Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F002705.707ON29829814750.0
NCAS0G002105.707ON2882581933e-16
SAKL0E15026g5.707ON2901711172e-06
KNAG0L021605.707ON2091151073e-05
KAFR0D022005.707ON1821541011e-04
Skud_9.165.707ON2261101022e-04
YIL152W5.707ON2351131012e-04
Suva_9.365.707ON224110978e-04
TPHA0E001805.707ON165107940.001
TDEL0B021305.707ON208113950.001
Smik_9.175.707ON251110920.004
Kwal_55.196755.707ON232210770.22
Kpol_1043.745.707ON177111750.35
KLTH0E00946g5.707ON215137711.4
ZYRO0B16434g5.707ON23734692.8
TDEL0C047203.330ON1122103685.7
KAFR0C025808.187ON31542667.0
Smik_16.2923.330ON118169669.4
NOTE: 3 genes in the same pillar as NDAI0F00270 were not hit in these BLAST results
LIST: TBLA0I01690 KLLA0A00506g Cgla_YGOB_Anc_5.707

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F00270
         (298 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...   572   0.0  
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    79   3e-16
SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa] ...    50   2e-06
KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {O...    46   3e-05
KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.70...    44   1e-04
Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)     44   2e-04
YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...    44   2e-04
Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)     42   8e-04
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    41   0.001
TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.70...    41   0.001
Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)     40   0.004
Kwal_55.19675 s55 (74607..75305) [699 bp, 232 aa] {ON} [contig 1...    34   0.22 
Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {...    33   0.35 
KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved...    32   1.4  
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    31   2.8  
TDEL0C04720 Chr3 complement(855282..858650) [3369 bp, 1122 aa] {...    31   5.7  
KAFR0C02580 Chr3 (502274..503221) [948 bp, 315 aa] {ON} Anc_8.18...    30   7.0  
Smik_16.292 Chr16 complement(537812..541357) [3546 bp, 1181 aa] ...    30   9.4  

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/298 (94%), Positives = 282/298 (94%)

Query: 1   MVERRGFVIYPDYNNNQSRISNHSENTLLINEKKEXXXXXXXXXXXXXXXXDVENAKERY 60
           MVERRGFVIYPDYNNNQSRISNHSENTLLINEKKE                DVENAKERY
Sbjct: 1   MVERRGFVIYPDYNNNQSRISNHSENTLLINEKKETSSQLLSSSQRSITSIDVENAKERY 60

Query: 61  HKTNNINSLFTLAHKSIKKVAKEPRNNLPISSFTSGKFKSITLKDTKRAGPLQSIQNIIY 120
           HKTNNINSLFTLAHKSIKKVAKEPRNNLPISSFTSGKFKSITLKDTKRAGPLQSIQNIIY
Sbjct: 61  HKTNNINSLFTLAHKSIKKVAKEPRNNLPISSFTSGKFKSITLKDTKRAGPLQSIQNIIY 120

Query: 121 NCKGYPHSVFMAKQLERKEPTTIRDGIAILDSKNGIGSKIIKAKFRKSHFKLGSVTRKYE 180
           NCKGYPHSVFMAKQLERKEPTTIRDGIAILDSKNGIGSKIIKAKFRKSHFKLGSVTRKYE
Sbjct: 121 NCKGYPHSVFMAKQLERKEPTTIRDGIAILDSKNGIGSKIIKAKFRKSHFKLGSVTRKYE 180

Query: 181 LFPLQDLEQNKPSALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEMLSDHEIKINSV 240
           LFPLQDLEQNKPSALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEMLSDHEIKINSV
Sbjct: 181 LFPLQDLEQNKPSALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEMLSDHEIKINSV 240

Query: 241 KNYTAGFTTDVTMLLHSKISLNVPLPNNLHKDYKLALDSKVYLELAPNVKWYLVWKFI 298
           KNYTAGFTTDVTMLLHSKISLNVPLPNNLHKDYKLALDSKVYLELAPNVKWYLVWKFI
Sbjct: 241 KNYTAGFTTDVTMLLHSKISLNVPLPNNLHKDYKLALDSKVYLELAPNVKWYLVWKFI 298

