Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F002905.702ON1554155479410.0
NCAS0G002305.702ON1735171911391e-129
KNAG0L021405.702ON160814297098e-75
ZYRO0G06600g5.702ON18205146591e-68
TDEL0B021905.702ON18104996392e-66
Ecym_40185.702ON17697136285e-65
NCAS0A032005.702ON17885565892e-60
Kwal_55.196975.702ON17606135687e-58
YIL149C (MLP2)5.702ON16797655516e-56
SAKL0E14916g5.702ON17795625453e-55
Skud_9.195.702ON16808015436e-55
AFR286W5.702ON17585185311e-53
Skud_11.3345.702ON18856005321e-53
KLLA0A00594g5.702ON17486345222e-52
Smik_9.205.702ON16829055185e-52
CAGL0G02497g5.702ON17805225114e-51
Smik_11.3585.702ON18785575105e-51
Suva_11.3315.702ON18984845033e-50
YKR095W (MLP1)5.702ON18755944927e-49
KLTH0E01056g5.702ON17714754873e-48
NDAI0E050405.702ON19734754854e-48
KAFR0D022205.702ON16745694578e-45
TBLA0E017305.702ON18205034328e-42
Kpol_1043.705.702ON13214884245e-41
Suva_9.395.702ON16827334013e-38
KAFR0H002105.702ON14543623191e-28
KNAG0C065905.702ON16514702716e-23
TPHA0D046105.702ON11831831991e-14
TPHA0E002305.702ON12841851428e-08
Kpol_2001.755.702ON10064831302e-06
YCR030C (SYP1)1.151ON87090860.27
Skud_3.1081.151ON87290830.63
KLLA0D06787g8.631ON43676820.73
Suva_12.2254.364ON708114811.1
Smik_3.1331.151ON87090801.3
KAFR0E014705.296ON872124801.5
KLTH0B01232g5.123ON86673801.6
Skud_12.4044.136ON146080791.8
ACR068W5.267ON1805257782.4
Suva_3.631.151ON87190772.8
NDAI0G002201.493ON65464773.0
KAFR0G025006.65ON28942744.6
Kpol_1018.216.291ON417173755.1
NCAS0A024504.238ON1928187756.0
TBLA0I029004.238ON1794144756.1
SAKL0F14894g7.488ON129758747.8
ZYRO0G02310g1.530ON395212738.7
Ecym_34343.393ON48655738.7
Skud_13.3938.744ON694160739.3
Smik_15.893.149ON45184729.5
CAGL0D03124g5.208ON72582739.5
KNAG0A074003.393ON4211547210.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F00290
         (1554 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...  3063   0.0  
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   443   e-129
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   277   8e-75
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   258   1e-68
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   250   2e-66
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   246   5e-65
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   231   2e-60
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   223   7e-58
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   216   6e-56
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   214   3e-55
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   213   6e-55
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   209   1e-53
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   209   1e-53
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   205   2e-52
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   204   5e-52
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   201   4e-51
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   201   5e-51
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   198   3e-50
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   194   7e-49
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   192   3e-48
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   191   4e-48
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   180   8e-45
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   171   8e-42
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   167   5e-41
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   159   3e-38
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   127   1e-28
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   108   6e-23
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    81   1e-14
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    59   8e-08
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    55   2e-06
YCR030C Chr3 complement(173826..176438) [2613 bp, 870 aa] {ON}  ...    38   0.27 
Skud_3.108 Chr3 complement(158356..160974) [2619 bp, 872 aa] {ON...    37   0.63 
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    36   0.73 
Suva_12.225 Chr12 complement(353202..355328) [2127 bp, 708 aa] {...    36   1.1  
Smik_3.133 Chr3 complement(171934..174546) [2613 bp, 870 aa] {ON...    35   1.3  
KAFR0E01470 Chr5 complement(293344..295962) [2619 bp, 872 aa] {O...    35   1.5  
KLTH0B01232g Chr2 complement(108265..110865) [2601 bp, 866 aa] {...    35   1.6  
Skud_12.404 Chr12 (712901..717283) [4383 bp, 1460 aa] {ON} YLR32...    35   1.8  
ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic h...    35   2.4  
Suva_3.63 Chr3 complement(86986..89601) [2616 bp, 871 aa] {ON} Y...    34   2.8  
NDAI0G00220 Chr7 (29472..31436) [1965 bp, 654 aa] {ON} Anc_1.493...    34   3.0  
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...    33   4.6  
Kpol_1018.21 s1018 (56444..57697) [1254 bp, 417 aa] {ON} (56444....    33   5.1  
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    33   6.0  
TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {...    33   6.1  
SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa...    33   7.8  
ZYRO0G02310g Chr7 (177479..178666) [1188 bp, 395 aa] {ON} simila...    33   8.7  
Ecym_3434 Chr3 (816557..818017) [1461 bp, 486 aa] {ON} similar t...    33   8.7  
Skud_13.393 Chr13 complement(692641..694725) [2085 bp, 694 aa] {...    33   9.3  
Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W...    32   9.5  
CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {...    33   9.5  
KNAG0A07400 Chr1 complement(1157757..1159022) [1266 bp, 421 aa] ...    32   10.0 

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score = 3063 bits (7941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1554/1554 (100%), Positives = 1554/1554 (100%)

Query: 1    MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDI 60
            MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDI
Sbjct: 1    MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDI 60

Query: 61   KHVYEGKINTISQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLI 120
            KHVYEGKINTISQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLI
Sbjct: 61   KHVYEGKINTISQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLI 120

Query: 121  KYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQEL 180
            KYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQEL
Sbjct: 121  KYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQEL 180

Query: 181  WLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILS 240
            WLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILS
Sbjct: 181  WLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQIVSSEILS 240

Query: 241  LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS 300
            LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS
Sbjct: 241  LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS 300

Query: 301  YKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKF 360
            YKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKF
Sbjct: 301  YKKQIERLTSKNLETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKF 360

Query: 361  GNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRIT 420
            GNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRIT
Sbjct: 361  GNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRIT 420

Query: 421  SSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTE 480
            SSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTE
Sbjct: 421  SSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPFTE 480

Query: 481  KEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQE 540
            KEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQE
Sbjct: 481  KEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQE 540

Query: 541  QEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVTNSTIQSNT 600
            QEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVTNSTIQSNT
Sbjct: 541  QEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVTNSTIQSNT 600

Query: 601  SNNSISSLQQCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALN 660
            SNNSISSLQQCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALN
Sbjct: 601  SNNSISSLQQCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEKHALN 660

Query: 661  FDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQ 720
            FDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQ
Sbjct: 661  FDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNLEQSKIIELSVAEQ 720

Query: 721  KISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEK 780
            KISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEK
Sbjct: 721  KISFLDKEISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNEEK 780

Query: 781  EPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHL 840
            EPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHL
Sbjct: 781  EPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHL 840

Query: 841  KLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGKEKELNELKSKLVEKTE 900
            KLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGKEKELNELKSKLVEKTE
Sbjct: 841  KLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGKEKELNELKSKLVEKTE 900

Query: 901  KLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIES 960
            KLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIES
Sbjct: 901  KLQMAENENSEKINNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIES 960

Query: 961  NYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMLAL 1020
            NYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMLAL
Sbjct: 961  NYNTEIDHANERLEEAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLIHEKKMLAL 1020

Query: 1021 NLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEEDKEEVMENTTKLLALEESNAKLI 1080
            NLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEEDKEEVMENTTKLLALEESNAKLI
Sbjct: 1021 NLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEEDKEEVMENTTKLLALEESNAKLI 1080

Query: 1081 KEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQ 1140
            KEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQ
Sbjct: 1081 KEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQ 1140

Query: 1141 TILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQ 1200
            TILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQ
Sbjct: 1141 TILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQ 1200

Query: 1201 INLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELE 1260
            INLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELE
Sbjct: 1201 INLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELE 1260

Query: 1261 KKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKT 1320
            KKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKT
Sbjct: 1261 KKVEDAKKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKT 1320

Query: 1321 KLEKEKETILAQRKNNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLP 1380
            KLEKEKETILAQRKNNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLP
Sbjct: 1321 KLEKEKETILAQRKNNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLP 1380

Query: 1381 SEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIK 1440
            SEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIK
Sbjct: 1381 SEEKINAVIEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIK 1440

Query: 1441 KKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKINLSNINSSSPPLG 1500
            KKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKINLSNINSSSPPLG
Sbjct: 1441 KKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKINLSNINSSSPPLG 1500

Query: 1501 EKVLQLNYGANVVAETDNDDNPFTLQSGKDETLLTKRSADNEIIQDIIKRPKEE 1554
            EKVLQLNYGANVVAETDNDDNPFTLQSGKDETLLTKRSADNEIIQDIIKRPKEE
Sbjct: 1501 EKVLQLNYGANVVAETDNDDNPFTLQSGKDETLLTKRSADNEIIQDIIKRPKEE 1554

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  443 bits (1139), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 541/1719 (31%), Positives = 871/1719 (50%), Gaps = 262/1719 (15%)

Query: 14   IDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDIKHVYEGKINTISQ 73
            ++ +++  ++     E+++   LEKI  K     +E   ++A ID+ K     + +T+  
Sbjct: 4    LNNLATSLEVTATDLETIEPTVLEKINAKLLSSEQEKDRLNATIDNFKSKMSSQFDTVKN 63

Query: 74   KYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDL--------- 124
                LQ      KEKE   L+  +K +  K  +++   A + +I+  K DL         
Sbjct: 64   DLELLQ------KEKE--LLIQDKKQLESKCIQWEQQYAQHQDIS--KTDLASDDVIKEN 113

Query: 125  EAMQRDHTTLEA-------RERKTENVLEQ---SKLELQDSLTENSALKEQIGVFEGKLD 174
            E  +RDH  L +       +    +  LE+   + LELQ+   +N  ++ Q+  F+ +  
Sbjct: 114  ETFKRDHQLLTSDLMNLSKKLSSCDAALEKKSTAYLELQN---DNIDIRTQLNNFKSETK 170

Query: 175  SMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKE-TDKNKKLY----SSAEDASRLQD 229
             +  +      + ++L+     ++    Y E   KE ++ + K Y    SS+ +    +D
Sbjct: 171  GLKSKYERKVKDFEELKNAYSSMK---TYEETSRKELSEMSNKFYTLKTSSSNELRNAKD 227

Query: 230  QLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQR 289
             L  +  +   L  E    K  N  L+T +  +LF+ K L+++LN  K+ F +E+TL Q 
Sbjct: 228  ALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQH 287

Query: 290  VNELLHNEIASYKKQIERLTSKNLETPEK-KIIQELVDLKEKLVNSEKECNELKSTVDKY 348
             N+LL   I  Y K   + T+    T EK +++ ELVD+K+ L  SE E   L   +++Y
Sbjct: 288  ENDLLKEHI-EYLKNTTKETTGGTSTLEKDRLLHELVDIKKSLEKSELENVHLNDFIEQY 346

Query: 349  INIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKER 408
            +  +E+       +  +L+ +L+ QL+KEKR KD LQ QVE F++ELE +LP ++S K+R
Sbjct: 347  LTENEES-----TSDNELV-LLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDR 400

Query: 409  NSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYL 468
            N +LE+EL++IT  LEET +E DI+ +ELT   +++    +  + L+ QR DLAHQVQ+L
Sbjct: 401  NQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFL 460

Query: 469  LLCIDNKSP----FTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNME 524
            LL +D K       T  E T ++KI+ + N++ND+DS KIIS+RL+ F ++  LQ++NME
Sbjct: 461  LLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNME 520

Query: 525  LLRTTRQLVQTLERQEQEQ-QKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQE 583
            LL TTR L + LE  + +  QK  R     KI +        L++ I  L SK+  + +E
Sbjct: 521  LLTTTRNLAEQLESSDTKSVQKITRNESKEKIAK--------LQESINGLTSKLEKLQKE 572

Query: 584  RDSYKLLVTNSTIQSNTSNNSISSLQQCE--LEK-ERLTNELSSMKQQHVKVLEELENKI 640
            +D+YKLL   +T +   +    S LQ+ E  L K ER+++  S + ++  KVL       
Sbjct: 573  KDAYKLLSLQNTGEQTPTEELRSQLQKKEEQLTKLERMSSLDSHLAEEKAKVL------- 625

Query: 641  KTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDK--LENKIKTLEQ---------DL 689
                 +Q   K++ EK+ L       NN ++KE   +   E K K LE          DL
Sbjct: 626  -----NQSIIKLKKEKYDL-------NNAIIKETSQRAIAEKKSKMLEDSLELLHKKYDL 673

Query: 690  A--ENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSK-------NKNLE 740
            A  + E +E  L      N++ S+  E + A  KIS L KEI + K         N+N  
Sbjct: 674  AVKKYEHYETLLNDHNAENIKHSRENETTQA--KISILQKEIESYKQNLLQYSKDNENTL 731

Query: 741  DKILTMTLSKNLLDNKVLQLET--------------------SLSERELPKNTQIKNEEK 780
             K+   T  K  L +++  ++                     S+SER L K ++I+ E+K
Sbjct: 732  SKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHDSISER-LLKKSKIQLEDK 790

Query: 781  -------EPAKQQTYTFERKKLESV---ND--------------------SDISYLYYEN 810
                   E  K     + +K+L+S+   ND                    SD+     +N
Sbjct: 791  IKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKISDLEKTLSQN 850

Query: 811  ------LEELQNQFRTLRRELKEVQED-------LDMKTESHLKLE---NKYTKVKND-- 852
                  L  +   F  L+ ELKE Q +       L++  E+  +L+   NK  ++ +D  
Sbjct: 851  TNGSSSLPRVDQDFEKLKNELKEKQLEINQYRDLLNLAEETKNRLQKDLNKQRQIVDDAM 910

Query: 853  ---------LKQATYKLASVYTTLEQKNSFLANSVSQLQGKEKELNELKSKLVEKTEKLQ 903
                     L + T + +S+ + L+++ +   +    +Q K  E   LK+ L     K+ 
Sbjct: 911  EGKEQLDQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKNSLSSLENKIT 970

Query: 904  MAENENSEK-----------------INNAIVLLQTMVEENTTFKDAFKHFKNSLSRLRQ 946
              ENE  EK                 ++ +  L++ M  EN  +K +    K +++    
Sbjct: 971  TLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYED 1030

Query: 947  AINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILE-------SYDGKIL 999
            AI++ +Q+ L  + N+  ++D   E ++    ++    GK + I           D  ++
Sbjct: 1031 AISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVV 1090

Query: 1000 N-TAAIGHLVRSLIHEKKMLALNLNSAN---YSLRRARYRNKNP----REKFPSF-VKID 1050
            N T+    L+ +L  E+  L + L+ +    YSLR      KN     R+ F     ++ 
Sbjct: 1091 NDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVS 1150

Query: 1051 QQSKKEEDKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQE 1110
             +    E  +E ++   +L  L+E+N +L +++    K N  + ++L  ++ ++ PL+ +
Sbjct: 1151 GEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDK 1210

Query: 1111 INELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLET 1170
            +  LK  + EK+Q L +  EE ERWKLRS+ IL + + V+ E H K +E++ TL+ QL+T
Sbjct: 1211 VERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDT 1270

Query: 1171 VRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE---IEK 1227
               +N  L DRF+RLKKQAHEKLDAAK    +LT +I +L + K  LE  L +E   I++
Sbjct: 1271 KTKDNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQE 1330

Query: 1228 NNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDA--------KKFKNEIESLKSE 1279
                     D  + I  L  EL  S   S ++E+ +++         KK   E+ SLKS+
Sbjct: 1331 VESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQ 1390

Query: 1280 LQSVK-------AYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQ 1332
            L+++K         + S +NS+ I  LKESF+ EK ELI  +K+EFK +LE+EK+ +L +
Sbjct: 1391 LETLKNQNGVISVADGSAINSETIAHLKESFEVEKTELITTLKEEFKKQLEEEKKKLLEE 1450

Query: 1333 RKNNIL----ANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAV 1388
            ++          G E  +IE++K +WEE+QE +I++RI +AEENLKKR+RLPSEEKIN V
Sbjct: 1451 KEKEYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRV 1510

Query: 1389 IEKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGK 1448
            IEKRRK LE+E+E KL+  GL  +   +  + R ++E+ELR KF+ ELAE+KKKAF EGK
Sbjct: 1511 IEKRRKELEEEYEKKLKRQGLTTE-TAIEEELRKEVERELRVKFDNELAEVKKKAFLEGK 1569

Query: 1449 QQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQ------------VPSKINL-----SN 1491
            QQS MK+TLLERKLSKLESQ  SP++  D   +Q             PSKINL     SN
Sbjct: 1570 QQSQMKTTLLERKLSKLESQA-SPSRTPDLESSQKENTEGATKTTLGPSKINLLPFSMSN 1628

Query: 1492 INSS---SPPLGEKVLQLNYGANVVAETDNDDNPFTLQS 1527
             + S     P GEKVLQ+N  +  +  +    NPFTL +
Sbjct: 1629 TDDSIEKQVPQGEKVLQINRRS--LEPSFGSSNPFTLPT 1665

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  277 bits (709), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 403/1429 (28%), Positives = 671/1429 (46%), Gaps = 233/1429 (16%)

Query: 223  DASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQR-------KLFRIKDLDDNLNS 275
            D  R   Q+ ++  ++    SEI  L+  N +L   L+R       K    K L D L+S
Sbjct: 147  DFQRDDRQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSS 206

Query: 276  SKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVD-LKEKLVNS 334
             + +F +E+  + ++N +L       KKQ+  L S+     E     E  D   ++    
Sbjct: 207  QRHDFERELATRDKLNAVL-------KKQVNSLHSELGNGGETPAHAEPNDQFAKQSSQH 259

Query: 335  EKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVE 394
            E+E +  K  V++ + I         G     I  LR+ L+KE++   +L++Q+ESF++E
Sbjct: 260  EEEISNYKEQVEELLGI--------LGQGAPSIAHLRKLLLKERKENVSLKKQMESFVIE 311

Query: 395  LEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDEL 454
            LE +LP +   +++N  ++++L   T+ + E +K +    REL++ ++K+ +  Q   +L
Sbjct: 312  LEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKL 371

Query: 455  LRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQN 514
              QRSDLAHQ+Q+LL    + +     E + +K I+ NEN +   DS +I+S RLL F N
Sbjct: 372  RVQRSDLAHQIQFLLTVNSSDTVLPPSELSFIKTIIENENWDAYKDSQRIVSDRLLRFDN 431

