K K EIE L++E            +K  + +T       N + IK   +S 
Sbjct: 1649 QQKAKECDEKSKMEIEQLQAETSQSQEKAKQLEIKYNDLATKEQAWQRNEEAIKRSTDSQ 1708

Query: 3910 KREKDELIEQM 3942
            K E + L+E++
Sbjct: 1709 KTEIERLVEEL 1719

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 176/908 (19%), Positives = 357/908 (39%), Gaps = 48/908 (5%)
 Frame = +1

Query: 1870 SMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDN-NNLLKEYVDKLENKI 2046
            S K+      E  E   K+L K    S+++  K    F E+  N +++L   +D  E  +
Sbjct: 632  SSKESPFPRKEYFEFVTKSLGKDNYASRIKQFKKDSFFSEIDQNEDSILTPELD--ETGL 689

Query: 2047 KTLEQDLAENELFEKNLI---TGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSK---- 2205
              +        LF +N+    T   +N ++  I ++S  E  +  L K+ + LKS+    
Sbjct: 690  PKVYFSAYFIHLFNENMYRIRTALSHNPDEEPISKISFEE--VEELQKQCAKLKSELGSL 747

Query: 2206 -------NKNLEDKILTMTLSKNLLDNKVLQLETS-LSERELPKNTQIKNEE-KEPAKQQ 2358
                   N++L +K+ T++     L  K   L +S +S +E   + +I+ +   E   + 
Sbjct: 748  QTETKTTNEDLTEKLGTLSKEHEELVEKYQSLTSSHMSLKENVSSLEIELKSITESLNEM 807

Query: 2359 TYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKY 2538
            T   +  + +  ++S     Y   + + +   RTL +EL+ +        +   K+    
Sbjct: 808  TKLRDALETKDKDNSFALQEYKSTIHKQEEAIRTLEKELETISSQKKKAEDGINKMGKDL 867

Query: 2539 TKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAE 2718
              +  + +    K  S+    ++ NS        L+                  K +   
Sbjct: 868  FALSREKQAVEEKQRSLQKEKDKSNSDHQKETKSLKDEITKKIIEIKTLNENLVKTKTQH 927

Query: 2719 NENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEI 2898
            +  SE+        + + +E   +K  F+   N +++L + + S+        +NY    
Sbjct: 928  SALSEE-------KEQISKELVEYKSRFQSHDNLVAKLTEKLKSLA-------NNYRDLQ 973

Query: 2899 DHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXX 3078
                  ++  EV  +  D +++ + + +D       ++     S   EK+          
Sbjct: 974  AKHESLMQSIEVTKSENDTQLSNLQDKFD-------SLSREKESFQTEKEHLTDDIKELK 1026

Query: 3079 XXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENC 3258
                R  ++N+    ++ S  K D +S        +   TT      +  ++L K + N 
Sbjct: 1027 ETISRLEHKNEETTSRYTS-AKDDYESQINQLKEQLETATTTQDDNMDKISELSKNIRNL 1085

Query: 3259 TKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQG 3438
              + ET  S   D+Q KLE  E+ + E+     E E+ L                     
Sbjct: 1086 EMLLETCKSSKHDLQTKLEASEKTLAEMH----ENEERLK-------------------- 1121

Query: 3439 KIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQ 3618
               EE+A          LE+++   + E + L + F+ L+K+  + +      +  +T +
Sbjct: 1122 ---EEKAQ---------LEKEVVNTKKELSTLRENFESLEKEHKDSVTQVGEYEKQITDK 1169

Query: 3619 INELNE--TKVNLE-KSLQQEIE---KNNQSGNGAADESEEIIRLRAELEKSNNFSNELE 3780
              E NE  +K+N + +S+QQE E   KNN +  G  ++ ++ +  ++ L +S      L 
Sbjct: 1170 AKEYNENISKLNDDIRSIQQENEALCKNNDNLKGEVEQVKQTLEEQSNLREST--VEALN 1227

Query: 3781 KKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDEL---------- 3930
             +++D      E+++  SE +  ++ +N  + ++ + +L++     K+E+          
Sbjct: 1228 TQIKDL-----EVKNQSSEAKLSESVKNKEIETEKMIELQKECNSRKEEISELEEKLKTS 1282

Query: 3931 -IEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXXXXALILKRITEA 4107
             +E                 L  R N +    ++ AN+             L  K  T+ 
Sbjct: 1283 EVENSHNLELLKELEEDKRELEIRTNEVKNQSEKIANLDKLREKTEAELCRL-KKTSTDE 1341

Query: 4108 EENLKKRM-RLPSEEKINA-VIEKRRKVLE-------QEFETKLREL--GLNADGNGVVT 4254
            + NL++++ +L +E KI +   EK RK+L        QE+  K+  L   LN   N   +
Sbjct: 1342 KSNLEEQLGKLRNEIKIKSQAFEKERKLLNEGSSTITQEYSEKINMLEDQLNKLENENES 1401

Query: 4255 DTR-AQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLL--ERKLSKLESQTLSPTKN 4425
             TR     K   EK  L   EI ++   E K    MK  +L  + K+++  ++ LS  ++
Sbjct: 1402 KTRLIDTSKNELEKATLSHDEILEEKRNEIKS---MKDEILSYKEKINEANTKLLSTERD 1458

Query: 4426 NDSNETQV 4449
            ++S    +
Sbjct: 1459 HESRSNSL 1466

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 82/373 (21%), Positives = 158/373 (42%), Gaps = 15/373 (4%)
 Frame = +1

Query: 286  REKLVSEKQKEFDSNDAL-------NSEITLIKYDLEAMQRDHTTLEARERKTENVLEQS 444
            +++++S K+K  ++N  L        S    +K  LEA+Q     +E +  + E      
Sbjct: 1435 KDEILSYKEKINEANTKLLSTERDHESRSNSLKEQLEAVQESKAEVERKMNEMEEESAHY 1494

Query: 445  KLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTE----NKKLQTGMKLLRENNLYL 612
            K EL  S      LK  I   E KL+ + +    ++ +     K  Q  +K L+     L
Sbjct: 1495 KSELNKSKEIVENLKSDIENNEKKLELLVESGKESDEKLKQYTKNSQIDIKELQNEKTDL 1554

Query: 613  EIKCKETDKN-KKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKL 789
            E +  E  K  ++L+   +D +    + + +  E+ S   +I     +NE     L  KL
Sbjct: 1555 ESQIIEFKKKIEELHGKLKDEAESNSKTEAIQQELTSAHEKIR----VNEEEKLLLNSKL 1610

Query: 790  FRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQE 969
               KDL+ NL  +++E        +  N+ L++ +   ++++     K  E  EK  + E
Sbjct: 1611 ---KDLECNLRDNQEEAQS----TKEKNDSLNSHLKELEQKLTDAQQKAKECDEKSKM-E 1662

Query: 970  LVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDT 1149
            +  L+ +   S+++  +L+    KY ++  K+            +  +R     KR  D+
Sbjct: 1663 IEQLQAETSQSQEKAKQLEI---KYNDLATKE------------QAWQRNEEAIKRSTDS 1707

