Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F00250singletonON32932917490.0
NCAS0D049408.841ON32732613830.0
KAFR0B00210singletonON32632413270.0
Suva_13.515na 1ON32532612941e-180
TPHA0G03760singletonON33132612911e-180
YPL273W (SAM4)8.841ON32532612891e-179
SAKL0D01452g8.841ON32732712871e-179
KLTH0C03850g8.841ON32932712831e-178
KNAG0B06970singletonON33231512671e-176
KLLA0D01551g8.841ON33132412561e-174
Smik_6.4848.841ON32532612551e-174
Kwal_27.102558.841ON32932712551e-174
Ecym_46128.841ON32632512181e-169
TDEL0E05690singletonON32832911371e-156
Suva_64.1singletonON27327311161e-154
Smik_12.1na 2ON32432610851e-148
Skud_12.4na 2ON32532510781e-147
KAFR0F04420singletonON32632610641e-145
KAFR0L00150singletonON32632710571e-144
Suva_16.17singletonON32432610531e-144
YLL062C (MHT1)na 2ON32432610421e-142
TDEL0E00240singletonON32832810411e-142
ABL125W8.841ON33633010091e-137
Suva_16.328.841ON2592509821e-134
TPHA0I002608.841ON3233218931e-119
TBLA0B032608.841ON3263268791e-117
Kpol_1068.78.841ON3233248651e-115
ZYRO0G14212g8.841ON3253278581e-114
Skud_101.1singletonON2002008211e-110
Skud_100.1singletonON2002007891e-105
SAKL0D09306gna 3ON3263367248e-94
Kwal_0.322na 3ON3323356241e-78
AFR410WsingletonON3703276071e-75
KLTH0H12716gna 3ON3483435538e-68
Skud_47.2singletonON96964022e-48
YMR321Cna 1ON1051033665e-43
ZYRO0G16588g5.296ON92790820.13
SAKL0H02376g5.78ON25582659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F00250
         (329 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       678   0.0  
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               537   0.0  
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       515   0.0  
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   503   e-180
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     501   e-180
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   501   e-179
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   500   e-179
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   498   e-178
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             492   e-176
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   488   e-174
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   488   e-174
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   488   e-174
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   473   e-169
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   442   e-156
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        434   e-154
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   422   e-148
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   419   e-147
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               414   e-145
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      411   e-144
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   410   e-144
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   405   e-142
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       405   e-142
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   393   e-137
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   382   e-134
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   348   e-119
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   343   e-117
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   337   e-115
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   335   e-114
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   320   e-110
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   308   e-105
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   283   8e-94
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   244   1e-78
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   238   1e-75
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   217   8e-68
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      159   2e-48
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   145   5e-43
ZYRO0G16588g Chr7 complement(1356025..1358808) [2784 bp, 927 aa]...    36   0.13 
SAKL0H02376g Chr8 complement(238421..239188) [768 bp, 255 aa] {O...    30   9.5  

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/329 (100%), Positives = 329/329 (100%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE
Sbjct: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK
Sbjct: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE
Sbjct: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV
Sbjct: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG
Sbjct: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYSNTK 329
           ARIIGGCCRTTPNDIKQISDAVHKYSNTK
Sbjct: 301 ARIIGGCCRTTPNDIKQISDAVHKYSNTK 329

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/326 (76%), Positives = 286/326 (87%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           MTRQ IK+YL +NP K+L+LDGGQGTELENRGINVANPVWSTIPFV++SFWS +SS DR+
Sbjct: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IVK+MF DFL AGAEILMTTTYQTSFKSVSENT+IKTL+EY+ELL RIV+FSRDCIGE K
Sbjct: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIGCIGPWGAH+C+EF G+YG HPE IDYY+YFKPQL NF  N++LD+IGFET+PNV E
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSW   IL KPFYIGLSVHENGVLRDGTTM ++ +I  SL +K+NPNL+LLGINCV
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S  HSP IL+ IH NLPD+PLI YPNSGEVYDTVKKIWLP N E  ++W++VV+RY++AG
Sbjct: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326
           ARIIGGCCRTTP DI +IS AV K+S
Sbjct: 301 ARIIGGCCRTTPKDILEISKAVKKFS 326