Query: 515  VKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLE 574
            + ELQ++NM+L+ T R LV  +E  E +        D+   +E+AK     LE+    LE
Sbjct: 432  IPELQEQNMKLVSTVRSLVDKVESWEAD-------NDSGLTLEAAKLQISKLEQSNAQLE 484

Query: 575  SKINIISQERDSYKLLVTNSTIQSNTSNNSISSLQQCELEK--ERLTNELSSMKQQHVKV 632
            S++        +++ L+   T++   S +S  ++   E +K  E L ++L+ + + HV+ 
Sbjct: 485  SEVK-------NWEALM--ETLKDGDSLDSKINVTMVEQQKKIEELESKLTDVGESHVQK 535

Query: 633  LEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVD-KLENKIKTLEQDLAE 691
            +  L    KT+ ++Q T  M  E+     + +K + N   E +  K EN   T +    +
Sbjct: 536  INVLN---KTIDRNQSTINMLNEQIK---NTVKSDMNAKSELIACKRENLSLTQQISTKQ 589

Query: 692  NELFEKNLITGGVNNLEQSKIIELSVAEQKI-----SF--LDKEISNLKSKNKNLEDKIL 744
            NEL E N  +       Q KI ELSVA  K      SF  L +E + ++ K ++L DKI 
Sbjct: 590  NELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKI- 648

Query: 745  TMTLSKNL--LDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSD 802
                SK L  L+ +  +LE  +S +EL +    ++EE   +K    + E K L     +D
Sbjct: 649  -QQESKKLLQLETRNKELEVKISGKELHRK---RSEETLSSKITFLSEENKSLH----ND 700

Query: 803  ISY-----------------LYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENK 845
            +++                  Y +N++EL  Q +    ++ E+ + L + +E  L   NK
Sbjct: 701  LAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLRLLSEKSLS--NK 758

Query: 846  YTKVKNDLKQATYKL-------------ASVY-TTLEQKNSFLANSVSQLQGKEKELNEL 891
               V  +LK+   +L             A++Y  TLE+  +F  NS    Q    EL   
Sbjct: 759  PYPVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSK 818

Query: 892  KSKLVEKTEKL--QMAENENSEKINNAIVL-LQTMVEENTTFKDAFKHFKNSLSRLRQAI 948
               L ++ E L  Q+ E EN  K    I L  QT+++  T+ K A +   NSLS   + I
Sbjct: 819  NEALSKQHETLQNQITETENQSK---GIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKI 875

Query: 949  NSIQ----QQSLVIESNYNTEID---HANERLEEAEVKMASFDGKVTEI---LESYDGKI 998
              ++     Q   IESN   + D   +    L   E ++ S+  ++ ++   +   +  I
Sbjct: 876  AEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDI 935

Query: 999  LNTAAIGHLVRSLIHEKKMLALNLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEED 1058
                      ++LI E+  L   L  AN  +     +N    + F     +D  ++  ED
Sbjct: 936  AALTEPAEARKTLIKERDSLGQELKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNED 995

Query: 1059 -----------------KEEVMENTTKLL-----------------------------AL 1072
                             +E   +   KLL                             +L
Sbjct: 996  LRNLVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSL 1055

Query: 1073 EESNAKLIKEVENCTKVNE---TLSSQLADMQVKLEPLEQEINELK------------LK 1117
              ++ K+++E+E  T   E    L   +  +      L++E++ L+            + 
Sbjct: 1056 TVTHEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQEEVSRLRESEELAKKNSSAIS 1115

Query: 1118 VAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRT---- 1173
              E +Q +   Q+E E+WKL  Q + +            +  +I+ L++QLET +     
Sbjct: 1116 EQEWQQKIETYQQESEKWKLMCQQMSE-----------NTATEIQNLQQQLETFKADIQL 1164

Query: 1174 ---ENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQ 1230
               EN  L DRF RLKKQAHEKL+A+K    +L  +++EL      L++ L      NNQ
Sbjct: 1165 KTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKL------NNQ 1218

Query: 1231 SGNGAADESEE--IIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYEN 1288
              N    ES    I++L+ E +++ +   EL   V+ ++K    I  +  EL ++K  EN
Sbjct: 1219 ETNSVDSESNAALILQLKEENKQAKSLELELRHSVDSSEKL---IADMTKELTTLK--EN 1273

Query: 1289 STVNSKIIKD-------LKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANG 1341
                S  ++D       LK  F+ EK  LIE+   E   + E+EK+ ++    NN     
Sbjct: 1274 PIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFEREKKELM----NN----- 1324

Query: 1342 QESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFE 1401
              +AN+EEL+K  EEE E   L+RI EA+ENLKK +RLP+EEKI  VI KR+  LE++F+
Sbjct: 1325 --NANLEELRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQ 1382

Query: 1402 TKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAE----IKKKAFEEGKQQSMMKSTL 1457
            TK+ E       + +   T  ++EKE+RE+    L E    +KKKAFEEG+QQ+ MK+TL
Sbjct: 1383 TKVAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTL 1442

Query: 1458 LERKLSKLESQ---TLSPTKN-NDSNETQVPSKINLSNINSSSPPLGEK 1502
            LERK++KLE++      P K+ N  N+  + S + ++   ++ P L EK
Sbjct: 1443 LERKIAKLEARLQGGTGPLKSANGLNKINIDSPLMVAGPLTNEPVLDEK 1491

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  258 bits (659), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 201/514 (39%), Positives = 295/514 (57%), Gaps = 48/514 (9%)

Query: 1060 EEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVA 1119
            E+++E   +L  L ESN  L    E   K N  L  +L  ++ ++ PLE E+N L   V 
Sbjct: 1226 EKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEELNQLRERILPLESELNTLHTSVL 1285

Query: 1120 EKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLT 1179
            EK+Q LN+ +EE  RWK RSQ IL +   ++ E H +  EK+  LE +L+    EN +L 
Sbjct: 1286 EKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELD 1345

Query: 1180 DRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE---IEKNNQSGNGAA 1236
            DRF+RLKKQAHEKL+++K  Q  L+ Q+NEL E K  LE   + E   + +  +  N   
Sbjct: 1346 DRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHG 1405

Query: 1237 DESEEIIRLRAELEKSNNFSNELEKKV--------EDAKKFKNEIESLKSELQSVKAYEN 1288
            +++E +  ++ EL  +   S ELE+ +        E  KK  +EI+SLK EL S+K    
Sbjct: 1406 NDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSA 1465

Query: 1289 STVNSKIIKDLKESFKREKDELIEQMKKEFK------TKLEKEKETILAQRKNNILANG- 1341
            +T   +I +DL          ++E M++ F+       K + E+   L + K+ +  NG 
Sbjct: 1466 ATAKGEISEDL--------SNVVESMRRSFEEEKINFLKEKTEELKKLEEEKHTLQVNGN 1517

Query: 1342 ---QESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQ 1398
               Q+  N EE+K++WE EQE  ILKRI EAEENLKKR+RLP+EE+I  V+EK++  LE+
Sbjct: 1518 EPQQQPVNYEEIKRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEE 1577

Query: 1399 EF---ETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKS 1455
             +     + +    ++DGN   +D + Q+EK+L+EKF  E+  +KKKAFEEGKQQ+ MKS
Sbjct: 1578 LYKKKLEESKSSLESSDGNN--SDLKKQLEKDLQEKFEAEVQAVKKKAFEEGKQQAAMKS 1635

Query: 1456 TLLERKLSKLESQTLSPTKNND--SNETQ------VPSKINLSNI--NSSSP-PL--GEK 1502
            TLLERK+SKLESQ      + D  S+ET       +PSKI+  ++  N S P PL  GEK
Sbjct: 1636 TLLERKISKLESQLHGKVDSPDKSSSETSSVPKPNLPSKIDEKSVTTNQSVPNPLVSGEK 1695

Query: 1503 VLQLNYGANVVAETD-NDDNPFTLQSGKDETLLT 1535
            VL+L+        +  +  NPFT     ++T+ T
Sbjct: 1696 VLKLDPSKPTFNFSSFSGGNPFTSSPQNNDTMGT 1729

 Score =  220 bits (561), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 210/663 (31%), Positives = 348/663 (52%), Gaps = 102/663 (15%)

Query: 2   STDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYD---LMKENSFVSAAID 58
           S D+ N+ +   + K+S+F+ +P +    +D   L  +  K  D   L  +N  ++  ID
Sbjct: 14  SGDNHNDVS---LGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTID 70

Query: 59  DIKHVYEGKINTISQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEIT 118
           +IK V   +   +  +  NL  +N  ++ + S       +   +KQK             
Sbjct: 71  EIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQK------------- 117

Query: 119 LIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQ 178
            I+ ++E++Q   + L+ +ER+T   L+Q K E+             + V E K+    +
Sbjct: 118 -IQNEVESLQEKLSDLD-QERET---LKQDKREV-------------VAVLEEKI----K 155

Query: 179 ELWLANTENKKLQTGMKLLRENNLYLE-----IKCKETDKNKKLYSSAEDASRLQ----- 228
           EL    TE++K     K LR+  L LE     +K KE     ++ +  +  + LQ     
Sbjct: 156 ELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTITQRLTILQKNSQW 215

Query: 229 --------------------DQLQIVSSEILSLKSEI-------ATLKYMNESLSTDLQR 261
                               D+L  ++SE LS K+E+         +   NE L+  LQ 
Sbjct: 216 LEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQE 275

Query: 262 KLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASY---------KKQIERLTSKN 312
           KL  +KDL D+L   KQEFA E+++KQ++ +LL N++ S          K  +E L S  
Sbjct: 276 KLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDKDNVELLASGE 335

Query: 313 LETPEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKK--------LISKFGNPK 364
             T  +K+IQEL+ LKE    SE+E   L++ V + I  D+ +         IS      
Sbjct: 336 RNTENEKLIQELITLKENFEESERERLRLEALVQELIPGDDSQDDINNTSSFISLRNKDS 395

Query: 365 KL--IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSS 422
            L  + IL+++L+KE+  K+ LQRQVESF+VELE K+P+I+SFKER S LE+EL  +   
Sbjct: 396 SLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALL 455

Query: 423 LEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI----DNKSPF 478
           L+ T+ E++ ++RE   L KK+ ++E     L RQR+DLAHQVQ+LL+ I    D+    
Sbjct: 456 LDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLL 515

Query: 479 TEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLER 538
           + +E + +K+IV+N++  +++DS ++IS+RL+ F N+  LQ+KNMELL+T R+L + LE 
Sbjct: 516 SAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLES 575

Query: 539 QEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVTNSTIQS 598
           +E++  K ++  +N+ I E AK   V L+ +   LESK+ I+++E D++K + + +    
Sbjct: 576 EEKDVNKKIQTFENDTIKE-AKEAIVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQ 634

Query: 599 NTS 601
           N S
Sbjct: 635 NGS 637

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  250 bits (639), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 185/499 (37%), Positives = 287/499 (57%), Gaps = 44/499 (8%)

Query: 1060 EEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVA 1119
            E++ME   ++  L ESN  L   V    + N  L S+L  +Q K+ PL  E++E +  + 
Sbjct: 1213 EDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELSECRQSIE 1272

Query: 1120 EKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLT 1179
            EK+Q + +  +E +RWK RS  IL++ + ++ E + K  E+I  L+++LE    EN  L 
Sbjct: 1273 EKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKSKENTDLN 1332

Query: 1180 DRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE-----------IEKN 1228
            DRF RLKKQAHEKL+A+K  Q NL+ ++NEL  TK  +E+ L++             E++
Sbjct: 1333 DRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTERD 1392

Query: 1229 NQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVED--------AKKFKNEIESLKSEL 1280
            ++S N           LR EL+ +     E+E K+ +          +   EI SLK ++
Sbjct: 1393 SESANNED--------LRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQV 1444

Query: 1281 QSVKAYEN-STVN-----SKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRK 1334
            +  K  EN ST+      S +++ +K++F+ EK + I++  +E+  K E+EK  + ++  
Sbjct: 1445 RIFKEKENDSTLEGSQGLSNVVESMKKAFEEEKIKFIQEKTEEYNKKFEEEKAKLSSE-- 1502

Query: 1335 NNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRK 1394
            N   A    + ++  LKK+WEEE EA+  +RI EAEENLKKR+R+P+EE+I  V++KR+ 
Sbjct: 1503 NGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKT 1562

Query: 1395 VLEQEFETKLRELGLNADGNGV--VTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSM 1452
             LE+EF+ +L+E  L  +G       + + Q+E E   K+   LA  KKKAFEEGKQQ+ 
Sbjct: 1563 ELEEEFQRRLKENNLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAA 1622

Query: 1453 MKSTLLERKLSKLESQTLS---PT-KNNDSNETQVPSKINLS---NINSSSPPLGEKVLQ 1505
            MKSTLLERK+SKLESQ  S   PT +   +    +P+KI+ S   N+ + +P  GEKVL+
Sbjct: 1623 MKSTLLERKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLK 1682

Query: 1506 LNYGANVVAETDNDDNPFT 1524
            L+       +  +  NPFT
Sbjct: 1683 LSDKPAFSFQPSSKSNPFT 1701

 Score =  209 bits (532), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 167/506 (33%), Positives = 297/506 (58%), Gaps = 35/506 (6%)

Query: 120 IKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDS-------LTENSALKEQIGVFEGK 172
           +K++L+        L++ +++   +LE+   EL+ S       + +N  L++Q+   + +
Sbjct: 121 VKFELQNTIEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNE 180

Query: 173 LDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYS-SAEDASRLQDQL 231
           + ++        +E + ++  + +L ++N +LE +   T K ++L     E+ + LQ  L
Sbjct: 181 VQTLKCNGLGDKSELEIVKQQVGMLTKSNEWLEKEV--TSKTEQLIKYRQENDTELQKSL 238

Query: 232 QIVSSEILSLKSEIATLKYM---NESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQ 288
           Q V+      + E ++ +++   N+ +S DLQ KL+ IK L D LN+ KQEF++E++LKQ
Sbjct: 239 QEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQ 298

Query: 289 RVNELLHNEIASYKKQIERLT--------SKNLE-TPEKKIIQELVDLKEKLVNSEKECN 339
           ++ +L   ++ S+K+++ RLT        + NL+ T + + + +L  ++++L  S  E  
Sbjct: 299 KLLDLQDEQLQSFKEEL-RLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERL 357

Query: 340 ELKSTVDKYINIDEKKLISKFGN---PKKL--IEILRRQLVKEKRHKDTLQRQVESFLVE 394
            L++ V++ +   E+  +    N   PK    I +L++QL+KE+  K+ LQRQ+ESF+VE
Sbjct: 358 RLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVE 417

Query: 395 LEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDEL 454
           LE K+P+I+S KER+ +LE+EL  I   LE T+ E++ K REL +   KI   E     L
Sbjct: 418 LEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTL 477

Query: 455 LRQRSDLAHQVQYLL----LCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLL 510
           +RQRSDLA QVQ+LL    L  D++ P T  E   +KKI+ NEN  N++DS  II++RL+
Sbjct: 478 IRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLV 537

Query: 511 HFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITD-NNKIVESAKSTSVDLEKH 569
            F+++  LQ++N ELL+T R L   LE  E+E+   +RI     K ++ AK   + L++ 
Sbjct: 538 EFKDIATLQERNTELLKTARTLADRLE--EEEKNSNIRIDSLERKTIDEAKEAIITLQER 595

Query: 570 IKTLESKINIISQERDSYKLLVTNST 595
              +ESK++ I +ERD+YK +++ ++
Sbjct: 596 NSEIESKVSTIEKERDAYKAILSQTS 621

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
           similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  246 bits (628), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 236/713 (33%), Positives = 384/713 (53%), Gaps = 79/713 (11%)

Query: 1   MSTDSRNEPTPSI-IDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMK---ENSFVSAA 56
           MS    ++ + S+   K+++F ++     + +DE  +   + KA +  K   +N  +S +
Sbjct: 1   MSQRGASDSSISVDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSIS 60

Query: 57  IDDIKHVYEGKINTISQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSE 116
           ID +K  +E KINT     F  Q+E  KL    +     +++   EK K  +    L+ E
Sbjct: 61  IDGLKCNFEQKINT-----FKEQVE--KLLSDVASRQQEKQQTEDEKLKLMNEKAQLSME 113

Query: 117 ITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDS-------LTENSALKEQIGVF 169
           +  ++  +E  ++    + + ++    +LE+   +L  S       L  N  L++     
Sbjct: 114 VLKLRSQVEEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDL 173

Query: 170 EGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETD-KNKKLYSSAEDASRLQ 228
           E  +     +     +E ++L   + L++ N  +L    KE + KN++L S  E   +  
Sbjct: 174 EFIIQGYKSQELREKSEIQRLHQELNLVKSNADWL---SKELESKNEQLNSFRE---KTN 227

Query: 229 DQLQIVSSEILSLKSEI-------ATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFA 281
            +LQ    ++ SLKS++       +TLK     LS  LQ KL   K L D LN+ K+EF 
Sbjct: 228 SELQNGYEQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFT 287

Query: 282 KEITLKQRVNELLHNEIASYKKQIE----RLTSKNLETPEK-KIIQELVDLKEKLVNSEK 336
           +E++LKQR+ +LL ++++S K  +E          + TPEK +++ EL+D K+ L  ++ 
Sbjct: 288 REMSLKQRLIDLLESQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQA 347

Query: 337 ECNELKSTVDKYI-------------NIDEKKLISKFGNPKKL---IEILRRQLVKEKRH 380
           E  +L++TV++ +             N+ +  L SK     KL   I IL++QLV+E+R 
Sbjct: 348 ENIKLEATVNELLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQ 407

Query: 381 KDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNL 440
           K+ LQ QVESF+VELE K+P+++SFKER   LEREL  +T  LE TAK+RD K  EL   
Sbjct: 408 KEELQNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQY 467

Query: 441 QKKISNNEQFNDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTE 496
           + KI+N E     L+ QRSDLAHQVQYLL+ +    D   P TE+E   VK+I+S+E+  
Sbjct: 468 KNKINNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEA 527

Query: 497 NDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIV 556
             +D+  IIS+RL+ F++V ELQ KN ELL T RQL   LE +E++ +  L+  +  + V
Sbjct: 528 PKSDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVE-TQTV 586