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 123/258 (47%), Gaps = 47/258 (18%)

Query: 53  VENAKERYHKTNNINSLFTLAHKSIKKVAKEPRNNLPISSFTSGKFKSITLKDTKRAGPL 112
           V+  K    KTNN ++L + +  +  K +K       IS     +F SI+ K  + A PL
Sbjct: 63  VKERKVLTEKTNNFSTLLSQSRHTSHKSSKMNE----ISILKPVQFTSISKKQVEIAKPL 118

Query: 113 QSIQNIIYNCKGYPHSVFMAKQLERKEPTTIRDGIAILDSKNGIGSKIIKAKFRKSHFKL 172
           +SI NI+ N      ++  +  L  + P + R  +            + K   R S   +
Sbjct: 119 KSINNIMDNV-----TIRQSDTLNVEPPRSKRPYL---------NYPLPKKLSRTSTSDV 164

Query: 173 GSVTRKYELFPLQDLEQNKPSALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEMLSD 232
            S          +D   N+P   + SLQK LCDLDT +KT    SYD++ T+ S   LSD
Sbjct: 165 SS----------RDNSNNEPKIFVTSLQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSD 214

Query: 233 HEIKINSVKNYTAGFTTDVTMLLHSKISL-NVPLPNNLH-----------KDYKLALDSK 280
            E+++      T   +  + ++LH+K S+ N+P+   +H           +  KLA++SK
Sbjct: 215 FELQV------TTQMSPQL-IILHNKTSINNIPILKFIHDVSINTKIQVTESLKLAINSK 267

Query: 281 VYLELAPNVKWYLVWKFI 298
            +++++ ++ WY+ WKFI
Sbjct: 268 SFIKVSDDINWYIDWKFI 285

>SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa]
           {ON} conserved hypothetical protein
          Length = 290

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 78/171 (45%), Gaps = 17/171 (9%)

Query: 131 MAKQLERKEPTTIRDGIAILDSK-NGIGSKIIKAKFRKSHFKLGSVTRKYELFPLQDLEQ 189
           + +Q++   P T     AIL S   G  S     +   + F   S  ++Y L P      
Sbjct: 128 LPQQMKPSSPATFD---AILQSSIAGGNSTSTDGRTGGTKFTGSSNVQRY-LHPEFSASL 183

Query: 190 NKPSALLQSLQKSLCDLDTSLKTLSYHS---YDTLLTVTSFEMLSDHEIKINSVKNYTAG 246
           +K S L + LQKSLCD +T  K  S+ S   YD +LTV   + LS  E+ + S +   A 
Sbjct: 184 SKDSMLFR-LQKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVISSECAHA- 241

Query: 247 FTTDVTMLLHSKISLNVPLPNNLHKDYKLALDSKVYLELAPNVKWYLVWKF 297
                 ++LH   +   P     H+  KL LDS+  +EL P + WY  W F
Sbjct: 242 ------IVLHRFKNKAFPR-TEKHRVLKLHLDSRSEIELYPGLYWYSNWYF 285

>KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {ON}
           Anc_5.707 YIL152W
          Length = 209

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 55/115 (47%), Gaps = 14/115 (12%)

Query: 188 EQNKPSALLQSLQKSLCDLDTSLKTLSY-HSYDTLLTVTSFEMLSDHEIKI---NSVKNY 243
           +Q  P+ L+Q LQ+SL  L+  + T  +   YD L+ VT    LS HE+ +   +S K Y
Sbjct: 101 QQGTPT-LVQQLQRSLGRLNQLVLTTGHSRHYDALVGVTGCLKLSSHELMLETGHSSKRY 159

Query: 244 TAGFTTDVTMLLHSKISLNVPLPNNLHKDYKLALDSKVYLELAPNVKWYLVWKFI 298
                  V   L  +I+            Y +AL SK+ + + P++ W L WK +
Sbjct: 160 VLHSNGPVHGFLLDQIASG---------GYTVALYSKLAVRVTPDLYWCLQWKLV 205

>KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.707
           YIL152W
          Length = 182

