Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F00260singletonON5322637573e-93
Smik_15.183na 1ON46958723.3
NDAI0E036507.161ON39322704.9
Skud_15.171na 1ON43557705.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F00260
         (532 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00260 Chr6 (53230..54828) [1599 bp, 532 aa] {ON}                296   3e-93
Smik_15.183 Chr15 (311669..313078) [1410 bp, 469 aa] {ON} YOR009...    32   3.3  
NDAI0E03650 Chr5 (788320..789501) [1182 bp, 393 aa] {ON}               32   4.9  
Skud_15.171 Chr15 (305234..306541) [1308 bp, 435 aa] {ON} YOR009...    32   5.3  

>NDAI0F00260 Chr6 (53230..54828) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  296 bits (757), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 166/263 (63%), Positives = 166/263 (63%)

Query: 256 LAASSVVPTHVNSTAPSAGSSILLTTTTHIPNPVHNTTTSKAAVSTKPVTVTDVFYNXXX 315
           LAASSVVPTHVNSTAPSAGSSILLTTTTHIPNPVHNTTTSKAAVSTKPVTVTDVFYN   
Sbjct: 256 LAASSVVPTHVNSTAPSAGSSILLTTTTHIPNPVHNTTTSKAAVSTKPVTVTDVFYNTTT 315

Query: 316 XXXXXXXXXXXXXXXXXXKTSASTNTVTICDSECQSKKSAEQVXXXXXXXXXXXXXXXEC 375
                             KTSASTNTVTICDSECQSKKSAEQV               EC
Sbjct: 316 VPCSTTTTPLNYNTTIVTKTSASTNTVTICDSECQSKKSAEQVTKTNTNTLHTTKTITEC 375

Query: 376 DIVCQSSKSVEFAKSQAARSSSAEYTVKTTVIPEVEGXXXXXXXXXXXVVCDEACEXXXX 435
           DIVCQSSKSVEFAKSQAARSSSAEYTVKTTVIPEVEG           VVCDEACE    
Sbjct: 376 DIVCQSSKSVEFAKSQAARSSSAEYTVKTTVIPEVEGTTTKYTTLTSTVVCDEACESSKS 435

Query: 436 XXXXXXXXXXXXXXXNISTTAGSNKSGTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 495
                          NISTTAGSNKSGTS                               
Sbjct: 436 SASTATTAGKFTAGTNISTTAGSNKSGTSTKGDTYTTVTNTNTITKHATSSSLATVAVSS 495

Query: 496 KKQNATSVTIHQQTENGAVKNGV 518
           KKQNATSVTIHQQTENGAVKNGV
Sbjct: 496 KKQNATSVTIHQQTENGAVKNGV 518

>Smik_15.183 Chr15 (311669..313078) [1410 bp, 469 aa] {ON} YOR009W
           (REAL)
          Length = 469

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 5/58 (8%)

Query: 341 TVTICDSECQSKKSAEQVXXXXXXXXXXXXXXXECDIVCQSSKSVEFAKSQAARSSSA 398
           TVT+CDS CQ+KKSA                   CD  CQ+ KS      Q+  S+ A
Sbjct: 379 TVTVCDSACQAKKSA-----TATKQSTLKTTVTVCDSACQAKKSATAVSVQSKNSAPA 431

>NDAI0E03650 Chr5 (788320..789501) [1182 bp, 393 aa] {ON} 
          Length = 393

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (81%), Gaps = 2/22 (9%)

Query: 496 KKQNAT--SVTIHQQTENGAVK 515
           K Q +T  +VT+HQQTENGAVK
Sbjct: 355 KAQTSTQSTVTVHQQTENGAVK 376

>Skud_15.171 Chr15 (305234..306541) [1308 bp, 435 aa] {ON} YOR009W
           (REAL)
          Length = 435

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 6/57 (10%)

Query: 341 TVTICDSECQSKKSA------EQVXXXXXXXXXXXXXXXECDIVCQSSKSVEFAKSQ 391
           TVT+CDS CQ+KKSA      ++                 CD  CQ+ KS    K Q
Sbjct: 337 TVTVCDSACQAKKSATVCSTCKEGTSTATDFSTLKTTVTVCDSACQAKKSATAVKVQ 393

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.302    0.114    0.304 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,653,832
Number of extensions: 332931
Number of successful extensions: 2098
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2114
Number of HSP's successfully gapped: 35
Length of query: 532
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 418
Effective length of database: 40,409,475
Effective search space: 16891160550
Effective search space used: 16891160550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 68 (30.8 bits)