Query: 557 ESAKSTSVDLEKHIKTLESKINIISQERDSYKLL---------VTNSTIQSNTSNNSISS 607
           + AK   + L++H++ LE ++ I+S+ERD++KL            +ST QS   +  I  
Sbjct: 587 KEAKEAILSLQEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHI-- 644

Query: 608 LQQCELEKERLTNELSSMKQQHVKVLEELENKIKTL--QKSQLTSKMEVEKHA 658
               ELEK RL N L+   Q ++K+   L ++IK L   KS++T  +E E+ +
Sbjct: 645 ---MELEK-RLKN-LAEQSQDNIKL---LNDEIKALYKAKSEVTVILEQERSS 689

 Score =  209 bits (531), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 236/786 (30%), Positives = 392/786 (49%), Gaps = 122/786 (15%)

Query: 872  SFLANSVSQLQGKEKELNELKSKLVEKTEKLQMAENENSEKINNA--------------- 916
            S L   +S LQG ++ L+ELKS+  EK  KLQ    + +   N A               
Sbjct: 1003 SELIKKLSILQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVT 1062

Query: 917  --IVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLE 974
              I LL+   EE+  +K   + FK S S  + A+   +Q      ++  +++  A +R E
Sbjct: 1063 KTISLLR---EESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTE 1119

Query: 975  EAEVKMASFDGKVTEILESYDGKILNTAAIGHLVRSLI------------------HEKK 1016
            E   +      +V  + ++        A++    R LI                   E+K
Sbjct: 1120 ELNTQNRLLYDQVELLSKATSSDSEAAASMSAESRELIMTLRRERDILETKLDVSIREEK 1179

Query: 1017 MLALNLNSANYSLRRARYRNKNPREKFPS--FVKIDQQSKKEEDKEEVMENTTKLLALEE 1074
            +L   L  A   L   R      +   P   F +        E +E++ME   +L  L E
Sbjct: 1180 ILRQRLGLAKTELENVRLEFSKTQATAPDSIFAR--------ESQEQIMEKLNQLNLLRE 1231

Query: 1075 SNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELER 1134
            SN  L  E +   + ++   +++A +Q +L+PLE ++  L + ++E++Q +++ +EE  R
Sbjct: 1232 SNVTLRNESKKYLEQSQHFQNEIAKLQEQLQPLESQLKSLTITISERDQQISLLKEESSR 1291

Query: 1135 WKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLD 1194
            WK RSQ IL + + ++   H K  +++  L+ +LE    EN +  +RF +L+KQA+E+LD
Sbjct: 1292 WKQRSQDILHKYERIDPVEHQKLADEVTELKNELEKKSLENLESQERFRKLRKQANERLD 1351

Query: 1195 AAKTMQINLTTQINELNETKVNLEKSLQQEIEK----------NNQSGNGAADE-SEEII 1243
              K  +  + ++   ++  K  LE  L Q ++K          +    NG AD   EE+ 
Sbjct: 1352 EFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKVSELESKLSSSANEKNGEADSLKEELE 1411

Query: 1244 RLRAELEKSNNFSNELEKKVEDAKK-FKNEIESLKSELQSVKA-YENSTVNSK------- 1294
             LRA   ++N    +++ +   ++K  KN+I+ L  +++++++  E+S + +K       
Sbjct: 1412 ELRANFIEANEAVADIKAEAASSEKDLKNQIQELTEKIKTLESEIEHSELEAKNSNDSPD 1471

Query: 1295 ---IIKDLKESFKREKDELIEQMKKEFKTKLEK-------EKETILAQRKNNILANGQES 1344
               I++++K+ F+ EK  LI++  +E + KLE+       E+E  L++ K +++ +   +
Sbjct: 1472 FAPIVENMKKKFEEEKQVLIQEKDEELRMKLEEIQKQYEEERERELSELKASLVESTPNA 1531

Query: 1345 ANIEE--LKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFET 1402
              I+E  LK K E E E   L+RI EAEE LKKR+RLPSEE+IN VIE+R++ L+QEFE 
Sbjct: 1532 PLIDEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFEL 1591

Query: 1403 KLRELGL---NADGNGVVTDTRAQIEKE-------LREKFNLELAEIKKKAFEEGKQQSM 1452
            ++R   L     +    V DT A++ KE       L  KF+ +LA ++KKAFEEGKQQ +
Sbjct: 1592 RVRARALELFKENPESFVGDT-AKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLV 1650

Query: 1453 MKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKINLSNINSSSP----PLGEK--VLQL 1506
            MK  LLE K++KLE Q   P K N +N   VPSKI + N N+SSP    P+  K    Q+
Sbjct: 1651 MKVKLLESKIAKLEGQ---PNKINLNN--SVPSKIPIDNNNNSSPQGAQPIAIKPSPFQV 1705

Query: 1507 NYGANV------------------VAETDNDDNPFTLQSGKDETLLTKRSADNEIIQDII 1548
             +G  +                  +A T  D +  TL +G   T   KR +++E+ Q   
Sbjct: 1706 AFGKAMENTSFGSFKGSLLDSKQFIANT-ADTSTSTL-TGNVGTNTNKRQSEDELAQSPE 1763

Query: 1549 KRPKEE 1554
            KRPK++
Sbjct: 1764 KRPKDD 1769

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  231 bits (589), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 196/556 (35%), Positives = 300/556 (53%), Gaps = 51/556 (9%)

Query: 1014 EKKMLALNLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEEDKEEVMENTTKLLALE 1073
            E K L L L+S N  L   R +    R+++ +  KI       E+ + +M    +L  L 
Sbjct: 1150 EGKALRLKLSSVNTELTNTRAKLTEIRQQYEN-TKISV-----EEHDNIMNQLNQLNLLR 1203

Query: 1074 ESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELE 1133
            ESN  L  E  +  +  + L   L  ++ K+ PLE E N LK  + E EQ LN  +EE  
Sbjct: 1204 ESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECN 1263

Query: 1134 RWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKL 1193
            RWK RSQ IL + K ++   H K   +I TL++ L   + EN +L DRF+R+KKQAHE+L
Sbjct: 1264 RWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERL 1323

Query: 1194 DAAKTMQINLTTQINELNETKVNLEKSLQQE---IEKNNQSGNGAADESEEIIRLRAELE 1250
            +++K  Q  L  QI +L +   +++  L+ E   I+   +       +SE++  LR++LE
Sbjct: 1324 NSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLE 1383

Query: 1251 KSNNFSNELEKKVEDAKKFKNE--------IESLKSELQSVKAYEN--STVN-----SKI 1295
            ++   S E E K   + K  +E        I+SL +EL  +K  +N  +TV      S +
Sbjct: 1384 EALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNV 1443

Query: 1296 IKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQESANIEELKKKWE 1355
            ++++K+SF+ EK + ++    EFK KL +E + I AQ  +    N     +I   +++WE
Sbjct: 1444 VEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDISAQREQWE 1503

Query: 1356 EEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKL----RELGLNA 1411
            +E E ++LKRI +AEENLK+R+RLP+EEKIN+VI+K++  LE+E++ K+    +EL  + 
Sbjct: 1504 KEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSE 1563

Query: 1412 DGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLS 1471
            +    + D +  I+KEL    + EL   K KAFEEGKQQ+MMK+T LE+K+SKLESQ   
Sbjct: 1564 ENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQG 1623

Query: 1472 PTKNND------------SNETQVP-------SKINLSNINSSSPPL--GEKVLQLN--Y 1508
                N+            S+E  VP       SK  LS I  ++P L  G   L LN   
Sbjct: 1624 SNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSR 1683

Query: 1509 GANVVAETDNDDNPFT 1524
              + +    +  NPFT
Sbjct: 1684 APSSLQNGSDSSNPFT 1699

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
           YKR095W (MLP1) - colied-coil protein (putative), similar
           to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  223 bits (568), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 189/613 (30%), Positives = 319/613 (52%), Gaps = 40/613 (6%)

Query: 15  DKISSFFDLPGNTWESMDEHALEKIYTKAYD---LMKENSFVSAAIDDIKHVYEGKINTI 71
           D ++SF +L      ++      +I  K  +   L  EN   S  ID+++     K+   
Sbjct: 19  DAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGAC 78

Query: 72  SQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDH 131
             +  +L  E + ++ +       R +  +E+Q+  + +D L +         EA+++  
Sbjct: 79  KDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARN-------EALEQQK 131

Query: 132 TTLEARERKTENVLEQS-------KLELQDSLTENSALKEQIGVFEGKLDSMTQELWLAN 184
             LEA +     +L +        + E +  L E   L++Q    EG+      E     
Sbjct: 132 QVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHK 191

Query: 185 TENKKLQTGMKLLRENNLYLEIKCKETDKNKKLY---SSAEDASRLQDQLQIVSSEILSL 241
            +  +L   + LL  NN +LE +  + +     Y   + +E AS +  +L+    ++ + 
Sbjct: 192 ADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELAS-VSQRLETCEGDLQAA 250

Query: 242 KSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASY 301
              I TL+  N    ++L+ +   +K L D L S+KQEF +E++LKQR+ ELL  ++++ 
Sbjct: 251 TKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSAL 310

Query: 302 KKQIERLTSKNLET------PEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKK 355
           K ++E   S    T       + +I  ELV   ++L  SE +  +L+ TV++ ++ DEK 
Sbjct: 311 KSELEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKT 370

Query: 356 LISKFGNPKKL--IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLE 413
           +      P     I IL++Q++ E+R K+ LQ QVE+F+VELE K+PM+ SFK+RN  LE
Sbjct: 371 ISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLE 430

Query: 414 RELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI- 472
           +EL      L+  +K++D    +L   + +I + E     L +QRSDLA QVQYLL+ + 
Sbjct: 431 KELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVT 490

Query: 473 ---DNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTT 529
              D+  P + +E   VKK+V+ ENT+ D D+  IIS+RL+ F+N+ ELQ KN +LL T 
Sbjct: 491 VRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTV 550

Query: 530 RQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKL 589
           R L   LE +E++ +      +N+ I E AK   V L+ HI+ LE++I++I++ERD+YK 
Sbjct: 551 RNLANQLETEERKVKSKTEAIENDTITE-AKEAIVTLQDHIQELETRIDVITRERDAYK- 608

Query: 590 LVTNSTIQSNTSN 602
                 IQS TS+
Sbjct: 609 -----AIQSQTSH 616

 Score =  169 bits (427), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 157/465 (33%), Positives = 256/465 (55%), Gaps = 55/465 (11%)

Query: 1045 SFVKIDQQSKKEEDKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKL 1104
            S V  D +S   E+  +++E   ++  L ESN  L  E++  ++ N+ L   + ++Q  L
Sbjct: 1193 SQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEAL 1252

Query: 1105 EPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTL 1164
            +PLE +I  L+  V  K++ +++  EE+ RWK RSQ IL + + V+ E H K  E++   
Sbjct: 1253 KPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQA 1312

Query: 1165 EEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE 1224
              +      + ++L DRF RLKKQA E+LD A+T Q  L  ++ E  E++  LE +L +E
Sbjct: 1313 RAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKE 1372

Query: 1225 IEKNN--QSGNGAADESEEIIRLRAELEKSNNFSNELE---KKVEDAKKFKNEI------ 1273
             EK    Q    A +E+        E+E S+   ++L+   +K+EDA+   NE+      
Sbjct: 1373 REKTRSLQESIKATEEN--------EIENSSATRDQLQDALQKLEDAQARINEMSTAPSQ 1424

Query: 1274 --ESLKSEL----QSVKAYENSTVNS----KIIKDLK-------ESFKREKDELIEQMKK 1316
              ++L+ EL    Q VK  E     +    +++++ K           R K ELI+   K
Sbjct: 1425 EEQTLREELERTRQHVKQLEEHLAKTQNEVRVLEEAKNQVSGTEAEIARVKTELIDHSNK 1484

Query: 1317 -------EFKTKLEKEKETILAQRKNNILAN-GQESANIEELKKKWEEEQEALILKRITE 1368
                   E K K EK++    A+ + ++ ++   +S++IE LKK+WEEE E   +KRI E
Sbjct: 1485 LLAEKEAEIKEKYEKQRLEDKAELEKSLASSESLKSSDIENLKKEWEEEYEQRTIKRIEE 1544

Query: 1369 AEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLR--------ELGLNADGNGVVTDT 1420
            A E L+KR+RLP+EEKIN +IE R++ L++EFE KL+        E  L A    V+   
Sbjct: 1545 ANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATFTEVMKRH 1604

Query: 1421 RAQIEK---ELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKL 1462
            + ++EK   +++ + + E+A+ KKKAF+EGKQQ+ MKS  LE+K+
Sbjct: 1605 KQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLEKKI 1649

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
           MLP2Myosin-like protein associated with the nuclear
           envelope, connects the nuclear pore complex with the
           nuclear interior; involved in the Tel1p pathway that
           controls telomere length
          Length = 1679

 Score =  216 bits (551), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 236/765 (30%), Positives = 387/765 (50%), Gaps = 89/765 (11%)

Query: 15  DKISSFFDLPGNTWESMDEHALEKIYTKAYDLMK---ENSFVSAAIDDIKHVYEGKINTI 71
           DKIS F ++P  + + +    L K+Y K     +   E + ++  +D+IK  Y  +I+ +
Sbjct: 3   DKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKL 62

Query: 72  SQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRD- 130
            Q           L E       A+E+L   K       D LN E +  + +++A+++  
Sbjct: 63  KQ----------LLDESSEQKNTAKEELNGLK-------DQLNEERSRYRREIDALKKQL 105

Query: 131 HTTLEA-------RERKTENVLEQSKLELQDSLT-----ENSALKEQIGVFEG------- 171
           H + EA       +  K E  + QS+ +  DSL      EN  L+ ++   E        
Sbjct: 106 HVSHEAMREVNDEKRVKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKS 165

Query: 172 -------KLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDA 224
                  K D+  QE  L     K ++  +    +  L  E+            + +   
Sbjct: 166 NAISLQLKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEV------------TKSSHV 213

Query: 225 SRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEI 284
             L+++L  + S   S+ +    L   N+ LS  ++ K+  +K+L D  +  K EF+KE+
Sbjct: 214 ENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEM 273

Query: 285 TLKQRVNELLHNEIASYKKQ-----IERLTSKNLETPEKK-IIQELVDLKEKLVNSEKEC 338
           TL++ +N+LL +++ S +K      IE+    +   PE   +I EL+D K +L  S+ EC
Sbjct: 274 TLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNEC 333

Query: 339 NELKSTVDKYINIDEKKLISKFGNP--KKL---IEILRRQLVKEKRHKDTLQRQVESFLV 393
             L++ V      +E  + +   +P   KL   I++L+RQL+KE+  K  LQ Q+E F++
Sbjct: 334 QRLQNIVMDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFIL 393

Query: 394 ELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDE 453
           ELE K P + SFKER  SLE EL R T  LE  +  +  ++RE+T+L++KI+  E     
Sbjct: 394 ELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHS 453

Query: 454 LLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRL 509
           L++QR DLA QV+ LLL      +  SP ++ E   ++KI+ + N  N+ DS  II++RL
Sbjct: 454 LVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERL 513

Query: 510 LHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKH 569
           + F NV ELQ+KN+ELL   R L   LE  E +Q KTL+  +N  I E AK   ++LE  
Sbjct: 514 VEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKE-AKDAIIELENI 572

Query: 570 IKTLESKINIISQERDSYKLLVTNSTIQSNTSNNSISSLQQCELEKER-LTNELSSMKQQ 628
              +E++INI+ +ERDSYKLL +    ++NT  NS++S++    +K R L  ELSS K +
Sbjct: 573 NAKMETRINILLRERDSYKLLASTEENKANT--NSVTSMEAAREKKIRELEAELSSTKVE 630

Query: 629 HVKVLEELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQD 688
           +  +++ L  ++   +KSQ   K  +E    +F+  K    L KE    LE  I  L+ +
Sbjct: 631 NSAIIQNLRKELLIYKKSQCKKKTTLE----DFENFK---GLAKEKERMLEEAIDHLKAE 683

Query: 689 LAENELFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLK 733
           L +    +K+ +   ++  ++    ELS +  KI  L+ EIS LK
Sbjct: 684 LEK----QKSWVPSYIHVEKERASTELSQSRIKIKSLEYEISKLK 724

 Score =  149 bits (375), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 148/448 (33%), Positives = 236/448 (52%), Gaps = 48/448 (10%)

Query: 990  ILESYDGKILNTAAIGHL-----VRSLIHEKKMLALNLNSANYSLRRARYRNKNPREKFP 1044
            ++E  D    N     HL       +L HE+  L   L +    L   + +N +  +   
Sbjct: 1081 LIEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTIN 1140

Query: 1045 SFVKIDQQSKKE--------EDKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQ 1096
               +    S+KE        ++ +++ +  T++  L+E+NA L K ++N T+ N  +  Q
Sbjct: 1141 DLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQ 1200

Query: 1097 LADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMK 1156
            L D Q ++  L++++ + K +V+     + + + E+E+ K R Q + QQ K    +A  K
Sbjct: 1201 LNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQK----DAQKK 1256

Query: 1157 SLEK----IKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNE 1212
             +EK    I  L+ +L +    NA L ++F+RLKKQAHEKLDA+K  Q  LT ++NEL  
Sbjct: 1257 DIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKA 1316

Query: 1213 TKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNE 1272
             K  LE+ L  E        N    + +   +L+A   +S + S + EK  +  +    E
Sbjct: 1317 IKDKLEQDLHFE--------NAKVIDLD--TKLKAHELQSEDVSRDHEK--DTYRTLMEE 1364

Query: 1273 IESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQ 1332
            IESLK ELQ  K   +S   S   + LK + ++EKD +I++  KEF+ KL+   ET+   
Sbjct: 1365 IESLKKELQIFKTANSS---SDAFEKLKVNMEKEKDRIIDERTKEFEKKLQ---ETL--- 1415

Query: 1333 RKNNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKR 1392
               +  +  + S +IE LKK+W +E E   L+RI EAEENLKKR+RLPSEE+I  +I KR
Sbjct: 1416 -NKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISKR 1474

Query: 1393 RKVLEQEFETKLRELG-----LNADGNG 1415
            ++ LE+EF  KL+E       L+  G+G
Sbjct: 1475 KEELEEEFRKKLKENAGSLTFLDNKGSG 1502

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  214 bits (545), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 190/562 (33%), Positives = 300/562 (53%), Gaps = 70/562 (12%)

