Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F002805.703ON61061029660.0
NCAS0G002205.703ON59260114190.0
Skud_9.185.703ON57161513550.0
Suva_9.385.703ON56961313371e-178
Smik_9.195.703ON57261213161e-175
YIL150C (MCM10)5.703ON57161213161e-175
Kpol_1043.715.703ON58549412461e-165
ZYRO0G06578g5.703ON56955912451e-165
KAFR0D022105.703ON58462012291e-162
KNAG0L021505.703ON61656812111e-159
TDEL0B021705.703ON56761312051e-159
TPHA0E002105.703ON54455911681e-153
TBLA0G010205.703ON59463811531e-150
CAGL0H06589g5.703ON58350711151e-145
KLTH0E01034g5.703ON58348010701e-138
Kwal_55.196915.703ON46648810511e-137
SAKL0E14938g5.703ON57456210341e-133
AFR287W5.703ON6114969351e-118
KLLA0A00572g5.703ON5776157447e-90
Ecym_34987.262ON13573702.7
NDAI0A061403.58ON68488724.7
TDEL0C017907.368ON56179707.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F00280
         (610 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...  1147   0.0  
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   551   0.0  
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   526   0.0  
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   519   e-178
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   511   e-175
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   511   e-175
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   484   e-165
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   484   e-165
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   478   e-162
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   471   e-159
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   468   e-159
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   454   e-153
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   448   e-150
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   434   e-145
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   416   e-138
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   409   e-137
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   402   e-133
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   364   e-118
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   291   7e-90
Ecym_3498 Chr3 (931185..931187,931658..932062) [408 bp, 135 aa] ...    32   2.7  
NDAI0A06140 Chr1 complement(1394748..1396802) [2055 bp, 684 aa] ...    32   4.7  
TDEL0C01790 Chr3 complement(311853..313538) [1686 bp, 561 aa] {O...    32   7.7  

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score = 1147 bits (2966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/610 (92%), Positives = 565/610 (92%)

Query: 1   MNDPRECSPEDPFADLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNFDE 60
           MNDPRECSPEDPFADLS                                     DPNFDE
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKXXXXXXXXFSGERLPNPNELKVREREENLEKL 120
           VQIPGTPEEKNTNIFTSEQTILQNRDRK        FSGERLPNPNELKVREREENLEKL
Sbjct: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKL 120

Query: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180
           PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE
Sbjct: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240
           EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS
Sbjct: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300
           IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN
Sbjct: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300

Query: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360
           NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH
Sbjct: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360

Query: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420
           QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK
Sbjct: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420

Query: 421 NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA 480
           NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA
Sbjct: 421 NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA 480

Query: 481 IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSGKDN 540
           IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSGKDN
Sbjct: 481 IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSGKDN 540

Query: 541 VHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLNDDV 600
           VHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLNDDV
Sbjct: 541 VHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLNDDV 600

Query: 601 DTSESDLEIV 610
           DTSESDLEIV
Sbjct: 601 DTSESDLEIV 610

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/601 (51%), Positives = 398/601 (66%), Gaps = 46/601 (7%)

Query: 1   MNDPRECSPEDPFADLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNFDE 60
           MNDPRE    DP+ ++S                                     DPNF +
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 61  VQIPGTPEEKN-TNIFTSEQTILQNRDRKXXXXXXXXFSGERLP--NPNELKVREREENL 117
           +Q+P +P +K  TN+  + +      +               +P  NPNEL++RE+    
Sbjct: 61  LQVPCSPVKKTETNVPVAMKKSTNEME---------------IPHENPNELRIREKSG-- 103

Query: 118 EKLPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAAN 177
            +LPSNTT+YFMEKFQ  KK+EE +  + E M+ ARVH FQ      +  K E++P   N
Sbjct: 104 -QLPSNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQ-----DQGGKQEFKPIQVN 157

Query: 178 EVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQ 237
           E+EEYS + ++KRYIP+ EL  +  NIKILRL+KLFAKVRPPKF EPQYSNW  LGII+ 
Sbjct: 158 EIEEYSNIWLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISA 217

Query: 238 KGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWR 297
           KG  KFT++DKPKKY KFT++DF++ +D++IF K  VERYYNLR+GD+IAILNPEV PWR
Sbjct: 218 KGDAKFTTTDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWR 277

Query: 298 PSNNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGT-CHTPIDISKEDR 356
           PS    G  IKSFNLRINH++ CI+E+G SKDLGFC + ++   +GT C+TPI++SKEDR
Sbjct: 278 PSG--KGQFIKSFNLRINHDFKCILEIGSSKDLGFCKVTSR---NGTLCNTPINMSKEDR 332

Query: 357 CSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGS 416
           C YHQEIRFR+N SKRIELNGSFALGAP KV   P LYR  N   R      +   V  S
Sbjct: 333 CDYHQEIRFRDNNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSAS 392

Query: 417 --EIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLD 474
              I K++  L    R R+FS+NNSAKAFFDEKFQNPDML NL++KRRKI DDK+   +D
Sbjct: 393 FGSINKDQFDL----RNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRID 448

Query: 475 QELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTG- 533
           +ELSKAI N++S+ L G ++  E  +MK ATETTLQ+GVIQRLGFDPTHGKIA VL+T  
Sbjct: 449 KELSKAIGNRASDDL-GERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTH 507

Query: 534 ----KDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGK 589
               KD+  + +  + K +KV DLL F+K  V+LAP + ELI+R++RRE +WQ++FG  +
Sbjct: 508 SKEEKDTLSEQM--SGKKDKVNDLLHFRKSHVILAPTRNELIERRDRRERIWQENFGQKR 565

Query: 590 R 590
           +
Sbjct: 566 K 566

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/615 (47%), Positives = 393/615 (63%), Gaps = 49/615 (7%)

Query: 1   MNDPRECSPEDPFADLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNFDE 60
           M+DPRE    DP+ +++                                     DPNF+ 
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKXXXXXXXXFSGERLPNPNELKVREREENLEKL 120
           +++P +P  KN NI  S+ T+   RD +               N N+LK+ + ++  E L
Sbjct: 61  IEVPQSPA-KNRNIMKSQNTM--KRDMRPAAS-----------NINDLKLSQLQQKQE-L 105

Query: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180
           PSNTT YFM+KFQ+ K+ EE +  + E M+ ARVH F G +K       EY+   ANE+E
Sbjct: 106 PSNTTGYFMQKFQNAKRNEEKQRAKYENMMNARVHTF-GTDKK------EYRATIANELE 158