Query: 1150 LQRQVESFLVELEQKLPMIDSFKERN---SSLERELLRITSSLEETAKERDIKDRELTNL 1320
             + ++E  + ELE+        KE N   S ++  +L +T   E+  K R     +L  L
Sbjct: 1708 QKTEIERLVEELERLNSENARLKEANENRSEIDDLMLLVTDLDEKNTKYRS----KLEEL 1763

Query: 1321 QKKISNNEQFNDE 1359
              + S+ ++  DE
Sbjct: 1764 GVEFSSEDEDEDE 1776

>KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa]
            {ON} similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 1712

 Score =  124 bits (310), Expect = 2e-27
 Identities = 232/1180 (19%), Positives = 483/1180 (40%), Gaps = 79/1180 (6%)
 Frame = +1

Query: 421  TENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLREN 600
            TEN L  S  E++  L  +S   +  G+ +    S  ++L   N    ++QT MK   + 
Sbjct: 636  TENSLFTSSREMKGVL--DSVETDVTGLPKIYFSSYFKKLLRNNLY--RIQTAMKRGPDF 691

Query: 601  NLYLEIKCKETDKNKKLYSSAEDA-----SRLQDQLQIVSSEILSLKSEIATLKYMNESL 765
             +  ++  +  +K  +  +  E+A        + Q++ ++  +  L+  + + +   ++ 
Sbjct: 692  QIKDKVSFESLEKLIQQKTQLEEALLKSEESSKGQIEDLNRSLEELQKALKSTEDEKKAA 751

Query: 766  STDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELL---HNEIASYKKQIERLTSKN 936
              DL+      K+L+DN + +K+    E+ L Q+ N  L   +++I + KK +E   + N
Sbjct: 752  ELDLENVRASFKNLEDNYSGTKE----ELNLLQKENSDLVATNSKIENTKKDLELKFNNN 807

Query: 937  LET------------PEKKIIQELVD-LKEKLVNSEKECNELKSTVDKYINIDEKKLISK 1077
             +              +KK  ++ ++ +  +L+   +E NELK+T  K  N  EK L + 
Sbjct: 808  RDALTKLEKELSIVCEQKKAAEDGINKMNRELLVLSREHNELKNTSTKSKNELEKVLAAS 867

Query: 1078 FGNPKKLIEILRRQ---LVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLEREL 1248
                K+L +  R +   + K +   + L+ + ++ L+E +         K R ++ E  +
Sbjct: 868  NEELKRLQDFTREKDSSIEKSRAELERLKSENKALLLEKDNASRNSAELKSRLANQELLV 927

Query: 1249 LRITSSLEETA-KERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAH-QVQYLLLCIDN 1422
             ++T+ L++ A K + I+  + +   +    +E    ++L  +S++   + QY  +  D 
Sbjct: 928  SKLTTKLKDIAEKYKSIEQAKASKEHELAEVSESNQTKILSLQSEIVELRQQYDSMKHDK 987

Query: 1423 KSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXX 1602
             +  TE +   +KK + +        +++I   +     + KE++Q N            
Sbjct: 988  DNMLTETKK--LKKSLEDAERSRSEAAYEIKQLKSELDHSSKEIEQLNSSSEEKSKNLAD 1045

Query: 1603 XXXXXEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXX 1782
                  + + +   +   NK +  A       E  I++LE K+  + +  D     +   
Sbjct: 1046 AVNTFNKARNE---LESLNKTLAEANDKLRSRESTIESLEEKLQELKKSSDE---KIASL 1099

Query: 1783 XXXXXXXXXXXXXXXXCELEKERLTNELSSM-------KQQHVKVLEELENKIKTLQKSQ 1941
                             ELEK +  + L+ +       K  H + L+  ++KIK L    
Sbjct: 1100 EKSRKDLEKFQQKFRDLELEKSKTQDALTDLQKALQDEKNNHQESLQLQKDKIKQL---- 1155

Query: 1942 LTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAE--NELFEKNLITGGVN 2115
                +E E  A + + +K   + L++ V+ L    K + +D  +  +EL +K +     +
Sbjct: 1156 ---ALEKENSAESTEALKSEVSKLRQTVEDLNKSHKLVHEDYEKKVSELKKKTVSLQDES 1212

Query: 2116 NLEQSKI----IELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLE 2283
            +L   ++     EL     +   L+++ ++LK K+KN+ ++I +    +   D+++L L+
Sbjct: 1213 SLRLQEVSALNTELEETRSRAEKLEEQATDLKEKHKNICNEIKSKVKQEKEKDSRILVLD 1272

Query: 2284 TSLSE-----RELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQN 2448
              +        ++    +  N E    ++    FE ++LE               E+   
Sbjct: 1273 KEMKSAKTDLSDIVHKLEASNSEIAKLQEIKAEFESQELEGKKQK----------EDFDA 1322

Query: 2449 QFRTLRRELK----EVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNS 2616
            + +TLR +LK    EV+++  M  E    LE +Y++  + L++    L S ++   Q++ 
Sbjct: 1323 EIKTLRAKLKEKSAEVEKERKMLNEGSSNLEQEYSRKISQLEEELESLESKHSLKHQESD 1382

Query: 2617 FLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLLQTMVEENTTFKD 2796
               N   +L G                  L+ +E+  +EK                    
Sbjct: 1383 ---NEKRKLSGL-----------------LKKSESSATEK------------------NR 1404

Query: 2797 AFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDH-------ANERLEEAEVKMASFDG 2955
              +  + S+ +LR+++   +QQS  + S   T+ D        AN++LEEA  K      
Sbjct: 1405 ELECVRESMKKLRESLKDKEQQSEQLSSLQKTQSDKMREELGLANQKLEEAREKGRKHKE 1464

Query: 2956 KVTEIL--ESYDGKILNTAAIGHLVR-----SLIHEKKMXXXXXXXXXXXXRRARYRNKN 3114
             +   L  ++ + K L   A+ +L +     ++I+E K+              A+  +  
Sbjct: 1465 NLEVALSQKASEVKKLKDQALNYLSKLDEKEAIINESKV----------QLETAKRDSDE 1514

Query: 3115 PREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLA 3294
             +    S +K  Q++          EN    L LE   +K   EV N  +++E       
Sbjct: 1515 LKSSMDSKIKKSQETLSK------AENERDQLRLELDLSKEKLEVNN-QRLHE------- 1560

Query: 3295 DMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQ----GKIVEEEAH 3462
                 L+  E ++ +LK+ +      L+  +     ++ RS+++ Q+       ++E A 
Sbjct: 1561 -----LDATEAQLKDLKMTIENNLHLLSNSEAAKRNYEARSKSLAQECEKVSSTLKEVAS 1615

Query: 3463 MKS--LEKIKTLEEQLET-----------VRTENAQLTDRFDRLKKQAHEKLDAAKTMQI 3603
             K     K++T E  L T             TE  +L D   +LKKQA ++ +    M  
Sbjct: 1616 QKDEVESKLRTSENALSTHAKKIAETELQQNTEVKRLEDEIAKLKKQAEDRSEVDDLML- 1674