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/324 (75%), Positives = 280/324 (86%), Gaps = 1/324 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M RQPIK+YL ENPKK+L+LDGGQGTELENRGI+VANPVWSTIPF+++SFWS  SSKDRE
Sbjct: 1   MPRQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWSNASSKDRE 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IVK MF DFL+AGA+ILMT TYQTSFKSV+ENT IKTLKEY+ELL RIV+FSR CIG+ K
Sbjct: 61  IVKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEK 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIGCIGPWGAH+C+EF G+YG HPE IDYY YFKPQL NF QN DLD+IGFET+PN +E
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSW   IL KPFYIGLSVHENGVLRDGTTM+++   I SL  K+NPN +LLGINCV
Sbjct: 181 LKAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCV 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S + SPDIL+SIH  LPD+PLI YPNSGE+YDTVKKIWL PN  + ++W++VV RY+KAG
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWL-PNHYSDITWNDVVNRYIKAG 299

Query: 301 ARIIGGCCRTTPNDIKQISDAVHK 324
           ARIIGGCCRT P+DI+Q+S AV K
Sbjct: 300 ARIIGGCCRTMPDDIEQVSAAVKK 323

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  503 bits (1294), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 234/326 (71%), Positives = 277/326 (84%), Gaps = 1/326 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R P+K  L+++PKK+L+LDGGQGTELENRGI VANPVWSTIPF+++SFWS +SS +R+
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IVK+MFNDFL AGAEILMT TYQTSFKSVSENT IKTL  YD LLTRIV+FSRDCIGE K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           +LIGCIGPWGAH+C EFTGNYG +PE ID+Y+YFKPQL NF +ND LD++GFETIPN++E
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSW   IL KPFYIGLSVHE+GVLRDGTTM  VA +I  L DK+NPN +LLGINCV
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S   SPDIL+S+H  LP++PL+ YPNSGEVYDT KKIW+ PN +   SWD VV++Y+ +G
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWM-PNSDKLNSWDTVVKQYIGSG 299

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326
           ARIIGGCCRTTP DI+++S AV KY+
Sbjct: 300 ARIIGGCCRTTPKDIQEVSAAVKKYT 325

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  501 bits (1291), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 233/326 (71%), Positives = 275/326 (84%), Gaps = 1/326 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M RQ IK+YL ENP K+L++DGGQGTELENRGI VANPVWSTIPF+++SFWS QSS+DR+
Sbjct: 1   MARQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWSDQSSEDRK 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IVK+MFNDF+ AGAEILMTTTYQTSFKSVSENT IK  K Y+ELL RI++FSRDCIGE +
Sbjct: 61  IVKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEER 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIGCIG WGAHIC+EF G+YGEHPE ID+YEYFKPQL NF  N+ LD+IGFET+PN++E
Sbjct: 121 YLIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSW   IL KPFYIGLSVHENG+LRDGT+M +VA++I    +KLNPNL LLGINCV
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCV 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S  HS DI+ SIH  LP+LPLI YPNSGE+YDT KKIWL PN     +WD++V+ Y++AG
Sbjct: 241 SYNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWL-PNKNPIFTWDDIVKGYIEAG 299

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326
            RIIGGCCRTTPNDIK ++ AV + +
Sbjct: 300 VRIIGGCCRTTPNDIKAVTIAVKERA 325

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  501 bits (1289), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 231/326 (70%), Positives = 277/326 (84%), Gaps = 1/326 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R P+K +L++NPKK+L+LDGGQGTELENRGI VANPVWSTIPF+++SFWS +SS +R+
Sbjct: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IVK+MFNDFL AGAEILMTTTYQTS+KSVSENT I+TL EY+ LL RIV+FSR+CIGE+K
Sbjct: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIGCIGPWGAHIC EFTG+YG  PE ID+Y+YFKPQL NF +ND LD+IGFETIPN++E
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSW   IL +PFYIGLSVHE+GVLRDGTTM ++A +I  L DK+NPN   LGINCV
Sbjct: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S   SPDIL+S+H  LP++ L+ YPNSGEVYDT KKIWL PN +   SWD VV++Y+ +G
Sbjct: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWL-PNSDKLNSWDTVVKQYISSG 299