Query: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240
           E+S + ++KRYIP+ +L      IKILRL KLFAK+RPPKF+EP Y+NW  +G+I+ K  
Sbjct: 159 EFSNIWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSD 218

Query: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300
           +KFTSSDKP K+F FTI+DF++ +D++IF K AVERYYNLR+GD+IAILNPEVLPWRPS 
Sbjct: 219 VKFTSSDKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSG 278

Query: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360
              G  IKSFNLRI+H++ CI+E+G S+DLG+CPI N+  ++  C +PI+I+    C YH
Sbjct: 279 --QGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNR-KKNENCGSPINIALHKCCDYH 335

Query: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420
           +E++FR   +KRIELNG +ALGAP KV AQP LYR      +G    N FN+V+   IRK
Sbjct: 336 REVQFRGTSAKRIELNGGYALGAPTKVDAQPTLYR-----AKG---ENNFNLVRS--IRK 385

Query: 421 NESKLMEERRRR---YFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQEL 477
             S+  EER ++    F ++NSAKAFFDEKFQNPDML NLD+KRRKI D K+S  L +EL
Sbjct: 386 TLSE-EEERMKKNSHNFRNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALSREL 444

Query: 478 SKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSG 537
            K +  K S+ L  +K  +E  K+K  TE+ LQTG++QRLGFDPTHGKI+KVL++    G
Sbjct: 445 GKIMRRKGSSGLE-DKCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGG 503

Query: 538 --KDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQP 595
             ++ V    K   + DLL +KK KV+LAP+K E  K+++ REEVWQKHFGS      + 
Sbjct: 504 EPRNKVMGGKKT-VIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS------KD 556

Query: 596 LNDDVDTSESDLEIV 610
            ++  D S SDLEIV
Sbjct: 557 TDEVSDASTSDLEIV 571

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  519 bits (1337), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 283/613 (46%), Positives = 387/613 (63%), Gaps = 47/613 (7%)

Query: 1   MNDPRECSPEDPFADLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNFDE 60
           M+DPRE    DP+ +++                                     DPNF+ 
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKXXXXXXXXFSGERLPNPNELKVREREENLEKL 120
           V++P +P +K+  I    Q  L+   R                N NE  + ++ +   + 
Sbjct: 61  VEVPQSPAKKS--IVKKSQDALKQAIRPVAS------------NINESMLSQQSQ---ES 103

Query: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180
           PSNTT+YFM+KFQ  K+ E+ +  + E M+ ARVH F   NK       EY+P   NE+E
Sbjct: 104 PSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNK-------EYKPIITNELE 156

Query: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240
            +S L ++KRYIP+++L      IKILRLNKLFAK+RPPKF+EP Y+NW T+G+I+ K  
Sbjct: 157 SFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSD 216

Query: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300
           IKFTSS+KP K+F FTI+DF++++D++IF K  VERYYNLR+GD+IAILNPEVLPWRPS 
Sbjct: 217 IKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG 276

Query: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360
              G  IKSFNLRI+H++ CI+E+G S+DLG+CPI NK     +C +PI+ +    C YH
Sbjct: 277 --RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHK-SCGSPINTNVHMCCDYH 333

Query: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420
           +E++FR  G+KRIELNG +ALGAP KV +QP LYR      +G    N+FN+V+ +    
Sbjct: 334 REVQFRGTGAKRIELNGGYALGAPTKVDSQPSLYR-----AKG---ENQFNIVRSTRKGL 385

Query: 421 NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA 480
           +E +   +R    F+++NSAKAFFDEKFQNPDML NLD+KRRKI D K+S  L +EL K 
Sbjct: 386 SEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKI 445

Query: 481 IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQT---GKDSG 537
           +  K S+ L  +K++ E  KMK  TE+ LQTG+IQRLGFDPTHGKI+KVL++   G +S 
Sbjct: 446 MRRKDSSGLE-DKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESM 504

Query: 538 KDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLN 597
            + ++    V  + DLL++KK KV+LAP+K E  K+++ REEVWQ+HFGS +        
Sbjct: 505 PNRINGKKTV--INDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVAS--- 559

Query: 598 DDVDTSESDLEIV 610
              D S SDLEIV
Sbjct: 560 ---DASGSDLEIV 569

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  511 bits (1316), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 280/612 (45%), Positives = 380/612 (62%), Gaps = 42/612 (6%)

Query: 1   MNDPRECSPEDPFADLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNFDE 60
           M+DPRE    DP+  ++                                     DPNF+ 
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKXXXXXXXXFSGERLPNPNELKVREREENLEKL 120
           +++P +P +  + + +  Q  ++   R                N NE  + + ++  E L
Sbjct: 61  IEVPQSPTK--SRVKSGSQNAVKQVTRLETS------------NANESNLSQIQKQPE-L 105

Query: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180
           P NTT+YFM+KFQ+ KK E+ +  + E M+ ARVH F   NK       +Y+P  ANE+E
Sbjct: 106 PINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDNK-------KYKPIIANELE 158

Query: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240
            +S L ++KRYIP+ +L      IKILRL KLFAKVRPPKF+ P+Y+NW T+G+I+ K  
Sbjct: 159 GFSNLWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSD 218

Query: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300
           IKFTSS+KP K+F FTI+DF++ +D++IF K  VERYYNLR+GDIIAILNPEVLPWRPS 
Sbjct: 219 IKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSG 278

Query: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360
              G  IKSFNLRI+H++ CI+E+G S+DLG+CPI N       C +PI+IS    C YH
Sbjct: 279 --RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVN-TKTHKKCGSPINISLHKCCDYH 335

Query: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420
           +E++FR   +KRIELNG +ALGAP KV +QP LY+      +G    NRFN+++ +    
Sbjct: 336 REVQFRGTSAKRIELNGGYALGAPTKVNSQPSLYK-----AKG---ENRFNIIRDARKGL 387

Query: 421 NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA 480
           +E +   ++    F+++NSAKAFFDEKFQNPDML NLD KRRKI D K+S  L++EL+K 
Sbjct: 388 SEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKI 447

Query: 481 IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSG--K 538
           +  K S+ L  +K+  E  KMK  TE  LQTG+IQRLGFDPTHG+I+KVL++    G  K
Sbjct: 448 MRRKESSGLE-DKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESK 506