Query: 3604 NLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEE 3723
             L T+++E N+   N  K+L  +   + +  +   DE +E
Sbjct: 1675 -LVTELDEKNQKYRNKLKALGADFSSDEE--DEEEDEEDE 1711

 Score =  105 bits (263), Expect = 6e-22
 Identities = 210/946 (22%), Positives = 376/946 (39%), Gaps = 69/946 (7%)
 Frame = +1

Query: 310  QKEFDSNDALNSEITLIKYDLE-AMQRDHTTLEARERKTENVLEQSKL----------EL 456
            QKE     A NS+I   K DLE     +   L   E++   V EQ K           EL
Sbjct: 780  QKENSDLVATNSKIENTKKDLELKFNNNRDALTKLEKELSIVCEQKKAAEDGINKMNREL 839

Query: 457  QDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETD 636
                 E++ LK      + +L+ +   L  +N E K+LQ      RE +  +E    E +
Sbjct: 840  LVLSREHNELKNTSTKSKNELEKV---LAASNEELKRLQ---DFTREKDSSIEKSRAELE 893

Query: 637  K----NKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKD 804
            +    NK L    ++ASR              LKS +A  + +   L+T L+    + K 
Sbjct: 894  RLKSENKALLLEKDNASR----------NSAELKSRLANQELLVSKLTTKLKDIAEKYKS 943

Query: 805  LDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERL--TSKNLETPEKKIIQELVD 978
            ++    S + E A+     Q     L +EI   ++Q + +     N+ T  KK+ + L D
Sbjct: 944  IEQAKASKEHELAEVSESNQTKILSLQSEIVELRQQYDSMKHDKDNMLTETKKLKKSLED 1003

Query: 979  --------------LKEKLVNSEKECNEL-KSTVDKYINIDEKKLISKFGNPKKLIEILR 1113
                          LK +L +S KE  +L  S+ +K  N+ +   ++ F   +  +E L 
Sbjct: 1004 AERSRSEAAYEIKQLKSELDHSSKEIEQLNSSSEEKSKNLAD--AVNTFNKARNELESLN 1061

Query: 1114 RQLVKEKRHKDTLQRQVESFLVELEQKLPMI-DSFKERNSSLE---RELLRITSSLEETA 1281
            + L +     D L R  ES +  LE+KL  +  S  E+ +SLE   ++L +      +  
Sbjct: 1062 KTLAEA---NDKL-RSRESTIESLEEKLQELKKSSDEKIASLEKSRKDLEKFQQKFRDLE 1117

Query: 1282 KERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVK 1461
             E+      LT+LQK + + +  + E L+ + D   +++ L L  +N +  TE   + V 
Sbjct: 1118 LEKSKTQDALTDLQKALQDEKNNHQESLQLQKD---KIKQLALEKENSAESTEALKSEVS 1174

Query: 1462 KIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTL 1641
            K+   +  E+   SHK++ +   + + V EL++K +                  E ++T 
Sbjct: 1175 KL--RQTVEDLNKSHKLVHED--YEKKVSELKKKTVSLQDESSLRLQEVSALNTELEET- 1229

Query: 1642 RITDNNKIVESAKSTSVDL-EKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXX 1818
                     E  +  + DL EKH        + + QE++    ++               
Sbjct: 1230 -----RSRAEKLEEQATDLKEKHKNICNEIKSKVKQEKEKDSRILVLDKEMKSAKTDLSD 1284

Query: 1819 XXXXCELEKERLTN------ELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALN 1980
                 E     +        E  S + +  K  E+ + +IKTL+        EVEK    
Sbjct: 1285 IVHKLEASNSEIAKLQEIKAEFESQELEGKKQKEDFDAEIKTLRAKLKEKSAEVEKERKM 1344

Query: 1981 FDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQ 2160
             +E   ++NL +EY      KI  LE++L    L  K+ +    ++ E+ K+  L     
Sbjct: 1345 LNE--GSSNLEQEY----SRKISQLEEEL--ESLESKHSLKHQESDNEKRKLSGL----- 1391

Query: 2161 KISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLE--TSLSERELPKNTQ---I 2325
                L K  S+   KN+ LE    +M   +  L +K  Q E  +SL + +  K  +   +
Sbjct: 1392 ----LKKSESSATEKNRELECVRESMKKLRESLKDKEQQSEQLSSLQKTQSDKMREELGL 1447

Query: 2326 KNEEKEPAKQQ----------TYTFERKKLESVNDSDISYLYYEN-----LEELQNQFRT 2460
             N++ E A+++            + +  +++ + D  ++YL   +     + E + Q  T
Sbjct: 1448 ANQKLEEAREKGRKHKENLEVALSQKASEVKKLKDQALNYLSKLDEKEAIINESKVQLET 1507

Query: 2461 LRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQ 2640
             +R+  E++  +D K +   K +   +K +N+  Q   +L      LE  N        +
Sbjct: 1508 AKRDSDELKSSMDSKIK---KSQETLSKAENERDQLRLELDLSKEKLEVNN-------QR 1557

Query: 2641 LQGXXXXXXXXXXXXXXXTEKLQMAENENSEKIN---NAIVLLQTMVEENTTFKDAFKHF 2811
            L                    L +  N  + K N    +  L Q   + ++T K+     
Sbjct: 1558 LHELDATEAQLKDLKMTIENNLHLLSNSEAAKRNYEARSKSLAQECEKVSSTLKEVASQK 1617

Query: 2812 KNSLSRLRQAINSIQQQSLVI---ESNYNTEIDHANERLEEAEVKM 2940
                S+LR + N++   +  I   E   NTE+    +RLE+   K+
Sbjct: 1618 DEVESKLRTSENALSTHAKKIAETELQQNTEV----KRLEDEIAKL 1659

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 184/890 (20%), Positives = 361/890 (40%), Gaps = 37/890 (4%)
 Frame = +1

Query: 1834 ELEKERLTNELSSMKQQHV--KVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNN 2007
            +LE+  L +E SS  Q     + LEEL+  +K+ +  +  +++++E    +F  ++DN +
Sbjct: 711  QLEEALLKSEESSKGQIEDLNRSLEELQKALKSTEDEKKAAELDLENVRASFKNLEDNYS 770

Query: 2008 LLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEI 2187
              KE ++ L+ +   L    ++ E  +K+L     NN +             ++ L+KE+
Sbjct: 771  GTKEELNLLQKENSDLVATNSKIENTKKDLELKFNNNRDA------------LTKLEKEL 818

Query: 2188 SNLKSKNKNLEDKILTMTLSKNLLDNKVLQLE--TSLSERELPKNTQIKNEEKEPAKQQT 2361
            S +  + K  ED I  M     +L  +  +L+  ++ S+ EL K     NEE +  + Q 
Sbjct: 819  SIVCEQKKAAEDGINKMNRELLVLSREHNELKNTSTKSKNELEKVLAASNEELK--RLQD 876