Query: 1058 DKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLK 1117
            D+EE+M    +L  L ESN  L  E +   + +  L ++L  +  K++PLE ++  L+  
Sbjct: 1219 DQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNS 1278

Query: 1118 VAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQ 1177
            V EK+  +++  EE ERWK RSQ IL + + ++ E H K  +K+  L++++++   EN +
Sbjct: 1279 VREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEE 1338

Query: 1178 LTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQ-------------E 1224
            L  RF RLK+QAHEKL+AAKT Q  LT+Q+N+L  TK  LE  L               +
Sbjct: 1339 LDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITD 1398

Query: 1225 IEKNNQSGNGAADESEE-----IIRLRAELEKSNNFSNELEKKV-EDAKKFKNEIESLKS 1278
            IEKN  S      E  E     ++    +LE+  + S  LEK++ E  +   N+I+ L+ 
Sbjct: 1399 IEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLEE 1458

Query: 1279 EL------------QSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEK 1326
            +L            QS +  EN+   SKI+++LK  F+ EK ++I   + E + + E+EK
Sbjct: 1459 DLEKAKTESPNDGSQSSELVENT---SKIVENLKIEFEEEKAKMISDKESELREQFEEEK 1515

Query: 1327 ETILAQRKNNI---LANGQ--ESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPS 1381
             +IL  ++  +   LA  +     NI+E+KKKWEEE E    +RI E+ E LKKR+RLP+
Sbjct: 1516 ASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPT 1575

Query: 1382 EEKINAVIEKRRKVLEQEFETKLRELG---------LNADGNGVVTDTRAQIE---KELR 1429
            EEKIN ++EK+R  LE EFE  +++            N++   V+   +  +E   +E++
Sbjct: 1576 EEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVLEKHKQDLENLKQEMQ 1635

Query: 1430 EKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ-----TLSPTKNNDSNETQVP 1484
            +KF+ ++A+IKK+AFEEGKQQ+ MKST LE+K++KLE+Q     +  P  N++S+ T   
Sbjct: 1636 KKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAIPI-NDNSSATPAE 1694

Query: 1485 SKINLSNINSSSP------------PLGEKVLQLNYGANVVAETDND-DNPFTLQSGKDE 1531
            S     ++   +P            PL        +G      T N   NPF  Q  +  
Sbjct: 1695 SGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFGMPFGQTTSNSFQNPFNSQPPEQT 1754

Query: 1532 TLLTKRSADNEIIQDIIKRPKE 1553
                KR ++  +     K+PKE
Sbjct: 1755 PNSPKRPSEEPVGGSPEKKPKE 1776

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
           YIL149C (REAL)
          Length = 1680

 Score =  213 bits (543), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 249/801 (31%), Positives = 407/801 (50%), Gaps = 79/801 (9%)

Query: 15  DKISSFFDLPGNTWESMDEHALEKIYTKAYDL---MKENSFVSAAIDDIKHVYEGKINTI 71
           DKIS F  +P  +   +   AL+++Y K  +     KE + ++  +D+IK  Y  +I+ +
Sbjct: 3   DKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKL 62

Query: 72  SQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEI-----TLIKY-DLE 125
           + K  N   E K +  K    L  +++L  E+ +     DALN ++     T+ K  D E
Sbjct: 63  T-KLLNESSEEKVINSKVMNRL--QDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEE 119

Query: 126 AMQRDHTTLEARER---KTENVLEQSKLELQDSLTEN----SALKEQIGVFEGKLDSMTQ 178
             + + ++ +   R    T++VL++    LQ  L E        K      + K D+ +Q
Sbjct: 120 GAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQ 179

Query: 179 --ELWLAN---TENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQI 233
             ELWL N   TE +      K L            E  K   L +       L+++L  
Sbjct: 180 EKELWLQNKKWTEERLSSCNQKAL----------VDEVTKTSYLQN-------LEEKLNQ 222

Query: 234 VSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNEL 293
             +E  S+ +    L   N+ LS  ++ KL  IK+L D  N+ K EF+KE+TL++++N+L
Sbjct: 223 TQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDL 282

Query: 294 LHNEIASYKKQI-----ERLTSKNLETPEK-KIIQELVDLKEKLVNSEKECNELKSTVDK 347
           L +++ S+++       E+   K  + PE   + +EL+D K KL  S++EC  LK+ V  
Sbjct: 283 LRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSD 342

Query: 348 YINIDEKKLISKFGNP--KKL---IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMI 402
            I  +   + +    P   KL   I+ L+RQLVKE+  K  +Q Q++ F++ELE K P +
Sbjct: 343 CIEENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPAL 402

Query: 403 DSFKERNSSLERELLRITSSLEET---AKERDIKDRELTNLQKKISNNEQFNDELLRQRS 459
            SFKER   LE E L+ ++ L ET   AK +D  +++LT+L++KI++ E     L+RQR 
Sbjct: 403 VSFKERTELLEHE-LKCSTELLETMSLAKRKD--EKKLTSLEQKINSYEANIHSLVRQRL 459

Query: 460 DLAHQVQYLLLCID----NKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNV 515
           DLA QV+ LL  I       SP +  E   ++K++ +ENT N+ DS  II+++L+ F+N+
Sbjct: 460 DLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNI 519

Query: 516 KELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLES 575
            ELQ+KNMELL   R L   LE  E E  KT+   +N  I E AK   +++E     L  
Sbjct: 520 DELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKE-AKEAIIEMESINSKLAL 578

Query: 576 KINIISQERDSYKLLVTNSTIQSNTSNNSISSLQQCELEKE--RLTNELSSMKQQHVKVL 633
           ++NI+++ERDSYKLL   ++   N ++     + +   EK+   L ++LSS + +   ++
Sbjct: 579 RVNILTRERDSYKLL---ASANDNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAII 635

Query: 634 EELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENE 693
           + L  ++ T +KSQ   K+ +++    F+  K    L+ E    L+ +I  L+  L +  
Sbjct: 636 QNLNGQLLTYKKSQTDGKIALQE----FENFKV---LVAEKEAMLQERINHLKTQLEKQR 688

Query: 694 LFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLL 753
           L         V + + S + +LS +E KI  L  EISNLK +N  L     ++T      
Sbjct: 689 LS----AAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERC 744

Query: 754 DNKVLQLETSLSERELPKNTQ 774
             + +QL   LSE E   N Q
Sbjct: 745 CKEKMQLHVKLSESETSHNEQ 765

 Score =  154 bits (388), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 142/418 (33%), Positives = 224/418 (53%), Gaps = 48/418 (11%)

Query: 1007 LVRSLIHEKKMLALNLNSANYSLRRARYRNKN--------------PREKF--PSFVKID 1050
            L  +L HE+  L   L +    L   R +N +              PR K   P+ + ID
Sbjct: 1104 LFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNKVQCPAVI-ID 1162

Query: 1051 QQSKKEEDKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQE 1110
            +        E++++   ++  L E+NA L K ++N T+ NE +  +L +MQ ++  L+  
Sbjct: 1163 EY-------EKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGH 1215

Query: 1111 INELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLET 1170
            + + K +V+     +   + E+E+ K R Q + QQ K+  +    K    I  LE +L  
Sbjct: 1216 LIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLN 1275

Query: 1171 VRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQ 1230
            V+  NA L ++F+RLKKQAHEKLDA+K  Q  LT ++NEL ETK  LE++L         
Sbjct: 1276 VQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLH-------- 1327

Query: 1231 SGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDA--KKFKNEIESLKSELQSVKAYEN 1288
                  +E  +++ L  +L++      E+ K  +    K F  EIESLK ELQ    + N
Sbjct: 1328 ------NEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQ---VFRN 1378

Query: 1289 STVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQESANIE 1348
            +   S   + +K + + EK+++I++  K+F+ KL+   + +   + N   +  + S +IE
Sbjct: 1379 ANDASDAFEKIKNNMEEEKNKIIDEKTKDFEKKLQ---DAVNKSKSNE--SEVENSEHIE 1433

Query: 1349 ELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE 1406
             LKK+W +E E   +KRI EAEENLKKR+RLPSEE+I  +I KR+  LEQEFE KL+E
Sbjct: 1434 ALKKEWLKEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKE 1491

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  209 bits (531), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 174/518 (33%), Positives = 275/518 (53%), Gaps = 91/518 (17%)

Query: 1057 EDKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKL 1116
            +++EE+ E   +L  L E N  L  E E  ++ NE L +++  +Q K++P+E++I  L  
Sbjct: 1212 QNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTA 1271

Query: 1117 KVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENA 1176
             + EKEQ L + +EE +RWK RSQ IL + + ++ E + K   +I+ L+ +LE    E+ 
Sbjct: 1272 TLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAELERKSAESI 1331

Query: 1177 QLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAA 1236
               +RF +L+KQA+E+LD  K  +  + +++      K  LE  L +  EK         
Sbjct: 1332 DSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAREK--------- 1382

Query: 1237 DESEEIIRLRAEL------EKSNNFSNELEK---KVEDA---------------KKFKNE 1272
                 I  L  +L      E  N  S+ELE+   K++DA               + FK +
Sbjct: 1383 -----ITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQ 1437

Query: 1273 IESLKSELQSVKAYENSTVNSK-------------IIKDLKESFKREKDELIEQMKKEFK 1319
            ++ L  +L++++  +NS  +S              +++D K+  + E+  LIE  ++E  
Sbjct: 1438 LDELNKQLETIQ--KNSAPSSGHSDPSSYHEQPTAVLEDFKKQVEEERRTLIESHQQELT 1495

Query: 1320 TKLEKEKETILAQRKNNI---------LANGQESANIEELKKKWEEEQEALILKRITEAE 1370
             +LE  ++  LA+++  +         ++    S N+E LKKKWEEE E   L+RI EAE
Sbjct: 1496 ARLEASRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAE 1555

Query: 1371 ENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELGL----------NADGNGVVTDT 1420
            E LKKR+RLPSEE+IN VIE+++K LEQEF TK+    L           +D   ++ D 
Sbjct: 1556 EALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDH 1615

Query: 1421 R---AQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNND 1477
            +    Q++K+L +KF  +L ++KKKAFEEG+QQ +MK  LLE K+SKLESQ  +P   N 
Sbjct: 1616 QKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAKAPLGTN- 1674

Query: 1478 SNETQVPSKINLSNINSSSPPLGEKV------LQLNYG 1509
                 VP+KI L N    + PL ++V       QL Y 
Sbjct: 1675 -----VPTKIPLEN----TQPLAQQVPVKPSPFQLAYA 1703

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  209 bits (532), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 206/600 (34%), Positives = 314/600 (52%), Gaps = 118/600 (19%)

Query: 1016 KMLALNLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEEDKEEVMENTTKLLALEES 1075
            KML   +   +  L+ AR +  N R      V+ D++S   +  + +ME   +L  L ES
Sbjct: 1170 KMLRQKITLMDVELQDARTKLNNSR------VENDERSSIVQQHDVIMEKLNQLNLLRES 1223

Query: 1076 NAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERW 1135
            N  L  E+ENC+K N+ L S+L  ++  + P+E E++ LK  + EKEQ + + +EE+ RW
Sbjct: 1224 NITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRW 1283

Query: 1136 KLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDA 1195
            K RSQ IL++ + +    + K   ++++L+ QLE    +  +  +RF+RL++QA EKL  
Sbjct: 1284 KKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKT 1343

Query: 1196 AKTMQINLTTQINELNETKVNLEKSLQ------QEIEKNNQSGNGAADE---SEEIIRLR 1246
            +K  Q  LT Q+NEL + KV LE+SL       QE+E     G   A++   SE I R +
Sbjct: 1344 SKLTQETLTEQLNELKDAKVALERSLNDANTRIQELE-----GEKVAEDNNRSEMIKRSQ 1398

Query: 1247 AELEKSNNFSNELEKKVED--------AKKFKNEIESLKSE----------LQSVKAYEN 1288
             + EKS   S ELE+K+E+         +K   EI +LK E          LQ+   + +
Sbjct: 1399 EDAEKS---SRELEEKLEENAISYSSTVRKLNEEIATLKEEIEKQGQIQKQLQTAAGHRD 1455

Query: 1289 STVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQESANIE 1348
              + S I++ +K+SF+ +K + IE+  +E   K+++ +E +          N   S NI+
Sbjct: 1456 EDL-SNIVESMKKSFEEDKIKFIEEKTREVNKKIQEAQERL----------NQPSSVNID 1504

Query: 1349 ELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELG 1408
            E+KK+WE E E  + +R+ EAEE LKKR+RLP+EEKI+ +IE++++ LE+EF  KL E  
Sbjct: 1505 EMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFNEKLEEKV 1564

Query: 1409 LNADGNGVV---------------------------------------------TDTRAQ 1423
             +  G+  +                                              + RA+
Sbjct: 1565 KSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAE 1624

Query: 1424 IEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ-------TLSPTK-- 1474
            IE +LRE+ N EL  +KKK+FEEGKQQ+ MK+TLLERKL+K+ESQ         SP K  
Sbjct: 1625 IEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESPPKHA 1684

Query: 1475 NNDSNE-TQVPSKINLSNINSSSP----PLGEKVLQLNYGANVVAETDNDDNPFTLQSGK 1529
            NN  N    +P KI     NS+SP      GEK+L+ N  ++         NPFT  S K
Sbjct: 1685 NNVPNPLLGLPRKIEE---NSNSPFNTLLSGEKLLKFNSKSSSSGAF----NPFTSPSPK 1737

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1748

 Score =  205 bits (522), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 201/634 (31%), Positives = 343/634 (54%), Gaps = 59/634 (9%)

Query: 8   EPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMK---ENSFVSAAIDDIKHVY 64
           EP   I  +++ F  +     + ++   L +I  K  DL K   EN  ++A +D +K   
Sbjct: 4   EP---IASRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQS 60

Query: 65  EGKINTISQKYFNLQLEN--KKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLIKY 122
           E K+ +     F + +    K L++ +   L   E    EK++  + N  +   I  ++ 
Sbjct: 61  ENKLES-----FKIHISQLAKALEDGKDERLHFEE----EKRRLIEGNSQVTKRIIELEQ 111

Query: 123 DLEAMQR-----DHTTLEARERKTENV--LEQSKLELQDSLTENSALKEQIGVFEGKLDS 175
           ++E  ++     D +  +  E   E +  L  +K +L ++   N  L++++   E +L +
Sbjct: 112 EIEVERQQKELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQT 171

Query: 176 MTQELWL-ANTENKKLQTGMKLLRENNLYL--EIKCKETDKNKKLYSSAEDASRLQD-QL 231
             Q L L + +E  +++  + LLRENN +L  ++  K    N+   S+    S LQD QL
Sbjct: 172 Q-QALELRSKSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTI---SELQDSQL 227

Query: 232 QI--VSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQR 289
           ++  + SE+   ++    LK    SL   L++KL   K++ D  N SKQE  KE++LKQR
Sbjct: 228 KVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQR 287

Query: 290 VNELLHNEIASYKKQIERLTSKNLETP------EKKIIQELVDLKEKLVNSEKECNELKS 343
           + + L   + S KK+++  T  N+++         ++I+EL  +K +L  SE  C +LK 
Sbjct: 288 MIDALEKHMESLKKEMD-ATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKE 346

Query: 344 TVDKY---INIDEKKLISKFGNPKKLIEI----------LRRQLVKEKRHKDTLQRQVES 390
           T+D+    I +++ ++ +   + +K + +          L++QLV EKR KD L+ QVE+
Sbjct: 347 TIDELTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEA 406

Query: 391 FLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQF 450
           F+VELE K+P+++SFKER+  LEREL  +T  LE T K+RD K  +L  L+  + + E  
Sbjct: 407 FVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQ 466

Query: 451 NDELLRQRSDLAHQVQYLLLCIDNKS----PFTEKEATLVKKIVSNENTENDTDSHKIIS 506
              L +QR DLAHQ+QYLL+    KS    P + +E   VK + +++     +D+  II+
Sbjct: 467 IASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIIT 526

Query: 507 KRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDL 566
            RL+ F++V ELQQKN ELL T R L   LER+E E +  +++ ++  + E AK T + L
Sbjct: 527 DRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVRE-AKETILTL 585

Query: 567 EKHIKTLESKINIISQERDSYKLLVTNSTIQSNT 600
             H + LE+++ I+S+ERD+YK L  N++  +NT
Sbjct: 586 HDHAQNLENQLVILSKERDAYKALSVNASSGTNT 619

 Score =  168 bits (426), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 164/548 (29%), Positives = 274/548 (50%), Gaps = 83/548 (15%)

Query: 1057 EDKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKL 1116
            E +E +M+   +L  L ESN  L  E  +  K  + L SQL +   +L PL+  I+ L+ 
Sbjct: 1198 EQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQN 1257

Query: 1117 KVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKI-------KTLEEQLE 1169
             +  KEQ L   +EE ERWK RSQ IL + + ++ E H K  E+I       +T ++ L+
Sbjct: 1258 GIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQ 1317

Query: 1170 TVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQ------- 1222
            +V  E      +F R++ QA ++L+A+K  + +L+++IN++NE K  +E  L        
Sbjct: 1318 SVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACK 1377

Query: 1223 ----------QEIEKNNQSGNGAADE-SEEIIRLRAELEKSNNFSNELEKKVEDAKKFKN 1271
                      QE E   Q+ N    +  E++  ++ ++E ++          E  K    
Sbjct: 1378 ELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLTE 1437

Query: 1272 EIESLKSELQSVKA-----------YENSTVN---SKIIKDLKESFKREKDELIEQMKKE 1317
             +E L S++Q ++A           +    +N     I+ +LK  F+ EK++LI+  +KE
Sbjct: 1438 TVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKE 1497

Query: 1318 FKTKLEKEKETILAQR--------------------KNNILANGQES--ANIEELKKKWE 1355
             ++K E EKE+    R                    K  + +  Q +   +I+ LK +WE
Sbjct: 1498 LRSKFEAEKESAWNSREEELRKQFEEREKRIREECEKTTVQSPSQPTLDIDIDALKNEWE 1557

Query: 1356 EEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRELG--LNAD- 1412
            +E E   L++I  AEE LKKR+RLP+++KI+ ++E R+ VLE+ FE K+ E    L  + 
Sbjct: 1558 KEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEI 1617