Query: 539 DNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLND 598
           +N+ N  K   + DLL +KK KV+LAP+K E  K++N REEVWQ+HFG      E     
Sbjct: 507 NNLLNGKKT-VINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKGEAEEAS--- 562

Query: 599 DVDTSESDLEIV 610
             D S SDLEI+
Sbjct: 563 --DASASDLEII 572

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  511 bits (1316), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 276/612 (45%), Positives = 378/612 (61%), Gaps = 43/612 (7%)

Query: 1   MNDPRECSPEDPFADLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNFDE 60
           MNDPRE    DP+ +++                                     DPNF+ 
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKXXXXXXXXFSGERLPNPNELKVREREENLEKL 120
           +++P +P +    + +   T                F G    N NE+++ + ++   K 
Sbjct: 61  IEVPQSPTKNRVKVGSHNAT-----------QQGTKFEGS---NINEVRLSQLQQQ-PKP 105

Query: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180
           P++TT+YFMEKFQ+ KK E+ +  + E M+ ARVH F    K       +Y P   NE+E
Sbjct: 106 PASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEK-------KYVPIITNELE 158

Query: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240
            +S L ++KRYIP+ +L      IKILRL KLFAK+RPPKF+EP+Y+NW T+G+I+ K  
Sbjct: 159 SFSNLWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSD 218

Query: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300
           IKFTSS+KP K+F FTI+DF++ +D++IF K  VERYYNLR+GD+IAILNPEVLPWRPS 
Sbjct: 219 IKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG 278

Query: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360
              G  IKSFNLRI+H++ CI+E+G S+DLG+CPI NK      C +PI+IS    C YH
Sbjct: 279 --RGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHK-KCGSPINISLHKCCDYH 335

Query: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRK 420
           +E++FR   +KRIELNG +ALGAP KV +QP LY+            N FN++KG+  R 
Sbjct: 336 REVQFRGTSAKRIELNGGYALGAPTKVDSQPSLYKAKG--------ENGFNIIKGTRKRL 387

Query: 421 NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKA 480
           +E +   ++    F+++NSAKAFFDEKFQNPDML NLD KRRKI + K+S  L +EL K 
Sbjct: 388 SEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKI 447

Query: 481 IENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSG--K 538
           +  + S+ L  +K+  E  KMK  TE+ LQTG+IQRLGFDPTHGKI++VL++       K
Sbjct: 448 MRRRESSGLE-DKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPK 506

Query: 539 DNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLND 598
           +N+    K   + DLL +KK KV+LAP+K E  K+++ REEVWQKHFGS      +   +
Sbjct: 507 NNLLGKKKT-VINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS------KETKE 559

Query: 599 DVDTSESDLEIV 610
             D S SDLEI+
Sbjct: 560 TSDGSASDLEII 571

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  484 bits (1246), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 252/494 (51%), Positives = 340/494 (68%), Gaps = 33/494 (6%)

Query: 124 TTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVEEYS 183
           TTSYFMEKF + KK  E + V    M+ +RVH F G        K E++P   +E+++YS
Sbjct: 106 TTSYFMEKFYNSKKDHERKVVAYSSMMSSRVHTFSGTGS-----KKEFKPTDVDELDQYS 160

Query: 184 MLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGSIKF 243
            L ++ RYIP  ELN +  +IKILRL KLFAKVRPPKF EPQYSNWV  GIIT K  IK+
Sbjct: 161 NLWLRSRYIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKY 220

Query: 244 TSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSNNKN 303
           TSS KP KYFKFTISDF++N+D+FIF    VE+YYNLR+GD++AILNPE+LPWRPS N  
Sbjct: 221 TSSSKPTKYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSG 280

Query: 304 GTG--IKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYHQ 361
           G+G  IKSFNLRI+H + CI+E+G S+DLG+CPIPN  +++  C TPI+ SKED+C YH+
Sbjct: 281 GSGSTIKSFNLRISHKFDCILEIGASRDLGWCPIPN-ASKNTLCKTPINKSKEDKCQYHR 339

Query: 362 EIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNR----FNVVKGSE 417
           EI+FR   S R+EL+G++ALGAP KV A+P LY+N     RG  + +R    +N+V  S 
Sbjct: 340 EIQFRKTTSNRVELSGTYALGAPTKVDARPALYQN-----RGTSNNSRVQKSYNMVSDSH 394

Query: 418 IRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQEL 477
            +K +     E R  +FS+ NSAKAFFDE FQNPD+L NLD+KRRKI D K    +++ L
Sbjct: 395 YQKRKDSNKLETRMHHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSK----MERNL 450

Query: 478 SKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQ-TGKDS 536
            KA++N      + +K  K +  +K+AT+ TLQTG++QRLGFDPT GK++ V++ +  ++
Sbjct: 451 VKALKN------TVDKESKNFKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSET 504

Query: 537 GKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPL 596
              N +   K E + DL+ F+K  V L P+K++LIKR+  R+  W+K FG      +Q  
Sbjct: 505 EVTNKYQMEKKEALDDLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFG-----KQQSS 559

Query: 597 NDDVDTSESDLEIV 610
            D+ D S SDL+I+
Sbjct: 560 IDNNDDSGSDLKIL 573

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  484 bits (1245), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 265/559 (47%), Positives = 367/559 (65%), Gaps = 48/559 (8%)

Query: 55  DPNFDEVQIPGTPEEKNTNIFTSEQTILQNRDRKXXXXXXXXFSGE-RLPNPNELKVRER 113
           DPN   +Q+  +P++   ++     T+ Q   R           GE R  N NELK + +
Sbjct: 55  DPNLSHIQVESSPKKVTNSVLPP--TVQQQEPR-----------GEVRNENLNELKAQSQ 101

Query: 114 EENLEKLPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQP 173
           E+    +P+NTTS+F+EK+   K+K++ E    E +L  RVH FQG  +       EY+P
Sbjct: 102 EQ----IPANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQD-----EYKP 152

Query: 174 EAANEVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLG 233
              NE+EE+S L I KRYIPK+E   IF NIKILRL+KLFAKV+PPKF EP YSNW  +G
Sbjct: 153 IPTNELEEFSNLWISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIG 212

Query: 234 IITQKGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEV 293
           +I+ KG +KFTS+  PKKYFKFT+++F+Y++D +IF K  VERYYNLR+GDIIAILNP+V
Sbjct: 213 LISNKGEVKFTSAASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQV 272