Query: 2362 YTFERKKLESVNDSDISYLYYENLEELQNQFRTLRR--ELKEV---QEDLDMKTESHLK- 2523
            +T E+      + +++  L  EN   L  +    R   ELK     QE L  K  + LK 
Sbjct: 877  FTREKDSSIEKSRAELERLKSENKALLLEKDNASRNSAELKSRLANQELLVSKLTTKLKD 936

Query: 2524 LENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEK 2703
            +  KY  ++       ++LA V  + + K   L + + +L+                T+K
Sbjct: 937  IAEKYKSIEQAKASKEHELAEVSESNQTKILSLQSEIVELRQQYDSMKHDKDNMLTETKK 996

Query: 2704 LQM----AENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLV 2871
            L+     AE   SE       L   +   +   +      +     L  A+N+  +    
Sbjct: 997  LKKSLEDAERSRSEAAYEIKQLKSELDHSSKEIEQLNSSSEEKSKNLADAVNTFNKARNE 1056

Query: 2872 IESNYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKM 3051
            +ES  N  +  AN++L   E  + S + K+ E+ +S D KI +      L +S    +K 
Sbjct: 1057 LES-LNKTLAEANDKLRSRESTIESLEEKLQELKKSSDEKIAS------LEKSRKDLEKF 1109

Query: 3052 XXXXXXXXXXXXRRARYRNKNPREKFPSFVK-IDQQSXXXXXXXXVMENTTKLLALEESN 3228
                        R         ++      K +  +         + ++  K LALE+ N
Sbjct: 1110 QQKF--------RDLELEKSKTQDALTDLQKALQDEKNNHQESLQLQKDKIKQLALEKEN 1161

Query: 3229 AKLIKEV--ENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKE-------QHLNI 3381
            +    E      +K+ +T+       ++  E  E++++ELK K    +       Q ++ 
Sbjct: 1162 SAESTEALKSEVSKLRQTVEDLNKSHKLVHEDYEKKVSELKKKTVSLQDESSLRLQEVSA 1221

Query: 3382 CQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKK 3561
               ELE  + R++ + +Q   ++E+ H     +IK+  +Q E  +     + D+   +K 
Sbjct: 1222 LNTELEETRSRAEKLEEQATDLKEK-HKNICNEIKSKVKQ-EKEKDSRILVLDK--EMKS 1277

Query: 3562 QAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLR- 3738
               +  D    ++ +  ++I +L E K   E    QE+E   Q  +  A+      +L+ 
Sbjct: 1278 AKTDLSDIVHKLEAS-NSEIAKLQEIKAEFE---SQELEGKKQKEDFDAEIKTLRAKLKE 1333

Query: 3739 --AELEKSNNFSNELEKKVED-----AKKFKNEIESLKSELQSVKAYENSTVNSKIIKDL 3897
              AE+EK     NE    +E        + + E+ESL+S+  S+K  E+     K+   L
Sbjct: 1334 KSAEVEKERKMLNEGSSNLEQEYSRKISQLEEELESLESK-HSLKHQESDNEKRKLSGLL 1392

Query: 3898 K--ESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXXX 4071
            K  ES   EK+  +E +               L +   +     ++ +++          
Sbjct: 1393 KKSESSATEKNRELECVRESMKK---------LRESLKDKEQQSEQLSSLQKTQSDKMRE 1443

Query: 4072 XXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVV 4251
               L  +++ EA E  +K      +E +   + ++   +++  +  L  L    +   ++
Sbjct: 1444 ELGLANQKLEEAREKGRKH-----KENLEVALSQKASEVKKLKDQALNYLSKLDEKEAII 1498

Query: 4252 TDTRAQIEKELREKFNLEL---AEIKKKAFEEGKQQSMMKSTLLERKLSK 4392
             +++ Q+E   R+   L+    ++IKK      K ++      LE  LSK
Sbjct: 1499 NESKVQLETAKRDSDELKSSMDSKIKKSQETLSKAENERDQLRLELDLSK 1548

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 167/755 (22%), Positives = 308/755 (40%), Gaps = 18/755 (2%)
 Frame = +1

Query: 289  EKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSL 468
            E L  + Q+   S+D   + +   + DLE  Q+    LE  + KT++ L   +  LQD  
Sbjct: 1079 ESLEEKLQELKKSSDEKIASLEKSRKDLEKFQQKFRDLELEKSKTQDALTDLQKALQD-- 1136

Query: 469  TENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRE--NNLYLEIKCKETDKN 642
             E +  +E + + + K+  +  E   +    + L++ +  LR+   +L    K    D  
Sbjct: 1137 -EKNNHQESLQLQKDKIKQLALEKENSAESTEALKSEVSKLRQTVEDLNKSHKLVHEDYE 1195

Query: 643  KKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESL---STDLQRKLFRIKDLDD 813
            KK+    +    LQD+  +   E+ +L +E+   +   E L   +TDL+ K    K++ +
Sbjct: 1196 KKVSELKKKTVSLQDESSLRLQEVSALNTELEETRSRAEKLEEQATDLKEK---HKNICN 1252

Query: 814  NLNSS-KQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEK 990
             + S  KQE  K+  +      +L  E+ S K  +  +  K LE    + I +L ++K +
Sbjct: 1253 EIKSKVKQEKEKDSRIL-----VLDKEMKSAKTDLSDIVHK-LEASNSE-IAKLQEIKAE 1305

Query: 991  LVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVES 1170
              + E E  + K   D  I     KL  K    +K      R+++ E             
Sbjct: 1306 FESQELEGKKQKEDFDAEIKTLRAKLKEKSAEVEK-----ERKMLNEGSS---------- 1350

Query: 1171 FLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQF 1350
                LEQ+      +  + S LE EL  + S      +E D + R+L+ L KK   +E  
Sbjct: 1351 ---NLEQE------YSRKISQLEEELESLESKHSLKHQESDNEKRKLSGLLKK---SESS 1398

Query: 1351 NDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLL 1530
              E  R+   +   ++ L   + +K   +E+ ++L K           T S K+  +  L
Sbjct: 1399 ATEKNRELECVRESMKKLRESLKDKEQQSEQLSSLQK-----------TQSDKMREELGL 1447

Query: 1531 HFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKSTSVDL---- 1698
              Q ++E ++K                   ++ ++ L +  + K  E  K     L    
Sbjct: 1448 ANQKLEEAREKG------------------RKHKENLEVALSQKASEVKKLKDQALNYLS 1489

Query: 1699 ---EKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNELS 1869
               EK     ESK+ + + +RDS                             + L + + 
Sbjct: 1490 KLDEKEAIINESKVQLETAKRDS-----------------------------DELKSSMD 1520

Query: 1870 SMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIK 2049
            S  ++  + L + EN     ++ QL  ++++ K     ++++ NN  L E +D  E ++K
Sbjct: 1521 SKIKKSQETLSKAEN-----ERDQLRLELDLSK-----EKLEVNNQRLHE-LDATEAQLK 1569