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 72/154 (46%), Gaps = 16/154 (10%)

Query: 151 DSKNGIGSKIIKAKFRKSHFKLGSVTRKYELFPLQDL--EQNKPSALLQSLQKSLCDLDT 208
           +SK   G   +      S  K  +  R +   P  +L  E NKP +L  SLQKSL DL+ 
Sbjct: 38  NSKETQGRTQVITILNNSEVKKMTFARHWNERPHLNLLDECNKPVSLAISLQKSLWDLN- 96

Query: 209 SLKTLSYHS--YDTLLTVTSFEMLSDHEIKINSVKNYTAGFTTDVTM--LLHSKISLNVP 264
           +L T+S ++  YD L+ V S   LS  E+ I          +TD  M  +LH  ++    
Sbjct: 97  ALVTVSKNNKKYDLLIKVASARRLSSTEMLIIP--------STDEAMRYILHKPLTFRTN 148

Query: 265 LPNNLHKDYKLALDSKVYLELAPNVKWYLVWKFI 298
             +N    + LAL+SK+   L   + W L WK +
Sbjct: 149 SVDNFTGAH-LALNSKISFRLDDTLIWCLNWKLL 181

>Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)
          Length = 226

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 59/110 (53%), Gaps = 13/110 (11%)

Query: 193 SALLQSLQKSLCDLDTSLKTLSYHSYDTLL-TVTSFEMLSDHEIKINSVKNYTAGFTTDV 251
           S L+  L  S+ DLDT ++T     +DT++  ++   +LS +E+ I            + 
Sbjct: 126 SKLVSQLHTSVKDLDTIVQTHKPR-FDTIIHDLSHTAILSSNELLIK--------LPMND 176

Query: 252 TMLLHSKIS-LNVPLPNNLHKD--YKLALDSKVYLELAPNVKWYLVWKFI 298
           T++LHS+I  +N    +N   D    L +DS+ +L L  N+KWYL WKFI
Sbjct: 177 TIILHSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 57/113 (50%), Gaps = 13/113 (11%)

Query: 190 NKPSALLQSLQKSLCDLDTSLKTLSYHSYDTLLT-VTSFEMLSDHEIKINSVKNYTAGFT 248
           N  S L+  L  S+ DLD  ++T     +DT++   +   +LS +E+ I   K       
Sbjct: 132 NTDSKLVSQLHSSVKDLDAIIQTHKP-KFDTIIRDFSQATILSSNELLIKLPK------- 183

Query: 249 TDVTMLLHSKIS-LNVPLPNNLHKD--YKLALDSKVYLELAPNVKWYLVWKFI 298
            D T++LHS+   +N     N   D    L +DS+ +L L  N+KWYL WKFI
Sbjct: 184 -DQTIILHSRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 58/110 (52%), Gaps = 13/110 (11%)

Query: 193 SALLQSLQKSLCDLDTSLKTLSYHSYDTLL-TVTSFEMLSDHEIKINSVKNYTAGFTTDV 251
           S L+  L  S+ DLDT ++T     +DT++  ++   +LS +E+ I           T+ 
Sbjct: 124 SRLVSQLHSSVKDLDTIVQTHKP-RFDTIIHDLSHTTILSPNELLIK--------LHTED 174

Query: 252 TMLLHSKISL-NVPLPNN--LHKDYKLALDSKVYLELAPNVKWYLVWKFI 298
           T++LHS+  + N     N   +    L +DS+ +L L  N+KWYL WKFI
Sbjct: 175 TIILHSRTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 11/107 (10%)

Query: 192 PSALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEMLSDHEIKINSVKNYTAGFTTDV 251
            SA +  L+ S+   +  LK  S + YD +  + S E LS +E  + ++           
Sbjct: 55  SSASVSDLRLSINKFNMLLKA-SSNKYDEIHDINSIEKLSQNEFIVTTI--------DSK 105

Query: 252 TMLLHSKISLNVPLPNNLHKDYK-LALDSKVYLELAPNVKWYLVWKF 297
           T++LHS    NV   NN    Y+ +A++SK YL L  ++ WYL WKF
Sbjct: 106 TLILHSN-EKNVVNSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151

>TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.707
           YIL152W
          Length = 208

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 53/113 (46%), Gaps = 11/113 (9%)

Query: 185 QDLEQNKPSALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEMLSDHEIKINSVKNYT 244
           Q LE ++  +L  ++  +L  L+T ++ LS    D L+      +LS HE+ +       
Sbjct: 106 QGLETSRDKSLSTAVSVALSHLNTRIQVLS-GELDQLMAFERLVLLSQHELLV------- 157

Query: 245 AGFTTDVTMLLHSKISLNVPLPNNLHKDYKLALDSKVYLELAPNVKWYLVWKF 297
              T     +LHS I L     +      KLA++S+ Y  L  +V W++ WKF
Sbjct: 158 --VTQRKIFVLHSVIPLTREGVSRFGA-LKLAVNSQCYYVLYNDVVWFMRWKF 207

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 13/110 (11%)

Query: 193 SALLQSLQKSLCDLDTSLKTLSYHSYDTLL-TVTSFEMLSDHEIKINSVKNYTAGFTTDV 251
           S L+  L  S+ DLD  ++T     +DT++  ++   +LS +E+ I            + 
Sbjct: 151 SKLVSQLHSSVKDLDAIIQTHKP-KFDTIIHDLSRTTILSSNELLIK--------LPMEE 201

Query: 252 TMLLHSKI-SLNVPLPNN--LHKDYKLALDSKVYLELAPNVKWYLVWKFI 298
           T++LHS+  ++N    +N   +    L +DS+ +L L  N+KWYL WKFI
Sbjct: 202 TIILHSRTPTINEEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251

>Kwal_55.19675 s55 (74607..75305) [699 bp, 232 aa] {ON} [contig 159]
           FULL
          Length = 232

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 90/210 (42%), Gaps = 19/210 (9%)

Query: 98  FKSITLKDTKRAGPLQ----SIQNIIYNCKGYPHSVFMAKQLERKEPTTIRDGIAILDSK 153
           FK+IT   ++   PLQ    +I  ++ + K    +      +    PT++   I+    K
Sbjct: 15  FKNITALSSRERKPLQPKSVNISQLVASQKQ--DNAHKTVSVRAATPTSLSTLISKSRPK 72

Query: 154 NGIGS-KIIKAKFRKSHFKLGSVTRKYELFPLQDLEQNKPSALLQSLQKSLCDLDTSLK- 211
           +G    +   A+   S   L     +Y + P +  EQ    AL++ L K +  L+TS + 
Sbjct: 73  SGHSPMRFSVARVIGSRHHLAHAPAQYGIRPKKRYEQEASGALIRHLFKCVNSLETSWRL 132

Query: 212 ---TLSYHSYDTLLTVTSFEMLSDHEIKINSVKNYTAGFTTDVTMLLHSKISLNVPLPNN 268
               ++ H YD  L V  F+ LS  E          A  +T   +L+  + SL   +  +
Sbjct: 133 QRHGVATHQYDRRLRVQYFKSLSPTE------DLAVASSSTGQEILILHRTSLRDSI--S 184

Query: 269 LHKDYKLALDSKVYLELAPNVKWYLVWKFI 298
           L    +L LDS   L L P ++WY  W+ +
Sbjct: 185 LRAGSELMLDSSSSLLLYPGLRWYFQWQAV 214

>Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {ON}
           complement(158958..159491) [534 nt, 178 aa]
          Length = 177

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 3/111 (2%)

Query: 186 DLEQNKPSALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEMLSDHEIKINSVKNYTA 245
            L  +K S  L SL  SL   +T +++ S   +D +  +  F++LS  +I    V +   
Sbjct: 68  QLSVSKYSPSLLSLHNSLYVFNTIVRSGSLLKFDHVWHILHFQLLSQFQIYCLVVDHNEM 127