Query: 294 LPWRPSNNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISK 353
           LPWRPS  K    IKSFNLRI+H + CI+E+G S+DLG+CP+ NK +++  C  PI+  K
Sbjct: 273 LPWRPSGTK--AHIKSFNLRISHKFECILEIGASRDLGWCPMFNK-SKNEICRAPINKDK 329

Query: 354 EDRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGN-RFNV 412
           ED C YH+E++FR+  +KR+EL+G++ALGAP ++ AQP LYR       G    N  +N+
Sbjct: 330 EDCCEYHRELKFRSTNAKRVELSGTYALGAPTRIDAQPALYRG------GSSQKNLNYNI 383

Query: 413 VK-GSEIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSN 471
           +  G++   N+     +   R+FS+ N+AKAFFDE+FQNP+ L NL+ KRRK+ D+++SN
Sbjct: 384 ITNGADGGSNKEINPLDINARHFSNRNAAKAFFDERFQNPETLRNLENKRRKLRDNRKSN 443

Query: 472 YLDQELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQ 531
            L++EL      K+S     +K+ +E  ++K  TE+T+ +G+++ LGFDPT GKIA V +
Sbjct: 444 ILNRELK-----KNSELDIKHKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFK 498

Query: 532 TGKDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRL 591
             + S  D    T K   V  LL FKK  V L P+KE LIK+K RRE VW++HFGSG   
Sbjct: 499 HQR-SDSDKKPLTEKDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHFGSG--- 554

Query: 592 AEQPLNDDVDTSESDLEIV 610
                 D+ D S+SDLEIV
Sbjct: 555 -----GDEKDDSDSDLEIV 568

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  478 bits (1229), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 270/620 (43%), Positives = 387/620 (62%), Gaps = 46/620 (7%)

Query: 1   MNDPRECSPEDPFADLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNFDE 60
           M+DPRE +P D + +++                                     DPNF  
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKXXXXXXXXFSGERLPNPNELKVRER-EENLEK 119
           VQ+P +P +K+      E  +++ +D+K         S E   NPNEL +++R ++   +
Sbjct: 61  VQVPASPVKKH------ELQLVEQKDQKLKNINRFEESNE---NPNELCLQQRFQKQTAR 111

Query: 120 L--PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAAN 177
           L   + +T YFMEKF+  K+KE++   ++E M+K+RVH F G+       K EYQ    +
Sbjct: 112 LNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEP-----KNEYQHVIVD 166

Query: 178 EVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQ 237
           E+E+YS L I KRY P   L  +   +KILRLNKLFAKVRPPKFEEPQYSNWV +GI++ 
Sbjct: 167 ELEQYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSD 226

Query: 238 KGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWR 297
           K  IKFT+S+KP+KY KFT++DFK+ VD +IF K  VERYYNLRIGDIIA+LNPE+LPWR
Sbjct: 227 KSDIKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWR 286

Query: 298 PSNNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRC 357
           PS  +N   IKSFNLRI+H Y CI+E+GKS+DL  CPI  + + S  C  PI+   +  C
Sbjct: 287 PSGKQN--YIKSFNLRISHPYKCILEIGKSRDLARCPIVVR-STSKECGVPINKKVDRCC 343

Query: 358 SYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNN---NVPVRGVYHGNRFNVVK 414
            YH+E+  R   SKR++L+G +ALGAP K+ +QP LYR +   NV ++        N   
Sbjct: 344 EYHREMEIRKGPSKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQ--------NFKL 395

Query: 415 GSEIRKNESKLMEE--RRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNY 472
                +N   L+++   + ++FS+ N+AKAFFD++FQNPDM++NLD KRRKI + ++SN 
Sbjct: 396 TPSYSQNNPHLIDKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNV 455

Query: 473 LDQELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQT 532
           L++EL + +  +    L G KT++E  KMK  T+ TLQ+G+ Q++GFDPT GKI+++L+ 
Sbjct: 456 LNRELDRLL--RKDQDLEG-KTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILK- 511

Query: 533 GKDSGKDNVHN--THKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKR 590
            K+  KD      + K   V DL+ FKK  ++LAP+K +L+ +KN+RE+VWQ++FG  K 
Sbjct: 512 NKERSKDGEPKFLSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQNK- 570

Query: 591 LAEQPLNDDVDTSESDLEIV 610
                 ++D   S+SDLEIV
Sbjct: 571 ------SNDNSESDSDLEIV 584

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  471 bits (1211), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 250/568 (44%), Positives = 364/568 (64%), Gaps = 30/568 (5%)

Query: 60  EVQIPGTPEEKNTNIFTSEQTILQNRDRKXXXXXXXXFSGERLPNPNELKVREREENLEK 119
           +VQ+P +P++++ +     +   +  +           +  +  N NE +  + + +  K
Sbjct: 62  DVQVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGK 121

Query: 120 LPSN-TTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANE 178
              N TTSYF+EKFQ  KK E++E    E ML ARVH FQG++K       E+Q EA NE
Sbjct: 122 QSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDK-------EFQLEAVNE 174

Query: 179 VEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQK 238
           +E++S L I KRYIPK+ L +  +++K+LRLNKLFAKVRPPKF+EPQYSNW  L II++K
Sbjct: 175 LEQFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKK 234

Query: 239 GSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRP 298
             +KFT+S  P+K+ +FT+++F+  +D+F+F    V+RYYNLR GDI+A+LNPE+LPWRP
Sbjct: 235 SEVKFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRP 294

Query: 299 S-NNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRC 357
           S  ++  T IKSFNL+I H + CI+E+GKS+DLG+CP+  K +    C + I+++++  C
Sbjct: 295 SGGSQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNE-KCGSAINLARDRTC 353

Query: 358 SYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVY------HGNRFN 411
            YH+E++ R N SKR++LNG FALGAP KVG QP L+R  +   +          G RF 
Sbjct: 354 EYHRELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFY 413

Query: 412 VVKGSEIRKNESKLMEER---RRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDK 468
                  R  +    EE    + ++F+S+N+AKAFFD++FQNPDML NLD KRRK+ D K
Sbjct: 414 TEPSWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSK 473

Query: 469 RSNYLDQELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAK 528
           +S  LD++L + + +K  +R + +K   E A +K  TET L TG+IQRLGFDPTHG+ A 
Sbjct: 474 KSRQLDRKLKRLL-SKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAAS 532