Query: 2050 TLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKI 2229
             L+  +  N     N      N   +SK   L+   +K+S   KE+++ K +   +E K+
Sbjct: 1570 DLKMTIENNLHLLSNSEAAKRNYEARSK--SLAQECEKVSSTLKEVASQKDE---VESKL 1624

Query: 2230 LTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLES----VN 2397
             T   S+N L          ++E EL +NT++K  E E AK +    +R +++     V 
Sbjct: 1625 RT---SENALSTHA----KKIAETELQQNTEVKRLEDEIAKLKKQAEDRSEVDDLMLLVT 1677

Query: 2398 DSDISYLYYEN-LEELQNQFRTLRRELKEVQEDLD 2499
            + D     Y N L+ L   F +   + +E +ED D
Sbjct: 1678 ELDEKNQKYRNKLKALGADFSSDEEDEEEDEEDED 1712

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 139/680 (20%), Positives = 261/680 (38%), Gaps = 22/680 (3%)
 Frame = +1

Query: 106  LEKIYTKAYDLMKENSFVSAAIDDIKHVYEGKINTISQKYFXXXXXXXXXXXXXSGYLVA 285
            LEK   K  DL  E S    A+ D++   + + N   +                      
Sbjct: 1106 LEKFQQKFRDLELEKSKTQDALTDLQKALQDEKNNHQESLQLQKDKI------------- 1152

Query: 286  REKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDS 465
             ++L  EK+   +S +AL SE++ ++  +E + + H  +     K  + L++  + LQD 
Sbjct: 1153 -KQLALEKENSAESTEALKSEVSKLRQTVEDLNKSHKLVHEDYEKKVSELKKKTVSLQD- 1210

Query: 466  LTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRE--NNLYLEIKCK---E 630
                S+L+ Q      ++ ++  EL    +  +KL+     L+E   N+  EIK K   E
Sbjct: 1211 ---ESSLRLQ------EVSALNTELEETRSRAEKLEEQATDLKEKHKNICNEIKSKVKQE 1261

Query: 631  TDK-------NKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKL 789
             +K       +K++ S+  D S +  +L+  +SEI  L+   A  ++ ++ L    Q++ 
Sbjct: 1262 KEKDSRILVLDKEMKSAKTDLSDIVHKLEASNSEIAKLQEIKA--EFESQELEGKKQKED 1319

Query: 790  F--RIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKII 963
            F   IK L   L     E  KE   ++ +NE   N    Y ++I +L             
Sbjct: 1320 FDAEIKTLRAKLKEKSAEVEKE---RKMLNEGSSNLEQEYSRKISQLE------------ 1364

Query: 964  QELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHK 1143
            +EL  L+ K     +E +  K  +   +   E     K     + +E +R  +       
Sbjct: 1365 EELESLESKHSLKHQESDNEKRKLSGLLKKSESSATEK----NRELECVRESM------- 1413

Query: 1144 DTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTN-- 1317
                +++   L + EQ+   + S ++  S   RE L + +   E A+E+  K +E     
Sbjct: 1414 ----KKLRESLKDKEQQSEQLSSLQKTQSDKMREELGLANQKLEEAREKGRKHKENLEVA 1469

Query: 1318 LQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDT 1497
            L +K S  ++  D+ L   S L                  EKEA + +  V  E  + D+
Sbjct: 1470 LSQKASEVKKLKDQALNYLSKL-----------------DEKEAIINESKVQLETAKRDS 1512

Query: 1498 DSHKIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESA 1677
            D  K          +  + + K                  E +  K  ++  NN+ +   
Sbjct: 1513 DELK----------SSMDSKIKKSQETLSKAENERDQLRLELDLSKE-KLEVNNQRLHEL 1561

Query: 1678 KSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLT 1857
             +T   L+    T+E+ ++++S    + +                         +K+ + 
Sbjct: 1562 DATEAQLKDLKMTIENNLHLLSNSEAAKRNYEARSKSLAQECEKVSSTLKEVASQKDEVE 1621

Query: 1858 NELSSMK---QQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNL---LKE 2019
            ++L + +     H K + E E +  T  K       +++K A +  E+ D   L   L E
Sbjct: 1622 SKLRTSENALSTHAKKIAETELQQNTEVKRLEDEIAKLKKQAEDRSEVDDLMLLVTELDE 1681

Query: 2020 YVDKLENKIKTLEQDLAENE 2079
               K  NK+K L  D + +E
Sbjct: 1682 KNQKYRNKLKALGADFSSDE 1701

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 119/620 (19%), Positives = 240/620 (38%), Gaps = 66/620 (10%)
 Frame = +1

Query: 2737 INNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANER 2916
            + N +  +QT ++    F+   K    SL +L Q    +++  L  E +   +I+  N  
Sbjct: 674  LRNNLYRIQTAMKRGPDFQIKDKVSFESLEKLIQQKTQLEEALLKSEESSKGQIEDLNRS 733

Query: 2917 LEEAEVKMASFDGK-------VTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXX 3075
            LEE +  + S + +       +  +  S+     N +     +  L  E           
Sbjct: 734  LEELQKALKSTEDEKKAAELDLENVRASFKNLEDNYSGTKEELNLLQKENSDLVATNSKI 793

Query: 3076 XXXXRRARYRNKNPREKFPSFVKIDQQSXXXXXXXXVMENTTKLLALEESNAKLIKEVEN 3255
                +    +  N R+   +  K++++           E+      + + N +L+     
Sbjct: 794  ENTKKDLELKFNNNRD---ALTKLEKELSIVCEQKKAAED-----GINKMNRELLVLSRE 845

Query: 3256 CTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTIL-Q 3432
              ++  T +    +++  L    +E+  L+    EK+  +   + ELER K  ++ +L +
Sbjct: 846  HNELKNTSTKSKNELEKVLAASNEELKRLQDFTREKDSSIEKSRAELERLKSENKALLLE 905

Query: 3433 QGKIVEEEAHMKS------------LEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEK 3576
            +       A +KS              K+K + E+ +++    A        + +    K
Sbjct: 906  KDNASRNSAELKSRLANQELLVSKLTTKLKDIAEKYKSIEQAKASKEHELAEVSESNQTK 965

Query: 3577 LDAAKTMQINLTTQINELNETKVNL---EKSLQQEIEKNNQSGNGAADE----SEEIIRL 3735
            + + ++  + L  Q + +   K N+    K L++ +E   +S + AA E      E+   
Sbjct: 966  ILSLQSEIVELRQQYDSMKHDKDNMLTETKKLKKSLEDAERSRSEAAYEIKQLKSELDHS 1025

Query: 3736 RAELEKSNNFSNELEKKVEDA----KKFKNE---------------------IESLKSEL 3840
              E+E+ N+ S E  K + DA     K +NE                     IESL+ +L
Sbjct: 1026 SKEIEQLNSSSEEKSKNLADAVNTFNKARNELESLNKTLAEANDKLRSRESTIESLEEKL 1085