Query: 1413 GNGVVT--DTRAQ---IEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLES 1467
            GN  +T    RA+   ++  +R++F  +LAEIK+K+FEEGKQQ  +K   LE K+  LE 
Sbjct: 1618 GNDAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQ 1677

Query: 1468 Q--TLSPTKNNDSNET---QVP---------SKINLSNINSSSPPLGEKVLQLNYGANVV 1513
            Q  T+ P +N+ SN +   Q P         S  + S I+ +  P+ +   +     +  
Sbjct: 1678 QKSTIKPVENDTSNMSAAFQAPVFGSHSTFTSPFSTSEISPNKRPIDDTATEQPEKRHKE 1737

Query: 1514 AETDNDDN 1521
             E+D +D 
Sbjct: 1738 PESDTEDG 1745

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
           YIL149C (REAL)
          Length = 1682

 Score =  204 bits (518), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 265/905 (29%), Positives = 459/905 (50%), Gaps = 80/905 (8%)

Query: 15  DKISSFFDLPGNTWESMDEHALEKIYTKA--YDLMKEN-SFVSAAIDDIKHVYEGKINTI 71
           DKIS F  +P  + + ++   L K++ K   ++  +E  + ++  +D+IK  Y  +I+ +
Sbjct: 3   DKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRISKL 62

Query: 72  SQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEITLIKYDLEAMQRDH 131
           S K  N   E K +  KE  +L  +++L+ ++++     DALN ++   +   +A++R +
Sbjct: 63  S-KLLNESSEQKNIASKELSHL--QDQLMQDRERCRRKIDALNKQLDSSR---DAIKRLN 116

Query: 132 TTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQ 191
              +A+E   E+++ QSK +  +S+   + L ++  +   KL  M   L +  + +  LQ
Sbjct: 117 DEKDAKE---ESMIRQSKHQNVNSV--QNVLDKENKLLRRKLMEMENILQICKSNSVSLQ 171

Query: 192 TGMK-LLRENNLYLEIKCKETDK-----NKKLYSSAEDASR---LQDQLQIVSSEILSLK 242
                +++E  L L+ K    +K     NK L   +  ASR   L+++L    ++  S  
Sbjct: 172 LKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESAL 231

Query: 243 SEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYK 302
           S    L   N+ LS  ++ K+  IK+L D     K EF+KE+TL++ +N+LL +++AS++
Sbjct: 232 SYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFE 291

Query: 303 K-----QIERLTSKNLETPEKK-IIQELVDLKEKLVNSEKECNELKSTVDKYI-----NI 351
           +     +I +      + P+   +  EL++ K +   S+ EC  L++ +  ++      +
Sbjct: 292 RDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATV 351

Query: 352 DEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSS 411
           D        G     I++LR+QL+KE+  K  LQ Q+E F++ELE K P + SFKER  S
Sbjct: 352 DTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKS 411

Query: 412 LERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLL- 470
           LE EL R T  LE  +  +   +RELT+L++KI++ E     L++QR DLA QV+ LLL 
Sbjct: 412 LEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLN 471

Query: 471 --CIDNKS-PFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLR 527
              I   + P ++ +   ++KI+ + +  N+ D+  IIS+RL+ F N+ ELQ+KN+ELL 
Sbjct: 472 TSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLY 531

Query: 528 TTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSY 587
             R L   LE  E ++  TL   +   I E AK   ++LE     +ES+INI+ +ERDSY
Sbjct: 532 CIRTLADKLEFHEGKKDTTLAEVEKQTIKE-AKDAIIELENTNMKMESRINILLRERDSY 590

Query: 588 KLLVTNSTIQSNTSNNSISSLQQCELEKERLTNELSSMKQQHVKVLEELENKIKTLQKSQ 647
           KLL ++     N +  + + +   +  KE L  ELSS K +   V++ L  ++ T +K  
Sbjct: 591 KLLASSKENNVNVNAKNFTEISHEKKIKE-LEAELSSTKVESSAVIQNLRKELTTYKKLL 649

Query: 648 LTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENELFEKNLITGGVNNL 707
              K+  +    +F+  K    L KE    LE ++  L+ DL + +L   + +    N +
Sbjct: 650 CDKKIASQ----DFENFK---MLAKEKESILETRVNNLKTDLEKQKLSVPSFVQD--NKV 700

Query: 708 EQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNL--LDNKVLQLETSLS 765
             S   EL  +  K   L  EIS+LK +  N    +L  +L+++L     + +QL+  L 
Sbjct: 701 RDS--TELLQSRTKTEILMHEISSLKKETAN--SMVLKESLTRDLERCCKEKIQLQMKLK 756

Query: 766 ERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRREL 825
           E E+  N Q  N + +  K   Y    K+LE            E+LE L+ + ++  +E+
Sbjct: 757 ESEISLNEQKVNFDSKGIK---YDARIKQLE------------ESLERLRIELKSKAQEI 801

Query: 826 KEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGKE 885
           K +Q   D    S LK        +N +     KL SV T L +K   +    S+++  +
Sbjct: 802 KSLQSSKD----SQLKW------AQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLD 851

Query: 886 KELNE 890
            EL E
Sbjct: 852 NELRE 856

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar
           to uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  201 bits (511), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 176/522 (33%), Positives = 272/522 (52%), Gaps = 100/522 (19%)

Query: 171 GKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKE-------------------- 210
           G  D    EL     E K+LQT +K L +  L LE+KC+E                    
Sbjct: 131 GSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSELERNAQEIL 190

Query: 211 -------------TDKNKK-----------LYSSAEDASRLQDQLQI--VSSEILSLKSE 244
                        T+KN+            ++ +  +  +L+  L+I   S EILS    
Sbjct: 191 LLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSSKEILS---- 246

Query: 245 IATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQ 304
               K ++E+ +  LQ  L   KDL D L   KQEF KE+++K ++ +L  N+I S    
Sbjct: 247 ----KKLDET-TEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKS---- 297

Query: 305 IERLTSKNLETPE----------KKIIQELVDLKEKLVNSEKECNELKSTVDK------- 347
           +E    +  +T E          K + +EL   + KL + E++C  L+S +D        
Sbjct: 298 LESTLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSL 357

Query: 348 --------YINIDEKKLISKFGN----------PKKLIEILRRQLVKEKRHKDTLQRQVE 389
                   Y N        + G+           +  I+IL+RQLV+EKR K+ LQ QVE
Sbjct: 358 QTKGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVE 417

Query: 390 SFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQ 449
           SF++ELE K+P+I+SF+ER S LE+EL      LE   KE ++K  EL +L+KKIS++  
Sbjct: 418 SFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNS 477

Query: 450 FNDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTENDTDSHKII 505
             + LLRQR+DLAHQ+QYLL+ I    DN     E E   +K +VSN+N  +  DS K+I
Sbjct: 478 QLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVI 537

Query: 506 SKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLR--ITDNNKIVESAKSTS 563
           S+ L+ F+++++LQ+KNMEL++T R L Q LE  E++++ T    + ++N+I   AK   
Sbjct: 538 SEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAI 597

Query: 564 VDLEKHIKTLESKINIISQERDSYKLLVTNSTIQSNTSNNSI 605
           + LEK  + LE  + I+++ERD++KLLV+    ++  S+NS+
Sbjct: 598 LTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSV 639

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  201 bits (510), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 191/557 (34%), Positives = 293/557 (52%), Gaps = 94/557 (16%)

Query: 1016 KMLALNLNSANYSLRRARYRNKNPR---EKFPSFVKIDQQSKKEEDKEEVMENTTKLLAL 1072
            KML   ++  +  L+ AR +  N R   EK P+ +         +  E++ME   +L  L
Sbjct: 1165 KMLRQKISLMDIELQEARTKLDNSRLEEEKRPTII---------QQHEDIMEKLNQLNLL 1215

Query: 1073 EESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEEL 1132
             ESN  L  E+EN  +    L S+L  ++  + P+E E+  LK  + EKEQ L + +EE+
Sbjct: 1216 RESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLTKEEV 1275

Query: 1133 ERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEK 1192
             RWK RSQ IL++ + +    + K   +I +L+ +L+    + A+  +RF+RL++QA E+
Sbjct: 1276 HRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQER 1335

Query: 1193 LDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADES----EEIIRLRAE 1248
            L  +K     LT Q+N+L   K+ LEKSL     K  +  N  A++     + I RL+ +
Sbjct: 1336 LKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDNNQLDAIKRLQQD 1395

Query: 1249 LEKSNN-FSNELEKKV----EDAKKFKNEIESLKSE----------LQSVKAYENSTVNS 1293
             E S+  F  +LE+K        KK   EI +L+ E          LQS  A E + + S
Sbjct: 1396 AENSSKEFKTKLEEKATFYDSTIKKLNEEIITLREEIEKQRRIQQQLQSEPANEQNDL-S 1454

Query: 1294 KIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQESANIEELKKK 1353
            KI++ +K++F+ +K   I +  KE   K+      + AQ + N  +N     NI+ELK K
Sbjct: 1455 KIVESMKKTFEEDKINFIREKTKEVNEKI------LEAQERLNQPSN----INIDELKIK 1504

Query: 1354 WEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE------- 1406
            W+ E E  ++ RI EAEE LKKR+RLP+EEKI+ +IE++R+ LE+EF+ K+ E       
Sbjct: 1505 WKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQ 1564

Query: 1407 ------------------------------LGLNADGNGVVTD----TRAQIEKELREKF 1432
                                          L   +  N +  D     RA+IE ++R++ 
Sbjct: 1565 SGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKEL 1624

Query: 1433 NLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ-------TLSPTKNNDSNETQ--- 1482
            + EL  IKKK+FEEGKQQ+MMK+TLLERKL+K+ESQ       T SP+K+ +  + Q   
Sbjct: 1625 DNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITESPSKHVNHTQNQLLG 1684

Query: 1483 VPSKINLSNINSSSPPL 1499
            +P KI   N +SS  PL
Sbjct: 1685 LPRKIE-ENSSSSFNPL 1700

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  198 bits (503), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 169/484 (34%), Positives = 257/484 (53%), Gaps = 80/484 (16%)

Query: 1060 EEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVA 1119
            +EVME   +L  L ESN  L  E+++    N+ L S+L  ++  + P+E E+  LK  + 
Sbjct: 1208 DEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAALKFSIQ 1267

Query: 1120 EKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLT 1179
            EKEQ + + +EE+ RWK RSQ I+++ + +    + K   +I++L+ QLE    + A   
Sbjct: 1268 EKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQQGADSE 1327

Query: 1180 DRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADES 1239
            ++F+RL++QA EKL A+K  Q +   Q+NEL + K+ LEKSL      NN +      E 
Sbjct: 1328 EKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSL------NNANARIQELED 1381

Query: 1240 EEIIRLRAEL-------EKSNNFSNELEKKVED--------AKKFKNEIESLKSELQSVK 1284
             ++   R +L       E +   S ELE K+E+         KK   EI  LK EL+  +
Sbjct: 1382 AKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVKKLNEEIGILKEELEKQR 1441

Query: 1285 AYENSTVN---------SKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKN 1335
              +              SK+++ +K SF+ +K + IE+  +E   K+ + +E   A+   
Sbjct: 1442 QIQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREVNQKIREFQEAQEAEETG 1501

Query: 1336 NILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKV 1395
               +N     NI+E+KK+WE E    + K+I EAEE LKKR+RLP+EEKI+ +IE++++ 
Sbjct: 1502 LKPSN----INIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKED 1557

Query: 1396 LEQEFETKLRELGLNADGNGVVTDT----------------------------------- 1420
            LE+EF+ K+ E   +   +G + D                                    
Sbjct: 1558 LEKEFDEKVEERLKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSSD 1617

Query: 1421 ----------RAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTL 1470
                      RA IE +LRE+FN EL  IKKK+FEEGKQQ+MMK+TLLERKL+K+ESQ L
Sbjct: 1618 IISSDDKDKLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQ-L 1676

Query: 1471 SPTK 1474
            S TK
Sbjct: 1677 SETK 1680

 Score =  192 bits (487), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 196/644 (30%), Positives = 343/644 (53%), Gaps = 65/644 (10%)

Query: 1   MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAY---DLMKENSFVSAAI 57
           M +   +E T   ++ I+SFFD      +S+D   +  +  K     +L  EN  ++  +
Sbjct: 8   MRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTL 67

Query: 58  DDIKHVYEGKINTISQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEI 117
           D++K     KIN++  +  ++  +N +++++ +      E +  EK         L++E+
Sbjct: 68  DELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKT-------HLSNEL 120

Query: 118 TLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQ-------DSLTENSALKEQIGVFE 170
             IK  L  +  +   +++ +++T  +L++   EL+        S +E   L+  I   E
Sbjct: 121 ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180

Query: 171 GKLDSMTQELWLANTENKKLQ-----TGMKLLRENNLYLEIKCKETDKNKKLYSSAEDA- 224
            K     Q+ +++N  N K Q       + LL+ N  +LE +   + KN++  S  +   
Sbjct: 181 TK-----QQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKEL--SSKNQQYLSYRQKTN 233

Query: 225 ---SRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFA 281
              S +++ L  + ++    K+    L+  N  LS DLQ KL +IK L D+ NS K++F+
Sbjct: 234 TIISEIRNDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFS 293

Query: 282 KEITLKQRVNELLHNEIASYKKQIERL-----------TSKNLETPEKKIIQELVDLKEK 330
            EITLKQR+ +LL +++ + K+++               SK L +  +K++++L   K K
Sbjct: 294 AEITLKQRLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHK 353

Query: 331 LVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVES 390
           LV  E EC  L S  ++     E  +++   N   +  +L++QL+KEKR K+ LQ Q+ES
Sbjct: 354 LVQCENECLRLSSITEEAGK--EDGILTSKSNGDFI--LLKKQLIKEKRAKEHLQNQIES 409

Query: 391 FLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQF 450
           F+VELE K+P+I+SFKER  +LE EL      LE T+ E++ K +EL    +K++   ++
Sbjct: 410 FIVELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLA---EY 466

Query: 451 NDE---LLRQRSDLAHQVQYLL----LCIDNKSPFTEKEATLVKKIVSNENTE-NDTDSH 502
            DE   L +QR DL  Q+QYLL    +  D+K P  ++E   ++ I+ N+++   ++DS 
Sbjct: 467 KDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQ 526

Query: 503 KIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKST 562
           KI+++RL+ F+++ +LQ+KN ELLR TR L   LE  E + +  L+  +N  I E AK  
Sbjct: 527 KIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINE-AKEA 585

Query: 563 SVDLEKHIKTLESKINIISQERDSYKLLVTNSTIQSNTS-NNSI 605
            + L+     LESKI+ + +ER+ +K    N T+   TS NNS+
Sbjct: 586 ILTLQSQKVQLESKIHELEKEREKFK----NWTMDQETSPNNSV 625

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  194 bits (492), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 202/594 (34%), Positives = 312/594 (52%), Gaps = 111/594 (18%)

Query: 1016 KMLALNLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEEDKEEVMENTTKLLALEES 1075
            KML   ++  +  L+ AR +  N R +  +   I QQ       +++ME   +L  L ES
Sbjct: 1169 KMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQH------DDIMEKLNQLNLLRES 1222

Query: 1076 NAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELERW 1135
            N  L  E+EN     + L S+L  ++  + P+E E+  LK  + EKEQ L + +EE+ RW
Sbjct: 1223 NITLRNELENNNNKKKELQSELDKLKQNVAPIESELTALKYSMQEKEQELKLAKEEVHRW 1282

Query: 1136 KLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDA 1195
            K RSQ IL++ + +    + K   +I+ L+E+LE    + A+  ++F+RL++QA E+L  
Sbjct: 1283 KKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKERQGAEAEEKFNRLRRQAQERLKT 1342

Query: 1196 AKTMQINLTTQINELNETKVNLEKSLQQ---EIE--KNNQSGNGAADESEEIIRLRAELE 1250
            +K  Q +LT Q+N L + K  LE SL +    IE  +N +   G  ++ E I +L+ + E
Sbjct: 1343 SKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVAQGN-NQLEAIRKLQEDAE 1401

Query: 1251 KSNNFSNELEKKVEDA--------KKFKNEIESLKSELQ----------SVKAYENSTVN 1292
            K+   S EL+ K+E++             EI +LK E++          +  A E + + 
Sbjct: 1402 KA---SRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQRQIQQQLQATSANEQNDL- 1457

Query: 1293 SKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQESANIEELKK 1352
            S I++ +K+SF+ +K + I++  +E   K+      + AQ + N  +N     N+EE+KK
Sbjct: 1458 SNIVESMKKSFEEDKIKFIKEKTQEVNEKI------LEAQERLNQPSN----INMEEIKK 1507

Query: 1353 KWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVI----------------------- 1389
            KWE E E  + ++I EAEE LKKR+RLP+EEKIN +I                       
Sbjct: 1508 KWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEERIKSME 1567

Query: 1390 -----------------EKRRKVLEQEFETKLRELGLNADGNGVVTDT-----RAQIEKE 1427
                             ++++K LE E+  KL+E   +   +  ++D      RA+IE  
Sbjct: 1568 QSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESR 1627

Query: 1428 LREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKI 1487
            LRE+FN EL  IKKK+F+EGKQQ+MMK+TLLERKL+K+ESQ LS TK   S E+   S  
Sbjct: 1628 LREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQ-LSETKQ--SAESPPKSVN 1684

Query: 1488 NLSNI----------NSSSP--PL--GEKVLQLNYGANVVAETDNDDNPFTLQS 1527
            N+ N           NS+SP  PL  GEK+L+LN  +     +    NPFT  S
Sbjct: 1685 NVQNPLLGLPRKIEENSNSPFNPLLSGEKLLKLNSKS-----SSGGFNPFTSPS 1733

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  192 bits (487), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 162/475 (34%), Positives = 259/475 (54%), Gaps = 70/475 (14%)

Query: 1074 ESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELE 1133
            ESN  L  EV+  T+  + L  Q+ ++Q  L+PLE E+  LK  V  K+  +++  EE  
Sbjct: 1226 ESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLKRSVRAKDSQISLISEETN 1285

Query: 1134 RWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKL 1193
            RWK RSQ IL + + ++ E H K  E++   + +L     +N++L DRF RLKKQA E+L
Sbjct: 1286 RWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELEDRFQRLKKQARERL 1345

Query: 1194 DAAKTMQINLTTQINELNETKVNLE----------KSLQ---QEIEKNNQSGNGAADESE 1240
            DAAK +Q NL+ ++ +  E + N+E          K+LQ   Q +E   ++ +    E E
Sbjct: 1346 DAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRVESEAKADSTTQPELE 1405

Query: 1241 EIIR----------------------LRAELEKSNNFSNELEKKVEDAKKFKNEIESLKS 1278
              ++                      L++ELEK  + + ELE+++++A++   E+ESL+ 
Sbjct: 1406 SALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHAEELERRLDEARR---EVESLEE 1462

Query: 1279 ELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLE----KEKETILAQRK 1334
              Q   A+ +S+   K+ +DL+E      + LI + + E ++  E    KEK T     +
Sbjct: 1463 VKQG--AFTDSSELEKMKRDLEE----HSNTLIAEKEAEIRSHYEELRLKEKATY----E 1512

Query: 1335 NNILANGQESA-NIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRR 1393
              +  NG+ +  +IE LKK+WEE+ E   +KRI E+ E L+KR+RLP+EEKIN ++E R+
Sbjct: 1513 KELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRK 1572

Query: 1394 KVLEQEFETKLR--------ELGLNADGNGVVTDTRAQIEK---ELREKFNLELAEIKKK 1442
              LEQEFE KL+        E    A    V+   + ++EK   +L  + + E+A+++KK
Sbjct: 1573 SELEQEFEAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKK 1632

Query: 1443 AFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKINLSNINSSSP 1497
            AF+EGKQQ+ MKS  LE+K++KLE+Q  +      S    VPS     N  +  P
Sbjct: 1633 AFDEGKQQASMKSMFLEKKIAKLEAQVKA------SGTEAVPSAPTSKNSPTEKP 1681

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  191 bits (485), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 172/475 (36%), Positives = 264/475 (55%), Gaps = 63/475 (13%)

Query: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121
            VM   T+L  L ESN  L  E       N+ L +++ ++  KL PLE E+  L   + EK
Sbjct: 1224 VMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLETELQTLTNLIEEK 1283

Query: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181
            ++ L+IC EE ERWK RSQ IL + + ++   H    E+   L+ QLE    EN +L +R
Sbjct: 1284 DKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNR 1343

Query: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINEL--------------NETKVNLEKSLQQEIEK 1227
            F++LKKQAHEKL+A+K  Q +LT QIN+L               E K++LEK L  E+  
Sbjct: 1344 FEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRL--EVTM 1401

Query: 1228 NNQSGNGAADESEEIIRLRAELE----KSNNFSNELEKKVEDAKKFK----NEIESLK-- 1277
             N         S +I+ ++++LE    KS +F  +    VE +K+ +    +EI+ L+  
Sbjct: 1402 KN---------SHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNSEIKKLQEE 1452

Query: 1278 -SELQSVKAYE-----------------NSTVNSKIIKDLKESFKREKDELIEQMKKEFK 1319
             S+LQ   A+E                 +  V++ I++ +K+SF+ EK + IE+   EFK
Sbjct: 1453 SSKLQEELAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKQSFEEEKIKFIEEQTTEFK 1512

Query: 1320 TKLEKEKETILAQRKNNILANGQESANIEE--LKKKWEEEQEALILKRITEAEENLKKRM 1377
             KL+ E   + A+ +   +    E  +I+E  ++K+ EEE E    +RI EAEENLK+R+
Sbjct: 1513 KKLQAEINKLKAEYETKQI----EPVSIDENAIRKQIEEEYEQATSQRIKEAEENLKRRI 1568

Query: 1378 RLPSEEKINAVIEKRRKVLEQEFETKL----RELGLNADGNGVVTDTRAQIEKELREKFN 1433
            RLP+EEKIN VI+KRR  LE EF+ K+    +EL    + N      + +I++EL  K+ 
Sbjct: 1569 RLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQEELARKYE 1628

Query: 1434 LELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKIN 1488
             EL  +KKKAF+EG+QQ +MK++ LE+K++KLES   +   N  + +  + S  N
Sbjct: 1629 EELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVSTDN 1683

 Score =  130 bits (327), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 122/434 (28%), Positives = 238/434 (54%), Gaps = 38/434 (8%)

Query: 230 QLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQR 289
           QL  V +E+  +KS    L+   + LS  L+     +K++  + N+ K    KE+TLKQ+
Sbjct: 242 QLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQ 301

Query: 290 VNELLHNEIASYKKQIE---RLTSKNLETPEKK---IIQELVDLKEKLVNSEKECNELKS 343
           +  +L +++   +++      LT  +  +  +K     +E+ DLK +L + ++   EL+ 
Sbjct: 302 LIVVLQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEF 361

Query: 344 TVDK---YINI----DEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELE 396
            + K   Y  +        L +        I++L+++L  E+  ++  ++ +E F+ +LE
Sbjct: 362 KLRKSEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLE 421

Query: 397 QKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLR 456
            +LP +++++ R ++ E EL   T  LE+  KE+ +   EL   Q +I + EQ    + +
Sbjct: 422 TELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAK 481

Query: 457 QRSDLAHQVQYLL----LCIDNKSPFTEKEATLVKKIVSNENTEND--TDSHKIISKRLL 510
           QRSDLA+Q+Q+ L    +  D+  P T++E   ++ I+  ++  +D  TD+ K+IS+RL 
Sbjct: 482 QRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLT 541

Query: 511 HFQNVKELQQKNMELLRTTRQLVQTLERQEQ-EQQKTLRITDNNKIVESAKSTSVDLEKH 569
            F+++ ELQQKNMELL+TTR+L   LE +++ +Q +  RI +  + +  AK   + L+ +
Sbjct: 542 KFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEE--ETIAEAKEAILTLQNY 599

Query: 570 IKTLESKINIISQERDSYKLLVTNSTIQSNTSNNSISSLQQCELEKERLTNELSSMKQQH 629
             +L +KI  +++E ++YK+L       SNT ++S       + +K+R   E+     +H
Sbjct: 600 NSSLTAKIAALTKELETYKVL-------SNTEDSSTP----ADFDKQREQREI-----EH 643

Query: 630 VKVLEELENKIKTL 643
            ++++ELE +I ++
Sbjct: 644 TQLVKELETRIASI 657

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1674

 Score =  180 bits (457), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 170/569 (29%), Positives = 308/569 (54%), Gaps = 58/569 (10%)

Query: 160 SALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYS 219
           S + ++I   + +L+    E  ++ +E ++     +L+RE+N +LE    +T   ++L +
Sbjct: 97  SNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKT--TEELMT 154

Query: 220 SAEDASRLQDQLQIVSSEILSLKSEIATLK-------YMNESLSTDLQRKLFRIKDLDDN 272
             +   +++++ Q    EI +L+ E++ LK         N+ LS ++Q KL  IK   D+
Sbjct: 155 QKQSILKMEEKDQ----EIDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDD 210

Query: 273 LNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPE-KKIIQELVDLKEKL 331
            ++ +QEF  EI LK R+N  L  ++   +++       N    E +KI+++L+D +++L
Sbjct: 211 YSTKQQEFLHEIGLKDRINSSLETQLKEIQQEKSIQNEDNTSRAESQKIMEQLIDTRKQL 270

Query: 332 VNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESF 391
            +S  EC  LKS V+++IN          G       +L+++L+K K  KD L+ QVE+F
Sbjct: 271 KDSRNECTRLKSYVNEFIN-------DVNGEYSSSSSLLKKELLKVKEQKDYLETQVENF 323

Query: 392 LVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFN 451
           + ELE K+P+IDS +++N  LE+EL  +TS ++  + ER+  ++E  + ++K  +N+   
Sbjct: 324 ITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQSFKRKSEHNDGMI 383

Query: 452 DELLRQRSDLAHQVQYLLLCIDNKSP----FTEKEATLVKKIVSNENTENDTDSHKIISK 507
             L  QRSDLAHQ+Q+LLL +  ++      ++ E   ++++  N+    + DS  IIS+
Sbjct: 384 QTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARNNDSQSIISE 443

Query: 508 RLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKI----VESAKSTS 563
           RLL F ++ ELQ++NM++L T R L   LE QE+     LR  D++ I    +E AK   
Sbjct: 444 RLLKFADITELQKQNMDILATVRHLAGQLEEQEK-----LRQADHHTIERKTLEEAKKAL 498

Query: 564 VDLEKHIKTLESKINIISQERDSYKLLVTNSTIQSN-----------TSNNSISSLQQCE 612
           +DL+++  +LE K+    +ERD YKLL    +  SN           T+    + LQQ  
Sbjct: 499 LDLQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECNDIDKHTTGKLQNELQQT- 557

Query: 613 LEKERLTNELSSMKQQHVKVL---EELENKIKTLQKSQLTSKMEVEKHALNFDEMKDN-- 667
             +E LT E+  + + +  +L   +ELE  +K ++ ++  ++ + E    N   +++N  
Sbjct: 558 --REYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAELIENNLLMLQENRK 615

Query: 668 -----NNLLKEYVDKLENKIKTLEQDLAE 691
                N+ L++ + + E K+  L QDL E
Sbjct: 616 SVLEQNDHLQQLLSQKEAKLAELTQDLHE 644

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  171 bits (432), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 177/503 (35%), Positives = 279/503 (55%), Gaps = 68/503 (13%)

Query: 1057 EDKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKL 1116
            E+ E+++    ++   +ESN  L  +V    + N+TL ++L +   KL  L  E+  +K 
Sbjct: 1181 ENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKE 1240

Query: 1117 KVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENA 1176
             + +KE  + + +EE  +W+LR++ +  Q   V+ ++  K   ++  L++  ET R +NA
Sbjct: 1241 SLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNA 1300

Query: 1177 QLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAA 1236
            +L +RF+ LKKQAHE+L+A+K +Q +L  QINEL  +  N+E +L  E +K+    N  +
Sbjct: 1301 ELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLS 1360

Query: 1237 DE----SEEIIRLRAELE--KSNNFSNELEKKVEDAKKFKNEIESLK-------SELQSV 1283
            D     ++++  + +EL+  K+ N S +L  + E   +  +E++SLK       S+L ++
Sbjct: 1361 DNEVKYTQKLSNIESELKALKTENNSFKLSSEKEKM-ELTDEVDSLKKSLVEAQSKLSAI 1419

Query: 1284 KA-YENSTVNSKI------------------IKDLKESFKREKDELIEQMKKEFKTKLEK 1324
             +   +ST+N+ I                    +L+  +K EKD+L+    KE++ K+E 
Sbjct: 1420 GSDSTDSTMNAMIESMKKEFEEEKLKLLEDKTNELEAQWKLEKDKLL----KEYEEKIED 1475

Query: 1325 EKETILAQRKNNILANGQESANIEE---LKKKWEEEQEALILKRITEAEENLKKRMRLPS 1381
             +            A   +S  IEE   LKK+WEEE E   L+RI EA+E LKKR+RLPS
Sbjct: 1476 LQS-----------ARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPS 1524

Query: 1382 EEKINAVIEKRRKVLEQEFETKLRELGLN---ADGNGVVTDTRAQIEKELRE-------- 1430
            E KIN VIEKR+  LE E+E KL+E  LN   A+ N + T    ++ +E++E        
Sbjct: 1525 ETKINRVIEKRKHELENEYEVKLQE-KLNEIEANRNSIETIDPGKLREEIKEEVKRDMLI 1583

Query: 1431 KFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKINL- 1489
            KF  +L E KKK+FEEGKQQS MK+TLLERK+SKLESQ LS    ND    + P   +L 
Sbjct: 1584 KFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQ-LSEAIENDKQSDKNPIISDLA 1642

Query: 1490 --SNINSSSPPLGEKVLQLNYGA 1510
              S + S  PP  +K    ++G 
Sbjct: 1643 QTSTLASIQPPSAKKP-AFSFGG 1664

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  167 bits (424), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 160/488 (32%), Positives = 256/488 (52%), Gaps = 76/488 (15%)

Query: 1060 EEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVA 1119
            E ++E  T+L  L+E N +L +E+    + N  L  QL +   +L+PLE +I+EL + + 
Sbjct: 824  ETLIEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIE 883

Query: 1120 EKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLT 1179
            +K+  +N+  E+ E WK R   +    K  + E  +        L++Q+E    EN +L+
Sbjct: 884  DKDNIINVSNEKAENWKTRFNELTLSAKNNDNEDLI-------NLQKQVEEKSKENEELS 936

Query: 1180 DRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADES 1239
            DRF+RLKKQA+E+L A+K  Q NLT Q NEL     +LE++L +++E+  +  N  + + 
Sbjct: 937  DRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKD 996

Query: 1240 EEII-------RLRAELEKSNNFSNELEKKVEDAKKF----KNEIESL----KSELQSVK 1284
            +E+        +L   L+KS  F  EL K V +++      KNEIESL    KS+  SV 
Sbjct: 997  QELGSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKLKSKESSVG 1056

Query: 1285 AYENSTVNSK--IIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQ 1342
              E+   N+K  +I +L+E   + K EL  + K+E K                       
Sbjct: 1057 LQESEIENAKKILIAELEEKLNKTKSELDLKHKEELKV---------------------- 1094

Query: 1343 ESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFET 1402
                   LK ++E +    I KR+ EAEE LK+++RLPSEEKIN +IE +   LE++++ 
Sbjct: 1095 -------LKTEYEGD----IQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKK 1143

Query: 1403 KLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKSTLLERKL 1462
            KL            V+     IEK ++++F   L   KKKAFEEGKQQ+ MK+  LE K+
Sbjct: 1144 KLE----------TVSAESTDIEK-IKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKI 1192

Query: 1463 SKLESQTLSPTKNNDSNETQVPSKINLSNINSSSPPLGEKVLQLNYGANVVAETDNDDNP 1522
            +KLESQ     +NN+S+ T   +++  ++   S+P L ++  + ++  +    +    NP
Sbjct: 1193 AKLESQ----LQNNESDVTDKEAEVKTTDNEKSNPELDKQEAKPSFTFSPPPNS----NP 1244

Query: 1523 FTLQSGKD 1530
            FT     D
Sbjct: 1245 FTTTQDTD 1252

 Score = 89.0 bits (219), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 122/214 (57%), Gaps = 20/214 (9%)

Query: 379 RHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLR---ITSSLEETAKERDIKDR 435
           +  + L+  ++++L ELEQ+LP+I++FK    +L+  L +   I  SL+   KE    + 
Sbjct: 209 KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKE----NL 264

Query: 436 ELTNLQKKISNNEQFNDELLR-QRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIV 490
           +L +  KK  N +  + E L  QR+DLAHQ+QYLL+      DN  P ++ E   ++ ++
Sbjct: 265 KLMDSMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLI 324

Query: 491 SNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRIT 550
           + +     +D   +IS RL+ F+++  LQ+KNMEL ++ R L  +LE +E E + +    
Sbjct: 325 NKDKQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENY 384

Query: 551 DNNKIVESAKSTSVDLEKH-------IKTLESKI 577
           DN+ I E AK T + L+++       I TL+SKI
Sbjct: 385 DNDTINE-AKETILSLQEYNNVLKLEIGTLQSKI 417

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  159 bits (401), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 202/733 (27%), Positives = 352/733 (48%), Gaps = 94/733 (12%)

Query: 842  LENKYTKVKNDLKQATYKLASVYTTLEQKNSFLANSVSQLQGKEKELNELKSKLVEKTEK 901
            L ++ TK K +LK  +  L       E++ SFL   + +++G + +L E   +LV+++EK
Sbjct: 913  LNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLKEGALRLVQQSEK 972

Query: 902  LQ------MAENENSEKINNAIVLLQTMVE-----------------------ENTTFKD 932
            L        A NE  +K+   IV L   VE                       E   ++ 
Sbjct: 973  LGNQTQRIQAMNEKIDKMT-TIVELHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQT 1031

Query: 933  AFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLEEAEVKMASFDGKVTEILE 992
              K  K+SL   ++ ++  +++ +  +++Y  E+    E+ E   V+ ++   K+     
Sbjct: 1032 ELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSALVEKID---- 1087

Query: 993  SYDGKILNTA-----AIGHLVRSLIHEKKMLALNLNSANYSLRRARYRNKNPREKFPSFV 1047
              DG   N        +  L  SL HE+  L   L +    L  A+ +N N  +      
Sbjct: 1088 --DGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQ 1145

Query: 1048 KIDQQSKKE--------EDKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLAD 1099
            +    S+K+        ++ E++M+   ++  L+E+N  L K ++  T+ NE +  +   
Sbjct: 1146 QTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTS 1205

Query: 1100 MQVKLEPLEQEINELKLKVAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLE 1159
            +Q ++  L+ ++ + K +V+     + + + E+E+WK R   + QQ K   ++   K   
Sbjct: 1206 LQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFN 1265

Query: 1160 KIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEK 1219
            +I  L+ +L   +  NA L D+F+RLKKQAHEKLDA+K  Q  LT +++EL + K     
Sbjct: 1266 EISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK----- 1320

Query: 1220 SLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVED--AKKFKNEIESLK 1277
                     N+       E  +++ L A+L+K    +  + K  E+  +K    EIE LK
Sbjct: 1321 ---------NELEESLHSEESKVLELEAKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLK 1371

Query: 1278 SELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNN- 1336
             ELQ  K   +S   S  I+ +KE  + EK+++IE+   EF+ KLE+      A  KN  
Sbjct: 1372 RELQVFKETSDS---SDTIEKMKEIMEAEKNKIIEEKTTEFERKLEE------ATGKNTG 1422

Query: 1337 -ILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKV 1395
              + NG+   N+EELKK+W ++ E   ++RI EAEENLKKR+RLPSEE+I  +I KR++ 
Sbjct: 1423 ATIENGE---NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEE 1479

Query: 1396 LEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQQSMMKS 1455
            LEQEF+ KL+        +G  T +  + E E+  + +L  +  K  +     ++  + +
Sbjct: 1480 LEQEFQRKLKA------NSGSFTLSSDKKENEVNAEDDLWNSPSKGNS-----EKPSVVT 1528

Query: 1456 TLLERKLSKLESQTLSPTKNNDSNETQVPSKINLSNINSSSPPLGEKVLQLNYGANVVAE 1515
             L+ +K   L+ Q  +P K   SN+++  S    ++I  S+    +  L  N+G  +   
Sbjct: 1529 NLIRQKNLILQEQLKNPKKGIISNDSRPTSSNKENDIPGSTTAENKAPLAFNFGKPLFPS 1588

Query: 1516 TDND----DNPFT 1524
              +      NPFT
Sbjct: 1589 NTSSFQSFQNPFT 1601