Query: 529 VLQ---TGKDSGK-DNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKH 584
           V++   + + SG  ++V  + K   V +LL +K+ K  L P++ +L  RK  R EVW++ 
Sbjct: 533 VMKKRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRET 592

Query: 585 FG-SGKRLAEQPL-NDDVDTSESDLEIV 610
           FG  G  +  QP+ NDD D    DLEIV
Sbjct: 593 FGKKGTPVDSQPVDNDDSD----DLEIV 616

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  468 bits (1205), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 266/613 (43%), Positives = 373/613 (60%), Gaps = 49/613 (7%)

Query: 1   MNDPRECSPEDPFADLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNFDE 60
           MNDPRE    DPF +L+                                     DPNFD 
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKSK-DPNFDA 59

Query: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKXXXXXXXXFSGERLPNPNELKVREREENLEKL 120
           +Q+  +P +K       E +    R ++             + N NE KV  R +    +
Sbjct: 60  IQVESSPVKKPAESIKVEPS----RTKRVLD----------IENLNEKKVESRSQ----I 101

Query: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180
           P+NTTSYF++ F++ KK+E+      +++L  RVH F+G++ + K   +     A  EVE
Sbjct: 102 PANTTSYFIDNFRNSKKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAV-----AVEEVE 156

Query: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240
           EYS L +++RYI + +L  +   +KILRL+KLFAK++PPKF EPQYSNW  +GII+ KG 
Sbjct: 157 EYSDLWVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQ 216

Query: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300
           +KF+SS KP KYFKFT++DF+YN+D+++F K  VERYYNLR+GDI+AILNPEVLPWRPS 
Sbjct: 217 VKFSSSGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPS- 275

Query: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360
            + G  IKSFNLRI+H++ CI+E+G+S+D+ +C   NK +++  C TPI+ +KE  C +H
Sbjct: 276 -EKGNFIKSFNLRISHDFPCILEIGQSRDIDWCKSFNK-SQNKACGTPINKTKEKCCDFH 333

Query: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKG---SE 417
           +EI+FR+N +KRIELNGSFALGAP KV + P LYR  +       H N F V+       
Sbjct: 334 REIQFRSNHAKRIELNGSFALGAPTKVDSGPALYREKSAGA----HRN-FKVLPNHYQKS 388

Query: 418 IRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQEL 477
           + KN      + R  +FS+ N+AKAFF+++FQNPD+L NLD+KRRK  DDK+S  L Q+L
Sbjct: 389 VGKN-----SDLRGIHFSNGNAAKAFFNDEFQNPDILNNLDSKRRKRQDDKKSLILQQQL 443

Query: 478 SKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSG 537
            +   N     +   K  K+Y ++   TE TLQ+G+IQ LGFDPTHG+I  VL+      
Sbjct: 444 KRI--NSRHAAIEIEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDK 501

Query: 538 KDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLN 597
            +N     K ++V  LL+FKK  V L PAKE L++RK  RE  WQ++FG      ++ +N
Sbjct: 502 SNNGQLNKKQKEVSSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFG------DKSVN 555

Query: 598 DDVDTSESDLEIV 610
              D S+SD+EIV
Sbjct: 556 LSSD-SDSDIEIV 567

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  454 bits (1168), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 249/559 (44%), Positives = 343/559 (61%), Gaps = 32/559 (5%)

Query: 55  DPNFDEVQIPGTPEEKNTNIFTSEQTILQNRDRKXXXXXXXXFSGERLPNPNELKVRERE 114
           DPNF ++QI  +PE+K +N  T+   I   R  +               NPNE KV    
Sbjct: 15  DPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDV-------------NPNEAKVVSNA 61

Query: 115 ENLEKLPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPE 174
                LP+NTTSYFM+ F   KK+E  +    ++ + +RVH F G N S K     YQ  
Sbjct: 62  N----LPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKK-----YQSI 112

Query: 175 AANEVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGI 234
              E+EEYS   I KRY+PK+E++    NIKILRLNKLFAK+RPPKF EP Y+NW   GI
Sbjct: 113 IVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGI 172

Query: 235 ITQKGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVL 294
           I  K  IK TSS  P K+FKFTI++F++ +DIFIF    VE+YYNLR+GDII ILNPEVL
Sbjct: 173 ICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVL 232

Query: 295 PWRPSNNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKE 354
           PWRP     G  IKSFNLRI+H + CI+E+ +SKD+ +C   N+      C+TPI+ SK+
Sbjct: 233 PWRPEF--KGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINR-KTGAKCNTPINKSKQ 289

Query: 355 DRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVK 414
           D C YH+E++FR+  +KR+EL+G++ALGAP ++ ++P LYR+ N     +  GN FN+V 
Sbjct: 290 DVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTS--NLKPGNNFNIVA 347

Query: 415 GSEIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLD 474
                K +       +R +FSS+NSAKAFFDE FQNPDML NL+ KRRKI DDKR   L 
Sbjct: 348 DRRYMKKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQ 407

Query: 475 QELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGK 534
           + L +++ N  S  L  +K+ +E   M++ T+ TLQ G IQ+LGFDPT G+I  VL+   
Sbjct: 408 RALRESVGN--SKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSA 465

Query: 535 DSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEV---WQKHFGSGKRL 591
           D    +     K   +++L+ FKK  V L P++E L+++ + RE+    ++K   + +  
Sbjct: 466 DKSTQSKLQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENR 525

Query: 592 AEQPLNDDVDTSESDLEIV 610
             +  +   DT   DLEI+
Sbjct: 526 DRKSASTKNDTDSDDLEII 544

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  448 bits (1153), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 265/638 (41%), Positives = 373/638 (58%), Gaps = 72/638 (11%)

Query: 1   MNDPRECSPEDPFADLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNF-- 58
           MNDPRE    D F ++S                                     DPNF  
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 59  ----------DEVQIPGTPEE---KNTNI----FTSEQTILQNRDRKXXXXXXXXFSGER 101
                       +Q+PG+PE+   K+T +     T + T +Q+                 
Sbjct: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQD----------------- 103

Query: 102 LPNPNELKVREREENLEKLPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMF---Q 158
             NPNELK++ + E    +P+ +T+YFM  F   KK E  +    E ++ ARVH F    
Sbjct: 104 --NPNELKLKNQIEPAS-VPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYT 160