Query: 3841 QSVKAYENSTVNS--KIIKDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNN-- 4008
            Q +K   +  + S  K  KDL++  ++ +D  +E+                L   KNN  
Sbjct: 1086 QELKKSSDEKIASLEKSRKDLEKFQQKFRDLELEK---SKTQDALTDLQKALQDEKNNHQ 1142

Query: 4009 --ILANGQESANIXXXXXXXXXXXXAL--ILKRITEAEENLKKRMRLPSEEKINAVIEKR 4176
              +     +   +            AL   + ++ +  E+L K  +L  E+    V E +
Sbjct: 1143 ESLQLQKDKIKQLALEKENSAESTEALKSEVSKLRQTVEDLNKSHKLVHEDYEKKVSELK 1202

Query: 4177 RKVLEQEFETKLRELGLNADGNGVVTDTRAQIEK------ELREKFNLELAEIKKKAFEE 4338
            +K +  + E+ LR   ++A  N  + +TR++ EK      +L+EK      EIK K  +E
Sbjct: 1203 KKTVSLQDESSLRLQEVSA-LNTELEETRSRAEKLEEQATDLKEKHKNICNEIKSKVKQE 1261

Query: 4339 GKQQSMMKSTLLERKLSKLE 4398
             ++ S +     E K +K +
Sbjct: 1262 KEKDSRILVLDKEMKSAKTD 1281

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 50/245 (20%), Positives = 105/245 (42%), Gaps = 3/245 (1%)
 Frame = +1

Query: 3718 EEIIRLRAELEKSNNFSNELEK-KVEDAKKFKNEIE-SLKSELQSVKAYENSTVNSKI-I 3888
            E++I+ + +LE++   S E  K ++ED  +   E++ +LKS     KA E    N +   
Sbjct: 703  EKLIQQKTQLEEALLKSEESSKGQIEDLNRSLEELQKALKSTEDEKKAAELDLENVRASF 762

Query: 3889 KDLKESFKREKDELIEQMXXXXXXXXXXXXXTILAQRKNNILANGQESANIXXXXXXXXX 4068
            K+L++++   K+EL                  +L +  ++++A   +  N          
Sbjct: 763  KNLEDNYSGTKEEL-----------------NLLQKENSDLVATNSKIENT--------- 796

Query: 4069 XXXALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGV 4248
                   K+  E + N   R  L   EK  +++ +++K  E       REL + +  +  
Sbjct: 797  -------KKDLELKFN-NNRDALTKLEKELSIVCEQKKAAEDGINKMNRELLVLSREHNE 848

Query: 4249 VTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNN 4428
            + +T  + + EL +       E+K+      ++ S ++ +  E +  K E++ L   K+N
Sbjct: 849  LKNTSTKSKNELEKVLAASNEELKRLQDFTREKDSSIEKSRAELERLKSENKALLLEKDN 908

Query: 4429 DSNET 4443
             S  +
Sbjct: 909  ASRNS 913

>TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1794

 Score =  121 bits (304), Expect = 1e-26
 Identities = 213/986 (21%), Positives = 403/986 (40%), Gaps = 90/986 (9%)
 Frame = +1

Query: 283  AREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQD 462
            A+E L     ++ +  + LN E+T  K  L  + +   TL+  + K E  + +   EL  
Sbjct: 840  AKENLEKINSQQSNKMERLNDELTQNKEKLSILHKTLDTLKKEKAKAEEGINKMGRELMS 899

Query: 463  SLTENSALKEQIGVFEGKL-----------DSMTQELWLANTENKKLQTGMKLLRENNLY 609
               E   L  +    E K+            S+ Q L  A  + KKL   ++   +    
Sbjct: 900  LTKEKDFLSNKEKELEKKMKKNSDTFMKEKSSLQQNLHEAGLKIKKLSENLESANKVIDE 959

Query: 610  LEIKCKETDKN-------------------KKLYSSAEDASRLQDQLQIVSSEILSLK-- 726
            L  + + TDKN                   +KL S A     LQ Q + ++ E+ + K  
Sbjct: 960  LNSEKRNTDKNLEEWKARFQSHDALVPKLTEKLKSLANSFKDLQIQNEKITEELQASKNS 1019

Query: 727  --SEIATL----KYMNESLSTDLQRKLF---RIKDLDDNLNSSKQEFAKEITLKQRVNEL 879
              +E++TL      +NE +ST +  K     +I +L+ +L+ S      EI  K+ +   
Sbjct: 1020 HNTEVSTLTSQVALLNEKISTLISEKNVLNSQIIELEHSLSKS------EILSKEALESS 1073

Query: 880  LHNEIASYKKQIERLTSKN-LETPEKKIIQELVDLKEKLVNSEKECNELKSTV---DKYI 1047
            L  + A+ K+ +E  TS N L   +KK I+ L +L+ +L + +++     ST+   +  I
Sbjct: 1074 LVEKEANEKQILELTTSINELSADKKKNIETLDNLRTELSSCQEDSKTKDSTIINLNNTI 1133

Query: 1048 NIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERN 1227
             I E KL S     ++LI+  + +L K+K      + ++    VE + +L   +    + 
Sbjct: 1134 KIAEDKLASSESRLEELIK-QKGELAKQKDELAKQKDELHKLNVESKDELQKTNDKIAKL 1192

Query: 1228 SSLEREL-LRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYL 1404
            S   +EL L  TS ++++   + +   E+ +LQ+KI   +  + EL R+  +     + L
Sbjct: 1193 SGEHKELKLENTSLIKKSDDCKILHKTEVASLQEKI---KSLDGELKRKDENFHESEEKL 1249

Query: 1405 LLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMXXXXX 1584
            +   D        + +L+K++        ++D   + S    H + ++E +Q+ +     
Sbjct: 1250 VHKNDIMKDKLSTQESLLKQL--------ESDKESLKSNIESHLEKIEEQKQEILKLQDE 1301

Query: 1585 XXXXXXXXXXXEQEQQKTLRITD--NNK------IVESAKSTSVDLE------------- 1701
                        +E++    + D  NNK       +E A++  +DL+             
Sbjct: 1302 YSSLESDSLNSSKEKENVTLLLDEANNKNENLKSELEKARADLIDLKSNLDETNLNSQRI 1361

Query: 1702 --------KHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKER-L 1854
                    K IK  E +I  I +ER++ K                       E E+ER L
Sbjct: 1362 SEEKENLSKKIKKFEDEILSIKKERETSKQKTQEQIMELQKSIKSRNE----EFERERKL 1417

Query: 1855 TNELS--SMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVD 2028
             NE S  + K+   KV  ELE+K+  L+       +E +K   N D ++++N  L++ ++
Sbjct: 1418 LNEGSNTATKEYSAKV-SELEDKLDALKAEY---SLEKDKLVTNSDSLRESNERLEDQLE 1473

Query: 2029 KLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSV---AEQKISFLDKEISNLK 2199
            +  N++   ++D               + N E+ K IEL +   A    S L   + N+ 
Sbjct: 1474 EKSNELHLAKED-------------AKIQN-EKIKNIELKLKTQANSNESKLKDYMGNID 1519