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1454

 Score =  127 bits (319), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 115/362 (31%), Positives = 199/362 (54%), Gaps = 29/362 (8%)

Query: 246 ATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQI 305
           A L   NE LS DL+ K+  IK L+++L +S  +F  E  L+ ++   L N+I + ++Q+
Sbjct: 191 AELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQL 250

Query: 306 ERLTSKNLETP------EKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKK---- 355
           E L+ +  + P      + ++++++ +L EKL  SE+E   L  +++++ NI E++    
Sbjct: 251 ESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPEEESSSV 310

Query: 356 ----------LISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSF 405
                      +S  G+    + ILR+  +KE++ K  L+ Q+   L ELE+ +P + S+
Sbjct: 311 SSHASGRNNSALSLSGD----VNILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSY 366

Query: 406 KERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQV 465
           KER++ LE+EL      LE   KE   K  EL   + + SN     + L  QR+ LA QV
Sbjct: 367 KERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQV 426

Query: 466 QYLLLCIDN----KSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQK 521
           +YLLL I N     S    K+  L+ + ++    E  +DS KI+ +RL  F+NVKELQ +
Sbjct: 427 KYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNR 486

Query: 522 NMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIIS 581
           NM+LL+ +R+L    E+ E+   K +  ++ ++ +  AK   + L+++ + LES+I  +S
Sbjct: 487 NMQLLQVSRELASKAEKLEKVNLKQIS-SEEDETINDAKEAILVLQEYSQKLESQIKELS 545

Query: 582 QE 583
            E
Sbjct: 546 DE 547

 Score =  106 bits (265), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/171 (43%), Positives = 112/171 (65%), Gaps = 20/171 (11%)

Query: 1306 EKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQESANIEELKKKWEEEQEALILKR 1365
            E D L+++MK  F    EKEK ++L+Q++  I    + + N  +L++ +EEE    I K+
Sbjct: 1183 EHDSLVQEMKDNF----EKEKSSLLSQQEQEI---EKLTDNERKLREFYEEE----IQKK 1231

Query: 1366 ITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE----LGLNADGNGVVTDTR 1421
            +++AEENLKKR+RLP+EEKIN +IEKR+  LE  FE K++E    L L++D +  +    
Sbjct: 1232 VSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDDK-IKKIY 1290

Query: 1422 AQIEKELRE----KFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ 1468
             +IE+  RE    +F+ +L  ++KKAFEEGKQ  +MKS  LERK+S LE Q
Sbjct: 1291 KEIEESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1651

 Score =  108 bits (271), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 135/470 (28%), Positives = 234/470 (49%), Gaps = 60/470 (12%)

Query: 144 VLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLY 203
           +L+ S L++   +TE +   E+IG    ++ ++T +      E + LQ  ++LL++ +L 
Sbjct: 59  LLKSSNLDMSRIVTERA---EEIGRLRDEVSTVTGQTSALRAELENLQNDLELLKDKDLA 115

Query: 204 LEIKCKETD--------KNKKLYSSAEDASRLQDQLQ-------------IVSSE--ILS 240
           L+ +   T         +N  L +  E A  L    Q             +VS E  +  
Sbjct: 116 LQSERDSTVALLDGLKLENSALRAEIEQAKELASIRQHDYEADLDSKTGALVSKEEELRL 175

Query: 241 LKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIAS 300
            KSE A+L    E LS +L ++   I+ L D     + E+  EI L++    LL  ++AS
Sbjct: 176 AKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQKHRARLLQEQVAS 235

Query: 301 YKKQIERLTSKNLETPEKKIIQ--ELVDLKEKLVNSEKECNELKSTVDKYI--NIDEKKL 356
            +K+  +L     E PE +I    E V L+++             ++D  +  N +    
Sbjct: 236 LEKEA-KLVGHETE-PEYEIPPPGEEVALQQR---------SHSISMDSLLTGNDETSHS 284

Query: 357 ISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLEREL 416
           +S+  N    I IL  +L +E   K  L++QV  F+ ELEQ  P+I SFK+++   + ++
Sbjct: 285 MSELNNN---ISILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQI 341

Query: 417 LRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLL---CID 473
            ++   LE   K+++   +E+   +K++      +  L R+R DLA Q+QYLLL     D
Sbjct: 342 HKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLLNGFVKD 401

Query: 474 NKSPFTEKEATLVKKIVSNENTEND---TDSHKIISKRLLHFQNVKELQQKNMELLRTTR 530
           +  P T  E + +K+I++ +  E +   TDS  IISKR+L F+++ ELQQ+N+ LL   R
Sbjct: 402 SDDPLTSSEFSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVR 461

Query: 531 QL---VQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKI 577
            L    +TLER+       L   D+ + +  AK T +DL+++  +LE+K+
Sbjct: 462 TLSDRAETLERK-------LESGDSIEAINEAKQTLLDLQQYNSSLEAKV 504

 Score =  107 bits (267), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 130/508 (25%), Positives = 248/508 (48%), Gaps = 81/508 (15%)

Query: 1064 ENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQ 1123
            E+  +L +L+ESN  L  EV+     N  + ++L +++ K + +E +++E +  ++ K+ 
Sbjct: 1080 EHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDM 1139

Query: 1124 HLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEK-IKTLEEQLETVRTENAQLTDRF 1182
             L   Q E  R K  S  + Q G        + +L+  + TL EQ++ ++  N +L DRF
Sbjct: 1140 KLMELQTECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRF 1199

Query: 1183 DRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEI 1242
             RLK+QA E+LDA+K    +L   +  L + K     +LQ  IE++    N    + +E 
Sbjct: 1200 GRLKRQARERLDASKVTINSLRDNVETLTKDKT----ALQDVIERSKDELNELRAKIQEH 1255

Query: 1243 IR-------LRAELEKSNNFSNELEKKVEDAKKFKN--------EIESLKSELQSVKAYE 1287
            I        L+ EL    + + ++E ++ +  K  N        EIESLK E+Q +K   
Sbjct: 1256 IETSAVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEAS 1315

Query: 1288 NSTVN-----SKIIKDLKESFKREKDELIE---------------QMKKEFKTKLEKEKE 1327
            ++        S +++ ++++F+ EK   ++               ++K+E +  LEKEK+
Sbjct: 1316 SAEPQGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEA-LEKEKD 1374

Query: 1328 TI------LAQRKNNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPS 1381
            ++      L +    ++    +  +IE L+K+WE                  K+R+ L  
Sbjct: 1375 SLVMEKTRLGEENTALMKARSDVPDIETLQKQWEASN---------------KERLVLLY 1419

Query: 1382 EEKINAVIEKRRKVLEQEFETKLR--ELGLNADGNGVVTDTRAQIEKELREKFNLELAEI 1439
            +EK + ++  +   LE++F+ ++R  E  LNA         + +IE++ +      L  +
Sbjct: 1420 KEKSDQMMRAKMDELEEQFQNRVRNKEKELNA--------LKDEIEEKCKTGHEDTLIAV 1471

Query: 1440 KKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQ-VPSKINLSN--INSSS 1496
            KK+AFEEGKQQ+ MK ++LERK++KLE+++ +    +D + ++  P  +  +N  +  ++
Sbjct: 1472 KKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSVSEDAPRFVTPNNNKVQQAN 1531

Query: 1497 PPLGEKVLQLNYGANVVAETDNDDNPFT 1524
             P       L    +  +   ++ NPFT
Sbjct: 1532 QPF------LATAGSGFSVQSSESNPFT 1553

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 100/183 (54%), Gaps = 13/183 (7%)

Query: 367 IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEE- 425
           I+ ++ +L+KEK  K  L+++   FL ++E KLP +     +N+S+E E     + +EE 
Sbjct: 283 IDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYL-----QNNSVENET-NNGNKIEEQ 336

Query: 426 -TAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI-----DNKSPFT 479
               E D    E  +L+ K+++ E     LL+QRSDL HQ+ YLL+       DN    T
Sbjct: 337 KIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILT 396

Query: 480 EKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQ 539
           E E   ++ +V+       T++  IIS+RLL F NV +L  KN++L+   R+L   +E  
Sbjct: 397 ENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESI 456

Query: 540 EQE 542
           E++
Sbjct: 457 EKQ 459

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 105/411 (25%), Positives = 188/411 (45%), Gaps = 69/411 (16%)

Query: 1149 VEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQIN 1208
             E  A +K+  +I  L++Q+ET   E  +  DRF RLKKQA +KL+  K  +       N
Sbjct: 741  AESAAMLKNKNEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTE-------N 793

Query: 1209 ELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVEDAKK 1268
            +L E   +LEKS  +  ++     +      EEI++++ EL  SNN   EL+      ++
Sbjct: 794  KLREDYCDLEKSKNELEQRLLLLESSEKSLQEEIVKMKDELMTSNN---ELDNNQRSQEE 850

Query: 1269 FKNEIESLKSELQSVKAYE-NSTVNSKIIKDLKES---FKREKDELIEQMKKEFKTKLEK 1324
             +NE E  +++L  +K  E  S +N  ++K+ + S    +   D+++ ++K+  K  +E 
Sbjct: 851  LRNEYEK-QNKLYKIKEEELESALNQLMLKENQNSALDLESLPDDVMLKLKEMVKKDIEI 909

Query: 1325 EKETILAQRKNNILANGQESAN----------IEELKKKWEEEQEALILKRITEAEENLK 1374
            E + IL  +   I  N  +  N          I  +K+ WE+E + ++  RI +AE    
Sbjct: 910  ENDIILKAKLKEIEKNSAKDVNTDSIELSDDNISTMKEAWEKEYQHILKIRIEDAE---- 965

Query: 1375 KRMRLPSEEKINAVIEKRRKVLEQEFETKLRELG--LNADGNGVVTDTRAQIEKELREKF 1432
                       N  + + RK LE+E+E +L +    L+   N  + D  ++   ++ +K+
Sbjct: 966  -----------NQAMARTRKELEKEYEERLSKESEKLSDQYNNKLKDDLSEELLKIDKKY 1014

Query: 1433 NLEL-------AEIKKKAFEEGKQQSMMKSTLLERKLSKLESQT-----------LSPTK 1474
             +EL        +  KK F++       K+ +L +K+  LE+Q             +P K
Sbjct: 1015 AMELETKLKNETDESKKEFQDALGTEQTKNKILSKKIEFLETQIKELKDEQTKHHSNPMK 1074

Query: 1475 NNDSNETQVPSKINLS-NINSSSPPLGEKVLQLNYGANVVAETDNDDNPFT 1524
            +++    ++PS  NLS N      P      Q  Y +NV        +PF+
Sbjct: 1075 SDE----KIPSTTNLSTNFAFGQNPFVSNASQNAYMSNVFLSG----SPFS 1117

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score = 59.3 bits (142), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 102/185 (55%), Gaps = 15/185 (8%)

Query: 369 ILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAK 428
           IL++++ K +  +D LQ ++E  + ELE   P +++  ++ + LE  L    S  + T++
Sbjct: 300 ILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLL----SKEKNTSE 355

Query: 429 ERDIKDRELTNLQKKISNNEQFND---ELLRQ-RSDLAHQVQYLLLCI----DNKSPFTE 480
                 +E+ N +K I +  + +D   E LR+  +DL +Q+Q++L+      D     TE
Sbjct: 356 HFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTE 415

Query: 481 KEATLVKKIV--SNENTEND-TDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLE 537
            E   +K +     E + N+  +S  IIS RL+ F++V  LQQKNMEL++T R + + L+
Sbjct: 416 NEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLD 475

Query: 538 RQEQE 542
            QE E
Sbjct: 476 NQEHE 480

 Score = 36.6 bits (83), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 61/124 (49%), Gaps = 11/124 (8%)

Query: 1088 KVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQH-LNICQEELERWKLRSQTILQQG 1146
            K N  L  +L D +  +E ++ EI +L   + E +++ LNI           S+  L + 
Sbjct: 906  KSNRQLQEKLNDSEKHIEQMDMEIKKLNDSILEYQKNTLNIT----------SEITLLRN 955

Query: 1147 KIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQ 1206
            +  E E  +K        +E+ E    EN +  DRF+RLKKQA+ +L ++K  Q  L  Q
Sbjct: 956  RCKELENKLKEASLQSDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQ 1015

Query: 1207 INEL 1210
            I+ L
Sbjct: 1016 ISSL 1019

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 124/483 (25%), Positives = 214/483 (44%), Gaps = 128/483 (26%)

Query: 1066 TTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHL 1125
            + KL++++ESN  L  E +     N  LSS L  +      +  E+++L  K        
Sbjct: 538  SAKLVSIQESNDLLADENQKIKMENSNLSSLLNKINTDKNSISNELSDLHSK-------- 589

Query: 1126 NICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTE-------NA-- 1176
             I + E E+ KL  Q  L++G+   +E + K  E+IK  + +++    E       NA  
Sbjct: 590  EILELETEKTKLLEQ--LEEGERKLKETNEKHNEQIKWFQNKIDNFNEETTKNQFNNALK 647

Query: 1177 ------------------QLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLE 1218
                              +  D+F RLK+QA+E+L+A+KT Q  L+  +  L + + N +
Sbjct: 648  NDYENLKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFK 707

Query: 1219 KSLQQ-EIEKNNQSGNGAADESEEII---RLRAELEKSNNFSNELEKKVEDAKKFKNEIE 1274
            + + + E++ NN   N A  E+E+ +    L+ E E+     + L  K++D +   NE +
Sbjct: 708  EHISKLEVDINNL--NNALVEAEKKLSEENLKYETERQT--GSTLRLKIDDLQ--LNE-D 760

Query: 1275 SLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLE--KEKETILAQ 1332
            +LK ++++++  E ST+  KI             ++IE  + +   K+   +  E +L  
Sbjct: 761  NLKEKVKNLEENE-STLKDKI-------------KMIEGNEDDLMGKISVLQSNEILLKD 806

Query: 1333 RKNNI---LANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVI 1389
            + N++    +N  E  ++E LKK WE+E   +I KRI  AE  L+KR+            
Sbjct: 807  KLNDLNSKSSNNSELVDVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRL------------ 854

Query: 1390 EKRRKVLEQEFETKLRELGLNADGNGVVTDTRAQIEKELREKFNLELAEIKKKAFEEGKQ 1449
                                           ++++E+E+ +K  +    ++ K FE GK 
Sbjct: 855  -------------------------------KSEMEREMDDKMKV----VEMKGFESGKA 879

Query: 1450 QSMMKSTLLERKLSKLESQ---------TLSPTKNNDSNETQVPSKINLSNINSSSPPLG 1500
             S     LLE KLS LE Q         TL  ++NN  N+TQ   KIN    +S  P + 
Sbjct: 880  SSEKTLNLLEHKLSLLEKQNNEKSNKINTLIESENN--NKTQ---KINPFTFSSVEPKIS 934

Query: 1501 EKV 1503
              V
Sbjct: 935  NLV 937

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 111/237 (46%), Gaps = 43/237 (18%)

Query: 369 ILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAK 428
           +L++ LV EK     LQ ++ S L+EL  KLP + S KE+N  L+     I SS EE  +
Sbjct: 211 VLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQ 270

Query: 429 ERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPF---TEKEATL 485
           +      ++ ++  KI + EQ   +LL QR++L   +  LL  I+  S +   +E E  L
Sbjct: 271 QFHSNTDKIASMNNKIVDYEQSLKQLLSQRTNLISYILNLLNVINLNSKYLNLSESEGCL 330

Query: 486 VKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQK 545
           ++ + +NE              R+  F     LQ+KN+ L      L             
Sbjct: 331 IQNLFNNE--------------RIQRF-----LQEKNLTLTEIFDNL------------N 359

Query: 546 TLRITDNN------KIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVTNSTI 596
           T+ IT NN      K++   +S S   ++ I   +++I ++    D+YK+++ N+ I
Sbjct: 360 TVDITFNNFNRSDIKVLPPTESAS---KEEIINYKNEIILLENNCDAYKMILYNNGI 413

>YCR030C Chr3 complement(173826..176438) [2613 bp, 870 aa] {ON}
            SYP1Protein of unknown function that is involved in
            endocytic site formation; may regulate assembly and
            disassembly of the septin ring; colocalizes and interacts
            with septin subunits; potential role in actin
            cytoskeletal organization
          Length = 870

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 51/90 (56%), Gaps = 9/90 (10%)

Query: 1273 IESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQ 1332
            IE LKS+L+S   Y N T++ +++++LKES +        +  K+  +KL K   +I   
Sbjct: 105  IEELKSDLKSSTEYYN-TLDQQVVRELKESVENNTSW---RESKDLHSKLSKNAASIEHY 160

Query: 1333 RKNNILANGQESANIEELKKKWEEEQEALI 1362
             KNN     + S+++EE +++W+++   L 
Sbjct: 161  SKNN-----ENSSHLEEARRQWDQQSPYLF 185

>Skud_3.108 Chr3 complement(158356..160974) [2619 bp, 872 aa] {ON}
            YCR030C (REAL)
          Length = 872

 Score = 36.6 bits (83), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 50/90 (55%), Gaps = 9/90 (10%)

Query: 1273 IESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQ 1332
            IE LK++L++   Y N T++ +++ +LKES +        +  K+  +KL K   +I   
Sbjct: 105  IEELKADLKASTEYYN-TLDHQVVHELKESVENNTSW---RESKDLHSKLSKNAASIEHY 160

Query: 1333 RKNNILANGQESANIEELKKKWEEEQEALI 1362
             KNN     ++S N+EE +++W+++   L 
Sbjct: 161  SKNN-----EKSTNLEEARRQWDQQSPYLF 185

>KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} similar to
            uniprot|P18851 YOR212W Saccharomyces cerevisiae STE4 G
            protein beta subunit
          Length = 436

 Score = 36.2 bits (82), Expect = 0.73,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 1147 KIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQ 1206
            +++  + H  ++    T+E+++ T +TE  QL D+ +R+K +  +      T  +NL+  
Sbjct: 14   ELIVHDYHYPNMNSAGTVEDKIRTAKTECKQLYDQINRIKGKIQD------TQLMNLSHG 67

Query: 1207 INELNETKVNLEKSLQ 1222
            +N L+E  +   ++L+
Sbjct: 68   VNSLHELNLQPVRTLK 83

>Suva_12.225 Chr12 complement(353202..355328) [2127 bp, 708 aa] {ON}
            YJR134C (REAL)
          Length = 708