Query: 159 GLNKSSKIHKIEYQPEAANEVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRP 218
            L K S+I  +E       E E+YS L I +RY+ ++ ++ + Q+IKILRLNKLFAK+RP
Sbjct: 161 NLQKESQIINVE-------EKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRP 213

Query: 219 PKFEEPQYSNWVTLGIITQKGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYY 278
           PKFE PQYSNWV +G+IT+K   K TSS+ P+KYFKFTI DF+ N+ IF+F++ A+ +YY
Sbjct: 214 PKFESPQYSNWVAVGVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYY 273

Query: 279 NLRIGDIIAILNPEVLPWRPSNNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNK 338
           NLR+GDII ILNP + PWRPS  +NG  IKSFNL I   Y CIIE+GKS+DLG+C +P K
Sbjct: 274 NLRVGDIICILNPVIAPWRPS-EENGY-IKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVK 331

Query: 339 INESGTCHTPIDISKEDRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNN 398
                 C TPI+ +K+  C +H+E  FRN  +KRIELNGSFALGAP K    P LY+   
Sbjct: 332 SKGGKPCGTPINKTKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKK- 390

Query: 399 VPVRGVYHGNRFNVVKGSEIRK-NESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNL 457
                +Y  N+FNVV+    RK  +SKL        F S N AKAFF+++FQNPD+++NL
Sbjct: 391 --TNNIYSKNQFNVVRRRNARKEGDSKLHNSN----FRSTNIAKAFFNDEFQNPDIISNL 444

Query: 458 DTKRRKIADDKRSNYLDQELSKAI--ENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQ 515
           D+KRRK+ D KR + L +EL+K +  E+  S  L G K+K++  +M++ TE  +Q G+++
Sbjct: 445 DSKRRKLKDAKRDSELIKELNKTLTKEDNVSKNLEG-KSKEDVKEMRNITENIMQIGMLK 503

Query: 516 RLGFDPTHGKIAKVLQTGKDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKN 575
            +G+DPTHGK+  +++  K +GKD  + +++   V DLL FKK KV L P K +L+ +K 
Sbjct: 504 NIGYDPTHGKMKYLMK--KSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKR 561

Query: 576 RREEVWQKHFGSGKRLAEQPLNDDVDTS---ESDLEIV 610
           +R+E+W ++FG      +   N D+  S   +SDLEIV
Sbjct: 562 KRDEIWNEYFGD-----QSKSNRDIILSSGDDSDLEIV 594

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  434 bits (1115), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 230/507 (45%), Positives = 331/507 (65%), Gaps = 34/507 (6%)

Query: 104 NPNELKVREREENLEKLPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKS 163
           NPNE  +  +E ++      TTSYF  KF++ K  E       ++M+ AR H F G    
Sbjct: 111 NPNEEDIVRKELDV----VATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSL 166

Query: 164 SKIHKIEYQPEAANEVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEE 223
           S    I+      +E+E YS   I+KRYIPK E++ +   IKILRLNKLFAKVRPP F E
Sbjct: 167 SDNKTIQ-----CDELEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSE 221

Query: 224 PQYSNWVTLGIITQKGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIG 283
           PQYSNWV +G I+ K  +K T++ KP KYFKFT++DF++N+D+++F K  VERYYNLR+G
Sbjct: 222 PQYSNWVAIGAISSKEDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVG 281

Query: 284 DIIAILNPEVLPWRPSNNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESG 343
           DIIA+LNPE+LPWRPS   N  GIKSFNLRI H+++CI+E+G S+DLG+C + N   +S 
Sbjct: 282 DIIAVLNPEILPWRPSGCVN--GIKSFNLRIGHDFNCILEIGASRDLGWCQMVNH-GQSK 338

Query: 344 TCHTPIDISKEDRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRG 403
            C++PI+   +  C +H+E++ R+  SKRIEL+GS+ALGAP KVG QP +Y++NN     
Sbjct: 339 ICNSPINTKTDRCCEFHRELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNT 398

Query: 404 VYHGNRFNVVKGSEIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRK 463
               ++   + G   +K + K   E    +FS+  +AKAFFD+ FQ+P +L NL++KRRK
Sbjct: 399 NPAKHKMFSITGHGSKKEQEKEKHEIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRK 458

Query: 464 IADDKRSNYLDQELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTH 523
           I    +++ +D+ L KA+  + +++ S NK      ++K  TE TLQTGVIQRLGFDP+ 
Sbjct: 459 I----KASKMDRNLLKALNGEDASQ-SKNK-----QQVKEITEKTLQTGVIQRLGFDPSG 508

Query: 524 GKIAKVLQTGKDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQK 583
           G+IAKVL   + +  D+   + K+  + DL+ FKK K+ L P++E  +++++RRE +W+K
Sbjct: 509 GQIAKVLDKSRGTKTDDPTISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKK 568

Query: 584 HFGSGKRLAEQPLNDDVDTSESDLEIV 610
           HF             D + S+SDLEIV
Sbjct: 569 HF------------QDTNDSDSDLEIV 583

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  416 bits (1070), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 223/480 (46%), Positives = 310/480 (64%), Gaps = 28/480 (5%)

Query: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLN--KSSKIHKIEYQPEAANE 178
           PSNTTSYF+E F + +K EE +      +L  RVH F+G++  K S       QP   +E
Sbjct: 108 PSNTTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGS-------QPVNVDE 160

Query: 179 VEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQK 238
            E YS   I +RY+   EL++I + IK+LRL KLF+KVRPPKF EP Y+NWV +GII+ K
Sbjct: 161 KELYSGFNISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFK 220

Query: 239 GSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRP 298
             +K TSS KP KYFK T++DF +N+DI+IF+   VE+YYNLR+GDIIAILNP++LPWRP
Sbjct: 221 SEVKLTSSSKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRP 280

Query: 299 SNNKN----GTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKE 354
           S   N    G  +KSFNL I HN+ C++E+G SKDLGFC IPNK      C  PI+ +  
Sbjct: 281 SQVNNDEFSGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKA-CGAPINRAAT 339

Query: 355 DRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVK 414
           DRC YHQ++RFR+  ++R+ELNGS +L +PVK G +  LY  + V  +     ++     
Sbjct: 340 DRCEYHQDVRFRHVNAQRVELNGSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDK----- 394

Query: 415 GSEIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLD 474
                  +++  E +   +FS+ N AKAFFD+ +QNPDML NL+ KRRK+ D ++   L 
Sbjct: 395 ----HAPQAQDGESQNTLFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQ 450