Query: 246 GFTTDVTMLLHSKISLNVPLPNNLHKDYKLALDSKVYLELAPNVKWYLVWK 296
                +    ++  + N+ LP       K+A++S  ++ L  NV WYL W+
Sbjct: 128 TKNIILYKNNNNNNNANITLPTTF---AKIAINSNSFVHLYGNVNWYLHWR 175

>KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved
           hypothetical protein
          Length = 215

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 56/137 (40%), Gaps = 21/137 (15%)

Query: 167 KSHFKLGSVTRKYEL-FPLQDLEQNKPSALLQSLQKSLCDLDTSLK----TLSYHSYDTL 221
           K H++     ++Y+L FP          AL+  L K +   +T+ +     LS H YD  
Sbjct: 95  KPHYR-ARAKKRYDLAFPAGK-------ALVNRLLKCVSAFETNRRLQRHGLSTHEYDRK 146

Query: 222 LTVTSFEMLSDHEIKINSVKNYTAGFTTDVTMLLHSKISLNVPLPNNLHKDYKLALDSKV 281
           L V   ++LS  E+         AG      ++LH   S     P +     +L L S  
Sbjct: 147 LHVQYTKLLSPTELLA-----VAAGPLGREVLILHMLPSTKDAEPKS---GSQLLLSSNA 198

Query: 282 YLELAPNVKWYLVWKFI 298
              L P ++WY  W+ I
Sbjct: 199 SALLYPGLRWYFEWRVI 215

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 265 LPNNLHKDYKLALDSKVYLELAPNVKWYLVWKFI 298
           +P  ++   +LA+ SK  L L  ++ WYL WKF+
Sbjct: 204 IPKFVNSPSRLAICSKCCLTLYNDMNWYLKWKFL 237

>TDEL0C04720 Chr3 complement(855282..858650) [3369 bp, 1122 aa] {ON}
           Anc_3.330 YPR049C
          Length = 1122

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 47/103 (45%), Gaps = 7/103 (6%)

Query: 160 IIKAKFRKSHFKLGSVTRKYELFPL------QDLEQNKPSALLQSLQKSLCDLDTSLKTL 213
           IIK   R++H         Y+   +      +D  Q + SALL+ +   L D D  +++L
Sbjct: 83  IIKEPLRRAHDSEALQDESYKKAEVLLSNLVRDTLQKRESALLKPINSPLADADLRIESL 142

Query: 214 SYHSYDTLLTVTSFEMLSDHEIKINSVKNYTAGFTTDVTMLLH 256
           +  S  +LLT T+   LS  EI ++  +N  +      + +L 
Sbjct: 143 NARSITSLLT-TNLGWLSALEIDVHYFRNLMSECAAQTSEILR 184

>KAFR0C02580 Chr3 (502274..503221) [948 bp, 315 aa] {ON} Anc_8.187
           YDR068W
          Length = 315

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 4/42 (9%)

Query: 64  NNINSLFTLAHKSIKKVAKEPRN----NLPISSFTSGKFKSI 101
           N +NS++  A K IKK+ +E  N    NLP+   TS K + I
Sbjct: 35  NELNSVYEKATKEIKKIVQEDDNGLQLNLPLDPNTSAKAQKI 76

>Smik_16.292 Chr16 complement(537812..541357) [3546 bp, 1181 aa]
           {ON} YPR049C (REAL)
          Length = 1181

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 189 QNKPSALLQSLQKSLCDLDTSLKTLSYHSYDTLLTVTSFEMLSDHEIKINSVKNYTAGFT 248
           Q   + +++ +   L D D +L  L+YH+  +LLT T+   LS  EI ++  K+     T
Sbjct: 144 QGGDTIMIKPIPSPLEDADVALSRLNYHTVSSLLT-TNLGWLSALEIDVHYFKSLIPDIT 202

Query: 249 TDVTMLLHS 257
             V  +  S
Sbjct: 203 AQVIRIFDS 211

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,664,928
Number of extensions: 1314505
Number of successful extensions: 4571
Number of sequences better than 10.0: 49
Number of HSP's gapped: 4711
Number of HSP's successfully gapped: 49
Length of query: 298
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 189
Effective length of database: 40,982,805
Effective search space: 7745750145
Effective search space used: 7745750145
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)