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 59/114 (51%), Gaps = 10/114 (8%)

Query: 1084 ENCTKVNETLSSQLADMQVKLEPLEQEINE----LKLKVAEKEQHLNICQEELERWKLRS 1139
            EN ++V +  SSQ   ++ +LE  +   N     L +K+ + E HL   ++E  R++   
Sbjct: 335  ENGSEVKQHTSSQYNLLKEQLESSKANWNSIEYALNIKIVDLENHLTSTRKEKTRFEEAY 394

Query: 1140 QTILQQGKIV------EEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKK 1187
            QT L   + +      E+E H+ +  ++K LE Q+ET++     + D ++ LKK
Sbjct: 395  QTALDSSETLSEQLEREKENHLNAASQVKELERQIETLKLSLQSVNDDYNLLKK 448

>Smik_3.133 Chr3 complement(171934..174546) [2613 bp, 870 aa] {ON}
            YCR030C (REAL)
          Length = 870

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 49/90 (54%), Gaps = 9/90 (10%)

Query: 1273 IESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQ 1332
            I+ LKS+L+S   Y N T++ +++++LKES +        +  K+  +KL K   +I   
Sbjct: 105  IDELKSDLRSSTEYYN-TLDHQVVRELKESVENNTSW---RESKDLHSKLSKNAASIEHY 160

Query: 1333 RKNNILANGQESANIEELKKKWEEEQEALI 1362
             K N     + S ++EE +++W+E+   L 
Sbjct: 161  SKTN-----ENSVHLEEARRQWDEQSPYLF 185

>KAFR0E01470 Chr5 complement(293344..295962) [2619 bp, 872 aa] {ON}
            Anc_5.296 YDR285W
          Length = 872

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 67/124 (54%), Gaps = 2/124 (1%)

Query: 1165 EEQLETVRTENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQE 1224
            EE +E    +N  + + F++ K   +EKL+ +++       +  +LNETK++   + + +
Sbjct: 534  EELIEKFEAQNNTIIE-FEKTKADFNEKLNLSESKLNYFKNECAKLNETKMSDTANFENK 592

Query: 1225 IEKNNQSGNGAADESEEIIRLRAELEKS-NNFSNELEKKVEDAKKFKNEIESLKSELQSV 1283
            I   N+  N    E++ + +   ELE+S NNF  +   K E+ +KF  +++ L  E+  +
Sbjct: 593  IASQNRINNVLMSENDTLKQRITELEESKNNFEKDQNVKFENIQKFHEQLQKLNVEIVQM 652

Query: 1284 KAYE 1287
            KA+E
Sbjct: 653  KAHE 656

>KLTH0B01232g Chr2 complement(108265..110865) [2601 bp, 866 aa] {ON}
           similar to uniprot|P46675 Saccharomyces cerevisiae
           YLR045C STU2 Microtubule-associated protein (MAP) of the
           XMAP215/Dis1 family regulates microtubule dynamics
           during spindle orientation and metaphase chromosome
           alignment interacts with spindle pole body component
           Spc72p
          Length = 866

 Score = 35.4 bits (80), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 7/73 (9%)

Query: 384 LQRQVESFLVELEQKLPMIDSFKER-------NSSLERELLRITSSLEETAKERDIKDRE 436
           LQRQ + +L E ++ L  I  F+ +       NSSL ++L  + SSL E+  E   K+ +
Sbjct: 656 LQRQKQKWLKERQEFLATITDFQNKASHLSSENSSLRQQLDTVQSSLHESNIELRSKEMQ 715

Query: 437 LTNLQKKISNNEQ 449
           +T LQ +ISN EQ
Sbjct: 716 ITRLQDRISNLEQ 728

>Skud_12.404 Chr12 (712901..717283) [4383 bp, 1460 aa] {ON} YLR320W
           (REAL)
          Length = 1460

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 8/80 (10%)

Query: 1   MSTDSRNEPTPSIIDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMKENSFVSAAIDDI 60
           +ST SR E    ++D I SFF L    ++S+  + +E +YT  Y L        ++I DI
Sbjct: 708 ISTASRLEMDAKLVDHIVSFFKLLSICYDSVTRNPMEYLYTSYYIL--------SSIVDI 759

Query: 61  KHVYEGKINTISQKYFNLQL 80
            H  E   ++  +  F+ Q+
Sbjct: 760 IHKKEALWDSFQKHPFSPQI 779

>ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YHR023W (MYO1)
          Length = 1805

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 119/257 (46%), Gaps = 56/257 (21%)

Query: 1205 TQINELNETKVNLEK---SLQQEIEKNN-QSGNGAADESE---EIIRLRAELEKSNNFSN 1257
            T+I EL   K NL+K   S++++++ +  Q+    AD+S+   ++ +L+ EL+       
Sbjct: 913  TKIKELEREKSNLQKQIDSMKRQVDSSTKQAMAMKADKSDLESQLRKLKLELKSKEKRVK 972

Query: 1258 ELEKKVEDAKKFKNEIESLKSELQSV--------KAYENSTVNSKIIKDLKESFKREKDE 1309
            ELE+KV+      N  E LK +LQ V        K  E  T  +K++KD  E  K+E+ E
Sbjct: 973  ELEQKVD------NSGEDLKLKLQQVERAAATNNKRLEQLTSENKLMKDQMEKSKKEQHE 1026

Query: 1310 LIEQMKK------EFKTKLEKEKETI--LAQRKNNILANGQESAN--------IEELKKK 1353
               Q+            ++E E+E +  L + ++N++A  ++  N        I E KKK
Sbjct: 1027 SQRQLSSRGSELIRLNERIEAEREQVSDLTRERDNLVAEHEQVVNQLAIARSEIAEYKKK 1086

Query: 1354 WEEEQEALILKRITEAEENLKKRM--RLPSEEKINAVIEKRRKVLEQEFETKLRELG--- 1408
             E          +    EN+K+      P+ + + A +E R + LE E  TK R +    
Sbjct: 1087 IEA---------LKAEAENMKENYAESSPASQALVATVENRMRGLEDEL-TKERAMNRFL 1136

Query: 1409 ----LNADGNGVVTDTR 1421
                L+A  NG V D +
Sbjct: 1137 NEKLLSAFHNGGVHDAQ 1153

>Suva_3.63 Chr3 complement(86986..89601) [2616 bp, 871 aa] {ON}
            YCR030C (REAL)
          Length = 871

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 9/90 (10%)

Query: 1273 IESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQ 1332
            IE LK++L+S   Y N T++++++ +LKES +        +  K+  +KL K   +I   
Sbjct: 105  IEELKTDLKSSTEYYN-TLDNQVVHELKESVENNTSW---RESKDLHSKLSKNAASIEHY 160

Query: 1333 RKNNILANGQESANIEELKKKWEEEQEALI 1362
             KN     G  S  +E+ +++W+ +   L 
Sbjct: 161  SKN-----GGNSGQLEDARRQWDSQSPYLF 185

>NDAI0G00220 Chr7 (29472..31436) [1965 bp, 654 aa] {ON} Anc_1.493
           YML046W
          Length = 654

 Score = 34.3 bits (77), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 36/64 (56%)

Query: 365 KLIEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLE 424
           KLI +  + +VK K   DT+++ +E    ++ Q+ P+   + ++ +++E +L  +  S+ 
Sbjct: 52  KLIAMTEQLVVKYKDPNDTIKQSIEIIFYQILQRYPLFFGYWKKFTAIEYQLYGLEKSIA 111

Query: 425 ETAK 428
             AK
Sbjct: 112 TLAK 115

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 294 LHNEIASYKKQIERLT-SKNLETPEKKIIQELVDLKEKLVNS 334
           ++++++ Y++ + RL  S +   P+KKI QEL+D+  KL NS
Sbjct: 46  IYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNS 87

>Kpol_1018.21 s1018 (56444..57697) [1254 bp, 417 aa] {ON}
           (56444..57697) [1254 nt, 418 aa]
          Length = 417

 Score = 33.5 bits (75), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 84/173 (48%), Gaps = 36/173 (20%)

Query: 150 LELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIK-- 207
           L+L D L +NS +          +DS+ +E+     +NKK QT ++     N Y++ +  
Sbjct: 227 LQLLDKLDKNSKM----------IDSLNREV-----QNKKQQTKLQESNYKNKYMQTRNE 271

Query: 208 -CKETDKNKKLYSSAEDASRLQDQLQIVSSEILSLKSEIATL--KYMNESLSTD-----L 259
              E   +KKLY +     +   QL+I+S E L L++ I TL  + +NE+L  D     L
Sbjct: 272 LINELRHSKKLYDNYYKLFQKYQQLKIISKESLELQNRIPTLDDRLVNETLVKDRKINEL 331

Query: 260 QRKLFRIKDLDDNLNSSKQ-----------EFAKEITLKQRVNELLHNEIASY 301
           Q+++  ++  ++NL + ++           E   ++ L+  V+   H+  ++Y
Sbjct: 332 QKRIQSLQIANENLTTQREIDILKYESRIKELEAKLILQNDVHSQFHHSTSTY 384

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
           Anc_4.238 YDL058W
          Length = 1928

 Score = 33.5 bits (75), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 84/187 (44%), Gaps = 26/187 (13%)

Query: 754 DNKVLQLETSLSERELPK------NTQIKNEEKEPAKQQTYTFERKKLESVNDSDISYLY 807
           DN    L  +L E  LPK        Q+ NE         Y  +   + S ++  IS + 
Sbjct: 646 DNDFDILNAALDETGLPKVYFSSYFVQLINE-------NFYRIKNAFVHSPDEEPISKIS 698

Query: 808 YENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYTKVKNDLKQATYKLASV---- 863
           +E  EELQN+   L+ EL+ +  D     +S   L+N+   +  + + ++ +LAS+    
Sbjct: 699 FEAFEELQNRCIALKEELETLHHDNKASIDS---LQNQLKTISGEYEDSSTELASLKTEH 755

Query: 864 ------YTTLEQKNSFLANSVSQLQGKEKELNELKSKLVEKTEKLQMAENENSEKINNAI 917
                 Y T++ + S +  S+ Q+  +   L+ LK +   K EK +    E  EK+ N  
Sbjct: 756 SLLSDKYDTIKVELSDMTTSLKQITEERDTLDALKKENENKIEKNEELLKEYKEKLQNIE 815

Query: 918 VLLQTMV 924
             LQT++
Sbjct: 816 TQLQTII 822

>TBLA0I02900 Chr9 complement(687092..692476) [5385 bp, 1794 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1794

 Score = 33.5 bits (75), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 74/144 (51%), Gaps = 19/144 (13%)

Query: 728  EISNLKSKNKNLEDKILTMTLSKNLLDNKVLQLETSLSERELPKNTQIKNE--EKEPAKQ 785
            E+S L S+   L +KI T+   KN+L++++++LE SLS+ E+     +++   EKE  ++
Sbjct: 1023 EVSTLTSQVALLNEKISTLISEKNVLNSQIIELEHSLSKSEILSKEALESSLVEKEANEK 1082

Query: 786  QTYTFERKKLESVNDSDISYLYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENK 845
            Q          S+N  ++S    +N+E L N    LR EL   QED   K  + + L N 
Sbjct: 1083 QILELTT----SIN--ELSADKKKNIETLDN----LRTELSSCQEDSKTKDSTIINLNNT 1132

Query: 846  YTKVKNDLKQATYKLASVYTTLEQ 869
                   +K A  KLAS  + LE+
Sbjct: 1133 -------IKIAEDKLASSESRLEE 1149

>SAKL0F14894g Chr6 complement(1202168..1206061) [3894 bp, 1297 aa]
           {ON} similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1297

 Score = 33.1 bits (74), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%)

Query: 123 DLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQEL 180
           D E +Q++ +  EA     E  L + + ELQDS   NS LKEQIG       S+  EL
Sbjct: 643 DTETLQQELSVAEANYHAVEGKLTELQKELQDSEQSNSQLKEQIGNLNAMAASLQTEL 700

>ZYRO0G02310g Chr7 (177479..178666) [1188 bp, 395 aa] {ON} similar to
            uniprot|P47124 Saccharomyces cerevisiae YJR075W HOC1
            Alpha-1 6-mannosyltransferase involved in cell wall
            mannan biosynthesis subunit of a Golgi-localized complex
            that also contains Anp1p Mnn9p Mnn11p and Mnn10p
            identified as a suppressor of a cell lysis sensitive
            pkc1- 371 allele
          Length = 395

 Score = 32.7 bits (73), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 95/212 (44%), Gaps = 31/212 (14%)

Query: 1211 NETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSNNFSNELEKKVED-AKKF 1269
            N    +L+K LQ   ++ +QS N AA   +    L    E   N +NEL+KK ED A++F
Sbjct: 33   NSKAADLQKLLQNLPKEISQSINLAASHQKSDADLIQSFE---NLANELKKKQEDQAREF 89

Query: 1270 KNEIESLKSELQSVK-AYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKET 1328
            +   + L+ +LQ +K + E++T+  K+  + +   ++     I Q+              
Sbjct: 90   ERHRQELEKKLQELKLSPEHATLREKLAYNFRYDERKRFPAYIWQIGG------------ 137

Query: 1329 ILAQRKNNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPS-EEKINA 1387
                     ++  +E  N+EE ++ W ++    + + +T+   N   R    S  + INA
Sbjct: 138  ---------VSGTEELKNLEEQERNWRDKNPGFVHEIVTDEMMNALVRHYFSSVPDVINA 188

Query: 1388 VIEKRRKVLEQEFETKLRELGLNADGNGVVTD 1419
                  KVL+ +F    + L L A G GV  D
Sbjct: 189  YNALPSKVLKVDF---FKYLILLARG-GVYAD 216

>Ecym_3434 Chr3 (816557..818017) [1461 bp, 486 aa] {ON} similar to
           Ashbya gossypii AAR042W
          Length = 486

 Score = 32.7 bits (73), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%)

Query: 245 IATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIA 299
           I++LK+ NE+L++ L RK  R++DLD  L   K  +    T  + + + L N+ A
Sbjct: 149 ISSLKHENENLNSMLNRKTRRVRDLDTELGQLKVSYEDATTSHKHLKDQLENKFA 203

>Skud_13.393 Chr13 complement(692641..694725) [2085 bp, 694 aa] {ON}
            YMR224C (REAL)
          Length = 694

 Score = 32.7 bits (73), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 66/160 (41%), Gaps = 23/160 (14%)

Query: 1128 CQEELERWKLRSQTILQQGK-----IVEEEAHMKSL--------EKIKTLEEQLETVRTE 1174
            C   L    +++  +LQ G      + E EA  K +        E  K     LETVRT 
Sbjct: 245  CIPNLVHNPMKNFDVLQPGSSVATSLCEAEAQPKYVFVLDIKHGEPPKMTPITLETVRTF 304

Query: 1175 NAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNE-TKVNLEKSLQQEIEKNNQSGN 1233
              +     D    + H+K   +K +   +   INE NE TK  L          ++  G+
Sbjct: 305  KMRSISLQDVPHLRPHDKDATSKYLIEQVEGMINEANEETKRKL---------GDDAEGD 355

Query: 1234 GAADESEEIIRLRAELEKSNNFSNELEKKVEDAKKFKNEI 1273
              A+  + +IRLR +     N  + ++ +VE+ ++F N  
Sbjct: 356  MIAELPKPLIRLRVDYSAPFNKQSTIDYQVENPRRFSNRF 395

>Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W
            (REAL)
          Length = 451

 Score = 32.3 bits (72), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 1040 REKFPSFVKIDQQSKKEEDKE-EVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLA 1098
            R KF  +  I QQ K+ ED + E + +  +L  LEE N +L  +++  TK+ ETLS    
Sbjct: 155  RSKFDDYNLIQQQLKQYEDTDGENIPDEQELQKLEEQNKELEIQLKKLTKIQETLSIDYN 214

Query: 1099 DMQVKLEPLEQEINELKLKVAEKE 1122
            D ++  + + +++  L  ++ E E
Sbjct: 215  DYKISKQSIFKDLEALSFQIVELE 238

>CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {ON}
           highly similar to uniprot|P32892 Saccharomyces
           cerevisiae YLL008w DRS1 RNA helicase of the DEAD box
           family
          Length = 725

 Score = 32.7 bits (73), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 12/82 (14%)

Query: 392 LVELEQKLP---MIDSFKERNSSLERELLRITSSLEETAKERD-IKDRELTNLQKKISNN 447
           L+ L  K P   MID  K+  + L +E +RI        ++RD +K   L NL +K+  N
Sbjct: 401 LISLSLKRPVRIMIDPPKQAATKLTQEFVRI--------RKRDHLKPSLLFNLIRKLDPN 452

Query: 448 EQFNDELLRQRSDLAHQVQYLL 469
            Q    +   R D+AH+++ +L
Sbjct: 453 GQKRIVVFVARKDMAHKLRIIL 474

>KNAG0A07400 Chr1 complement(1157757..1159022) [1266 bp, 421 aa] {ON}
            Anc_3.393 YBR130C
          Length = 421

 Score = 32.3 bits (72), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 69/154 (44%), Gaps = 40/154 (25%)

Query: 1161 IKTLEEQLETVRTENAQLTDRFDRLKKQAH---EKLDAAKTMQINLTTQINELNETKVNL 1217
            I+TL E+++T+ + N QLT        Q+H   EKLD A+  +I L   I+  N  + NL
Sbjct: 60   IETLHEKVDTLTSTNLQLT-------LQSHTLLEKLDHAQKREIKLNENISHYNHERDNL 112

Query: 1218 EKSLQQEIEKNNQSGNGAADESEEIIRLRAELEKSN------------------------ 1253
               LQ++  K N+       E +E+++    L+ SN                        
Sbjct: 113  NSMLQRKKRKINE----LQGEIDELVQTFDSLQTSNSTLEKEIEENSALVDDYKEKTASL 168

Query: 1254 --NFSNELEKKVEDAKKFKNEIESLKSELQSVKA 1285
              N+   L+ +      F+ EI+SL  +++++KA
Sbjct: 169  TRNYDTVLQAQDSYTSHFETEIQSLVEQIKAIKA 202

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.124    0.315 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 170,057,983
Number of extensions: 8659855
Number of successful extensions: 101872
Number of sequences better than 10.0: 5536
Number of HSP's gapped: 84832
Number of HSP's successfully gapped: 12656
Length of query: 1554
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1431
Effective length of database: 39,377,481
Effective search space: 56349175311
Effective search space used: 56349175311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)