Query: 475 QELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGK 534
            +L+ AI  K+  +   NK+K+E  +MK ATE  L +G+++ +GFDP  GK+ +VL+ GK
Sbjct: 451 NQLNSAI-GKTGYQSFNNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGK 509

Query: 535 DSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQ 594
           +    N     K  +VK+++ FKK  V LAP+K E  KR  RRE+VW++HF + K LA Q
Sbjct: 510 NV---NSGLNSKSSQVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTEK-LANQ 565

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  409 bits (1051), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 223/488 (45%), Positives = 315/488 (64%), Gaps = 28/488 (5%)

Query: 129 MEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVEEYSMLRIQ 188
           ME F + +K EE       +ML +RVH F+GL K++K  K    P A  E E  S L + 
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGL-KATKSRK----PIAVEEKEPASGLWVS 55

Query: 189 KRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGSIKFTSSDK 248
           +RYI   EL +I ++IKILRL KLF+KVRPPKF EP Y+NWV +GI+  K  +K TSS K
Sbjct: 56  RRYIASDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSK 115

Query: 249 PKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSNNKN----G 304
           P KYFK TI+DF +++D+++F+   VE+YYNLR+GDIIAILN ++LPWRPS   N    G
Sbjct: 116 PTKYFKMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSG 175

Query: 305 TGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYHQEIR 364
             +KSFNL I  NY C++E+G S+DLGFC I NK  +   C  PI+ +  DRC YHQEIR
Sbjct: 176 ASVKSFNLSIRGNYDCVLEIGTSRDLGFCQIYNKA-KGKVCGAPINRAAVDRCDYHQEIR 234

Query: 365 FRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIRKNESK 424
           FR   ++R+ELNGS +L +PVK G +  LY ++ V         + N++      + + +
Sbjct: 235 FRQVNAQRVELNGSMSLRSPVKNGKKQALYGSSGVK-------RKLNLLPDKHAPQQQDR 287

Query: 425 LMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSKAIENK 484
             E +   YFS+ N AKAFFD+ +QNPD+L NLD+KRRK+ D +    L  +LS+A+   
Sbjct: 288 --ESQNTLYFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKD 345

Query: 485 SSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSGKDNVHNT 544
              R S  KTK+E  +MK ATE T+ +G+++ +GFDPT GK+  VL+ GK+S   N  +T
Sbjct: 346 GQQRFS-EKTKQEQKQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGKNS--KNSTDT 402

Query: 545 HKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPLNDDV--DT 602
             ++ V++++E +K  V LAP+K +  KR  RRE+VW++HF +     +   N+ +  D+
Sbjct: 403 KSIQ-VREIIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETK---TDPTANNQIPSDS 458

Query: 603 SESDLEIV 610
           S+SDLEIV
Sbjct: 459 SDSDLEIV 466

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  402 bits (1034), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/562 (41%), Positives = 342/562 (60%), Gaps = 46/562 (8%)

Query: 55  DPNFDEVQIPGTPEEKNTNIFTSEQTILQNRDRKXXXXXXXXFSGERLPNPNELKVRERE 114
           DPNF  V++P +P +       S+   ++   R          + E L   NEL+V+++ 
Sbjct: 53  DPNFSGVEVPRSPSK-------SKHVAVKETSRSKDDRESCFPAHENL---NELQVQKKA 102

Query: 115 ENLEKLPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPE 174
                L S +T YF + F   KK +E+E+ R  +ML  RVH F G +        EY P 
Sbjct: 103 S----LSSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDGPD-----FVREYSPI 153

Query: 175 AANEVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGI 234
           A NE EE+S   I KRYI  ++   I +  K+LRL KLFAKVRPP F EPQYSNWVT+GI
Sbjct: 154 AVNEEEEFSGKWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGI 213

Query: 235 ITQKGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVL 294
           I+ K S+K T+  KP +YF  T++DFK+ ++I++F    VE+YYNL++GDIIA+LNPE+ 
Sbjct: 214 ISAKSSVKMTTGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIW 273

Query: 295 PWRPS----NNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPID 350
           PWRPS       +   IKSFNL I HN++ I+E+G S+D GFC I NK+ +  TC TPI+
Sbjct: 274 PWRPSKVEHEQSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKL-QGKTCGTPIN 332

Query: 351 ISKEDRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRF 410
            S EDRC YHQE++FR   +KR+ELNG+ +L +P K G +  LY  N           ++
Sbjct: 333 KSVEDRCYYHQEVQFRQVNAKRLELNGNKSLRSPTKNGVKHILYGKNK--------SGKY 384

Query: 411 NVVKGSEIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRS 470
           +++      + +SK  + +   YFS+ N+A+AFFD+ +QNPD L NLD+KRRK+   K+ 
Sbjct: 385 DLLPDRYAPQTQSK--DSQNVLYFSNPNAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKE 442

Query: 471 NYLDQELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVL 530
             L ++L + I  KS++ L  N+T  +  +++ AT+  L++G+I+++GFDPT G+++ VL
Sbjct: 443 KLLQKQLQQVI-GKSNSNLFKNETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMSSVL 501

Query: 531 QTGKDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKR 590
           +      K+   N+     V+++L+ KK K+ L P+KE L ++  +REEVW  HF    +
Sbjct: 502 KNNSKGLKEQAKNS----AVEEILQIKKEKIELKPSKEALRQKFKKREEVWNHHF----K 553

Query: 591 LAEQPLNDDVDTSESD--LEIV 610
             E P N  V++S+ D  LEIV
Sbjct: 554 KEENP-NPGVESSDGDSELEIV 574

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  364 bits (935), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/496 (40%), Positives = 292/496 (58%), Gaps = 28/496 (5%)

Query: 124 TTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVEEYS 183
           TTSYF EKF   +        R +++LK RV+ F     S +   IEY   A +EVE YS
Sbjct: 134 TTSYFAEKFARARDSSASTMRRKQELLKRRVYTF-----SDRDTAIEYTTFAVDEVETYS 188

Query: 184 MLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGSIKF 243
            +RI KRY+P+++L  I  +IK+LRL KLFAKVRPPKF EP Y+NWVTLG I+ K  +K 
Sbjct: 189 NMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDVKS 248