Query: 2200 SKNKNLEDKILTMTLSKNLLDNK---VLQLETSLSE-RELPKNTQIKNEEKEPAKQQTYT 2367
            S  K L  K   + + ++ L+++   V + +T +++ R+  KN+ IK  EKE +      
Sbjct: 1520 SLKKELLGKEKALGILQSQLESQLSVVSEKDTEIADIRKQLKNSNIKLNEKEVS------ 1573

Query: 2368 FERKKLESVNDSDISYLYYENLEELQNQFRTLRRELK---EVQEDLDMKTESHLKLENKY 2538
               +KL      D++ +    L +++   +TLR +     +V   L++K      L   Y
Sbjct: 1574 ---EKLAKSAAEDLAAIKESELSKIKEDMKTLRSDYDGKIKVITSLELKLSEFKTLSEDY 1630

Query: 2539 TKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAE 2718
            + +K+ L      L     + ++K +  A     ++                TE++   E
Sbjct: 1631 SSLKDKLGNLENDLKDSKASFQEKKTEAAEYKQTVENLAKEKEKLTNDLSNLTERVNSCE 1690

Query: 2719 NENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQ--QQSLVIESNYNT 2892
                 K   AI   +   EE    KD        L +LR+ I  ++     L  ++N  +
Sbjct: 1691 TAIQLKDKEAIE-AKNRHEELAVSKD------EELIQLRKEIEELKASNSKLHAQANDKS 1743

Query: 2893 EIDHANERLEEAEVKMASFDGKVTEI 2970
            E+D     + + + K   +  K+ E+
Sbjct: 1744 EVDELMILVNDLDEKNTKYLAKLEEL 1769

 Score =  109 bits (272), Expect = 5e-23
 Identities = 223/1117 (19%), Positives = 461/1117 (41%), Gaps = 62/1117 (5%)
 Frame = +1

Query: 664  EDASRLQDQLQIVSSE----ILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSK 831
            E+   L+ ++  + +E    I  LK+++  LK  +E+++TD +        + DN N ++
Sbjct: 765  EECKALKQEINTLGAESQLTIEKLKNDLDALKESHENVTTDFETAKEEYLSVSDNYNKTQ 824

Query: 832  QEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKE 1011
            +E  K++T+  +V       ++  K+ +E++ S+     E+ +  EL   KEKL    K 
Sbjct: 825  KEL-KDLTINLKV-------VSEAKENLEKINSQQSNKMER-LNDELTQNKEKLSILHKT 875

Query: 1012 CNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQ 1191
             + LK    K      ++ I+K G          R+L+   + KD L  + +    ELE+
Sbjct: 876  LDTLKKEKAK-----AEEGINKMG----------RELMSLTKEKDFLSNKEK----ELEK 916

Query: 1192 KLPM-IDSFKERNSSLEREL-------LRITSSLEETAK-------ERDIKDRELTNLQK 1326
            K+    D+F +  SSL++ L        +++ +LE   K       E+   D+ L   + 
Sbjct: 917  KMKKNSDTFMKEKSSLQQNLHEAGLKIKKLSENLESANKVIDELNSEKRNTDKNLEEWKA 976

Query: 1327 KISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSH 1506
            +  +++    +L  +   LA+  + L +          +   + +++ +++N+ N   S 
Sbjct: 977  RFQSHDALVPKLTEKLKSLANSFKDLQI----------QNEKITEELQASKNSHNTEVST 1026

Query: 1507 KIISKRLLHFQNVKELQQKNMXXXXXXXXXXXXXXXXEQEQQKTLRITDNNKIVESAKST 1686
                  LL+ +    + +KN+                            N++I+E   S 
Sbjct: 1027 LTSQVALLNEKISTLISEKNVL---------------------------NSQIIELEHSL 1059

Query: 1687 SVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXXXXXXXXXXXXXXCELEKERLTNEL 1866
            S       + LES  +++ +E +  ++L                       E     NEL
Sbjct: 1060 SKSEILSKEALES--SLVEKEANEKQIL-----------------------ELTTSINEL 1094

Query: 1867 SSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKI 2046
            S+ K+++++ L+ L  ++ + Q+   T    +    +N       NN +K   DKL +  
Sbjct: 1095 SADKKKNIETLDNLRTELSSCQEDSKTKDSTI----INL------NNTIKIAEDKLASSE 1144

Query: 2047 KTLEQDLAENELFEKNLITGGVNNLEQSK--IIELSV-AEQKISFLDKEISNLKSKNKNL 2217
              LE+ + +     K  +    + L + K  + +L+V ++ ++   + +I+ L  ++K L
Sbjct: 1145 SRLEELIKQ-----KGELAKQKDELAKQKDELHKLNVESKDELQKTNDKIAKLSGEHKEL 1199

Query: 2218 EDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVN 2397
              K+   +L K   D K+L      S +E  K+  +  E K   K + +    +KL   N
Sbjct: 1200 --KLENTSLIKKSDDCKILHKTEVASLQEKIKS--LDGELKR--KDENFHESEEKLVHKN 1253

Query: 2398 DSDISYLYYEN--LEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQAT 2571
            D     L  +   L++L++   +L+  ++   E ++ + +  LKL+++Y+ +++D   ++
Sbjct: 1254 DIMKDKLSTQESLLKQLESDKESLKSNIESHLEKIEEQKQEILKLQDEYSSLESDSLNSS 1313

Query: 2572 YKLASVYTTLEQKNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAI 2751
             +  +V   L++ N+   N  S+L+                 + + +  N +   +N+  
Sbjct: 1314 KEKENVTLLLDEANNKNENLKSELE-------------KARADLIDLKSNLDETNLNS-- 1358

Query: 2752 VLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQ--QSLVIE-----SNYNTEIDHAN 2910
               Q + EE        K F++ +  +++   + +Q  Q  ++E      + N E +   
Sbjct: 1359 ---QRISEEKENLSKKIKKFEDEILSIKKERETSKQKTQEQIMELQKSIKSRNEEFERER 1415

Query: 2911 ERLEE-AEVKMASFDGKVTEILESYDG-KILNTAAIGHLVR---SLIHEKKMXXXXXXXX 3075
            + L E +      +  KV+E+ +  D  K   +     LV    SL    +         
Sbjct: 1416 KLLNEGSNTATKEYSAKVSELEDKLDALKAEYSLEKDKLVTNSDSLRESNERLEDQLEEK 1475

Query: 3076 XXXXRRARYRNKNPREKFPSF-VKIDQQ-----SXXXXXXXXVMENTTKLLALEESNAKL 3237
                  A+   K   EK  +  +K+  Q     S        +     +LL  E++   L
Sbjct: 1476 SNELHLAKEDAKIQNEKIKNIELKLKTQANSNESKLKDYMGNIDSLKKELLGKEKALGIL 1535