Query: 244 TSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSNNKN 303
           TS +KP KYF   I+DF Y+V I +F +  VE+YY LR+GD+IAILNPE+ PW+ S    
Sbjct: 249 TSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAKTT 308

Query: 304 G----TGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSY 359
           G    T  +SF L I HN +CI+E+G SK+LGFCP  NK  +   C  PI+  KE  CSY
Sbjct: 309 GETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNK-TKGAPCGAPINKLKEQVCSY 367

Query: 360 HQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIR 419
           HQE   R+  +KR+ELNG+ +L AP + G Q   Y   N       HG +  ++   ++ 
Sbjct: 368 HQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNS------HGTKIGLL--PDVY 419

Query: 420 KNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQELSK 479
              +   E++ R +F+S N+ +A+FD  + NPD+L NL++KRRKI   K+   ++++LS 
Sbjct: 420 APRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSL 479

Query: 480 AIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDSGKD 539
            +  K+  ++    +++   + + AT+  ++TG+++ +GFDPT G++A VL  G     D
Sbjct: 480 VL-GKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPAD 538

Query: 540 NVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHF-----GSGKRLAEQ 594
            V    +   + ++L  KK  + L P+KE   KR  +R EV+   F      + +   E 
Sbjct: 539 TV----REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCET 594

Query: 595 PLNDDVDTSESDLEIV 610
                 D+S+ +LEIV
Sbjct: 595 AQLSSADSSDEELEIV 610

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  291 bits (744), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 200/615 (32%), Positives = 312/615 (50%), Gaps = 47/615 (7%)

Query: 1   MNDPRECSPEDPFADLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNFDE 60
           + DPRE +  DP+ +LS                                     DPNFD 
Sbjct: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKXXXXXXXXFSGERLPNPNELKVREREENLEKL 120
           + +P +P++       S+       D K           E   N NE  VRE+ + L   
Sbjct: 65  IDVPESPKK-------SDNATKGIEDIKHIAPVADI--EEATFNVNEDYVREKVKKL--- 112

Query: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180
              TTSYF EK + +   E     R +++L  RV+ F G          EY+P   +E +
Sbjct: 113 --GTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNGDMFD------EYEPITVDEKD 164

Query: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240
           + S L I +RY+P   L    +NIK+LRL KLF+KVR PKF EP Y NW+ LGII++K  
Sbjct: 165 DLSGLVIDRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTE 224

Query: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300
            + T+S KP K+F  TISDF++ +++  F K  VE+YY LR+GD+IAILNPE++P +   
Sbjct: 225 PRMTNSVKPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLE 284

Query: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSYH 360
                   +F+L+++ + + I+E+G SK+ G C    K N+   C  PI+   ++ C+YH
Sbjct: 285 AGASPSYATFSLKVSKDTNNILELGHSKEFGLCQFYMK-NKGKLCGAPINKLHDNYCAYH 343

Query: 361 QEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYR----NNNVPVRGVYHGNRFNVVKGS 416
           +E + R N S+R+E++ S A+ APV  G Q  + +    N    +R   + ++  V + +
Sbjct: 344 KEAKMRQNSSRRVEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPA 403

Query: 417 EIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQE 476
               N         R  FSS N++ AFFD+ ++NPD+L NLD KRRKI  + R+N   + 
Sbjct: 404 AAETN---------RFLFSSANASTAFFDDDYENPDILANLDNKRRKIQ-ELRNN---RN 450

Query: 477 LSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDS 536
           L K ++  S   LS  + +      K+AT +  Q G+  ++G+DPT GK +  L+  + S
Sbjct: 451 LEKKLKGLSDKLLSKKEDRVNQEAKKTATLSMFQHGLANQIGYDPTKGKAS--LEMLEYS 508

Query: 537 GKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHF-GSGKRLAEQP 595
            ++      K   + D+   KK  V L P+K++L ++  +R  ++ +   GS +RL    
Sbjct: 509 TENKAPKNDKQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERL---- 564

Query: 596 LNDDVDTSESDLEIV 610
             D  + S  DLEI+
Sbjct: 565 --DKDEGSSDDLEII 577

>Ecym_3498 Chr3 (931185..931187,931658..932062) [408 bp, 135 aa]
           {ON} similar to Ashbya gossypii ACL043W
          Length = 135

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 8/73 (10%)

Query: 533 GKDSGKDNVHNT----HKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSG 588
           GK +G   V+N+     K E    L+ +   + V  P++++  +RKNR     +K FG+G
Sbjct: 67  GKSTGFGLVYNSVADAKKFEPAYRLVRYGMAEKVEKPSRQQRKQRKNR----GKKIFGTG 122

Query: 589 KRLAEQPLNDDVD 601
           KRLA++    + D
Sbjct: 123 KRLAKKTARRNAD 135

>NDAI0A06140 Chr1 complement(1394748..1396802) [2055 bp, 684 aa]
           {ON} Anc_3.58 YNL299W
          Length = 684

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 17/88 (19%)

Query: 127 YFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVEEYSMLR 186
           Y  +  +H+K+K     V  E + KARV + + + KSS+IH I+   E  N VE   ++R
Sbjct: 279 YLYDLARHLKQKGLTSQV--EVIAKARVPIIKFVEKSSQIH-IDVSFERTNGVEAAKLIR 335

Query: 187 --------------IQKRYIPKKELNDI 200
                         I K+++  + LND+
Sbjct: 336 EWLSATPGLRELILIVKQFLSARRLNDV 363

>TDEL0C01790 Chr3 complement(311853..313538) [1686 bp, 561 aa] {ON}
           Anc_7.368 YER087W
          Length = 561

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 4/79 (5%)

Query: 330 LGFCPIPNKINESGTCHTPIDISKEDRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGA 389
           +  C  P   + S      +D+S ED   Y     F +       +N S A+G P+ V A
Sbjct: 446 VSVCVAPGNESLSHQIKEQLDMSFEDDVMY----SFNDKMGLGARINYSHAIGIPICVIA 501

Query: 390 QPQLYRNNNVPVRGVYHGN 408
            P+ + N  + +RG  +GN
Sbjct: 502 GPKNWPNVELEIRGNNYGN 520

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,410,211
Number of extensions: 3277220
Number of successful extensions: 10000
Number of sequences better than 10.0: 137
Number of HSP's gapped: 10446
Number of HSP's successfully gapped: 140
Length of query: 610
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 494
Effective length of database: 40,180,143
Effective search space: 19848990642
Effective search space used: 19848990642
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)