Query: 3238 IKEVENCTKVNETLSSQLADMQVKLEPLEQEINEL----KLKVAEKEQHLNICQEELERW 3405
              ++E+   V     +++AD++ +L+    ++NE     KL  +  E    I + EL + 
Sbjct: 1536 QSQLESQLSVVSEKDTEIADIRKQLKNSNIKLNEKEVSEKLAKSAAEDLAAIKESELSKI 1595

Query: 3406 KLRSQTILQQ--GKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEK- 3576
            K   +T+     GKI    +    L + KTL E   +++ +   L +     K    EK 
Sbjct: 1596 KEDMKTLRSDYDGKIKVITSLELKLSEFKTLSEDYSSLKDKLGNLENDLKDSKASFQEKK 1655

Query: 3577 LDAAKTMQI---------NLTTQINELNETKVNLEKSLQ----QEIEKNNQSGNGAADES 3717
             +AA+  Q           LT  ++ L E   + E ++Q    + IE  N+    A  + 
Sbjct: 1656 TEAAEYKQTVENLAKEKEKLTNDLSNLTERVNSCETAIQLKDKEAIEAKNRHEELAVSKD 1715

Query: 3718 EEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESL 3828
            EE+I+LR E+E+    +++L  +  D    K+E++ L
Sbjct: 1716 EELIQLRKEIEELKASNSKLHAQAND----KSEVDEL 1748

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 182/890 (20%), Positives = 354/890 (39%), Gaps = 117/890 (13%)
 Frame = +1

Query: 1618 EQEQQKTLRITDN-NKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVXXXXXXX 1794
            E  +++ L ++DN NK  +  K  +++L+   +  E+   I SQ+ +  + L        
Sbjct: 807  ETAKEEYLSVSDNYNKTQKELKDLTINLKVVSEAKENLEKINSQQSNKMERLNDELTQNK 866

Query: 1795 XXXXXXXXXXXXCELEKERLTNELSSMKQQHVKVLEE----------LENKIK----TLQ 1932
                         + EK +    ++ M ++ + + +E          LE K+K    T  
Sbjct: 867  EKLSILHKTLDTLKKEKAKAEEGINKMGRELMSLTKEKDFLSNKEKELEKKMKKNSDTFM 926

Query: 1933 KSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAE-NELFEKN----- 2094
            K + + +  + +  L   ++ +N     + +D+L ++ +  +++L E    F+ +     
Sbjct: 927  KEKSSLQQNLHEAGLKIKKLSENLESANKVIDELNSEKRNTDKNLEEWKARFQSHDALVP 986

Query: 2095 LITGGVNNLEQSKIIELSVAEQKIS--------FLDKEISNLKSKNKNLEDKILTMTLSK 2250
             +T  + +L  S   +L +  +KI+          + E+S L S+   L +KI T+   K
Sbjct: 987  KLTEKLKSLANS-FKDLQIQNEKITEELQASKNSHNTEVSTLTSQVALLNEKISTLISEK 1045

Query: 2251 NLLDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLE-SVNDSDISYLYYE 2427
            N+L++++++LE SLS+ E+     +  E  E +  +    E++ LE + + +++S    +
Sbjct: 1046 NVLNSQIIELEHSLSKSEI-----LSKEALESSLVEKEANEKQILELTTSINELSADKKK 1100

Query: 2428 NLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQ 2607
            N+E L N    LR EL   QED   K  + + L        N +K A  KLAS  + LE+
Sbjct: 1101 NIETLDN----LRTELSSCQEDSKTKDSTIINL-------NNTIKIAEDKLASSESRLEE 1149

Query: 2608 KNSFLANSVSQLQGXXXXXXXXXXXXXXXTEKLQMAENENSEKINNAIVLL----QTMVE 2775
                    + + +G                 KL +   +  +K N+ I  L    + +  
Sbjct: 1150 --------LIKQKGELAKQKDELAKQKDELHKLNVESKDELQKTNDKIAKLSGEHKELKL 1201

Query: 2776 ENTTF----KDAFKHFKNSLSRLRQAINSIQQQSLVIESNYN---TEIDHANE------- 2913
            ENT+      D     K  ++ L++ I S+  +    + N++    ++ H N+       
Sbjct: 1202 ENTSLIKKSDDCKILHKTEVASLQEKIKSLDGELKRKDENFHESEEKLVHKNDIMKDKLS 1261

Query: 2914 ----RLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMXXXXXXXXXX 3081
                 L++ E    S    +   LE  + +      +     SL  +             
Sbjct: 1262 TQESLLKQLESDKESLKSNIESHLEKIEEQKQEILKLQDEYSSLESDSLNSSKEKENVTL 1321

Query: 3082 XXRRARYRNKNPREKFPSF--------VKIDQQSXXXXXXXXVMENTTKLLALEESNAKL 3237
                A  +N+N + +              +D+ +          EN +K +   E     
Sbjct: 1322 LLDEANNKNENLKSELEKARADLIDLKSNLDETNLNSQRISEEKENLSKKIKKFEDEILS 1381

Query: 3238 IKEVENCTKVNETLSSQLADMQVKLEPLEQEI---------------NELKLKVAEKEQH 3372
            IK+    +K  +    Q+ ++Q  ++   +E                 E   KV+E E  
Sbjct: 1382 IKKERETSK--QKTQEQIMELQKSIKSRNEEFERERKLLNEGSNTATKEYSAKVSELEDK 1439

Query: 3373 LNICQEE--LERWKL--RSQTILQQGKIVEEEAHMKS-------------LEKIKTLEEQ 3501
            L+  + E  LE+ KL   S ++ +  + +E++   KS              EKIK +E +
Sbjct: 1440 LDALKAEYSLEKDKLVTNSDSLRESNERLEDQLEEKSNELHLAKEDAKIQNEKIKNIELK 1499

Query: 3502 LETVRTEN-AQLTD---RFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNL------ 3651
            L+T    N ++L D     D LKK+   K  A   +Q  L +Q++ ++E    +      
Sbjct: 1500 LKTQANSNESKLKDYMGNIDSLKKELLGKEKALGILQSQLESQLSVVSEKDTEIADIRKQ 1559

Query: 3652 ---------EKSLQQEIEKNNQSGNGAADES------EEIIRLRAELEKSNNFSNELEKK 3786
                     EK + +++ K+      A  ES      E++  LR++ +        LE K
Sbjct: 1560 LKNSNIKLNEKEVSEKLAKSAAEDLAAIKESELSKIKEDMKTLRSDYDGKIKVITSLELK 1619

Query: 3787 VEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIE 3936
            + + K    +  SLK +L ++   EN       +KD K SF+ +K E  E
Sbjct: 1620 LSEFKTLSEDYSSLKDKLGNL---END------LKDSKASFQEKKTEAAE 1660

 Score = 40.8 bits (94), Expect = 0.039
 Identities = 53/248 (21%), Positives = 113/248 (45%), Gaps = 25/248 (10%)
 Frame = +1

Query: 3211 ALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQE 3390
            AL+ES+       EN T   ET   +   +       ++E+ +L + +    +     +E
Sbjct: 794