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326
           ARIIGGCCRT+P DI++IS AV KY+
Sbjct: 300 ARIIGGCCRTSPKDIQEISAAVKKYT 325

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  500 bits (1287), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 231/327 (70%), Positives = 278/327 (85%), Gaps = 1/327 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M RQPIK +  E+P +IL++DGGQGTELENRGI VANPVWSTIPF+++SFWS +SS+DR+
Sbjct: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IVK+MF+DF++ G+ ILMTTTYQTSFKSVSENT IKTLKEY++LL RIV FSR+CIGE+K
Sbjct: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIGCIG WGAH+C EFTG+YG +PE ID+ EYF+PQL NF  ++ +D+IGFETIPNV+E
Sbjct: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSW   I+ KPFYIGLSVHENGVLRDGTTM +VADII SL DKLNPNL+LLGINCV
Sbjct: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S  HS  IL S+H  LPD+P+IVYPNSGE+YDTVKKIWL  N+   ++WD+VV+ Y++ G
Sbjct: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWL-HNENQKVTWDDVVKSYIENG 299

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYSN 327
           ARIIGGCCRT+P DIK I  A+ KY +
Sbjct: 300 ARIIGGCCRTSPQDIKDIVQAIEKYKS 326

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  498 bits (1283), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 232/327 (70%), Positives = 279/327 (85%), Gaps = 3/327 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSG--QSSKD 58
           M R  +K+YL+ NP+++L+LDGGQGTELENRGI VANPVWSTIPF++DSFW+    SSKD
Sbjct: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60

Query: 59  REIVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGE 118
           R+IVK+M+ DFL+AGA +LMT TYQ SFKSVSENT+I TL+EYD LL+RIV+FSR CIG+
Sbjct: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120

Query: 119 NKYLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNV 178
           +K+L+GCIGPWGAH CSEFTG+YG  PE IDY +YFKPQL NF  NDDLD+IGFETIPN+
Sbjct: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180

Query: 179 YELKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGIN 238
           +EL+ ILSW T ILPKPFYIGLSVHE+GVLRDGTTM +VA++I SL DK+NPN VLLGIN
Sbjct: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240

Query: 239 CVSLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLK 298
           CVS  HSP+IL S+H  +P+LPLI YPNSGEVYDTVKKIW P  D T ++WD+VV+ Y+ 
Sbjct: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHT-LTWDQVVKSYID 299

Query: 299 AGARIIGGCCRTTPNDIKQISDAVHKY 325
           +GARIIGGCCRT+P DI  I+ AV+KY
Sbjct: 300 SGARIIGGCCRTSPKDIAAINAAVNKY 326

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  492 bits (1267), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 231/315 (73%), Positives = 267/315 (84%), Gaps = 1/315 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M RQPI++YL  NP+K+L+LDGGQGTELENRGINVANPVWST+PF++ SFWS +SSKDR 
Sbjct: 1   MPRQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWSNKSSKDRV 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IVK MF+ FL+AGAEILMTTTYQTSFKSVSENT I+ L+EY  LL RIV FSRDCIG +K
Sbjct: 61  IVKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDK 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIGCIGPWGAH+C+EF G+YG +P  IDY  YFKPQL NF  ND+LD+IGFETIPN++E
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           L+ ILSW   IL KPFYIGLSVH NG+LRDG+TM  VAD+I S   KLN NL LLGINCV
Sbjct: 181 LRAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCV 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S + SPDIL+SIH  LPD+PLI YPNSGEVYDTVKKIWL PN +  M+W+EVV+RY+KAG
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWL-PNRDMVMTWEEVVDRYIKAG 299

Query: 301 ARIIGGCCRTTPNDI 315
           ARI+GGCCRT+P DI
Sbjct: 300 ARIVGGCCRTSPKDI 314

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  488 bits (1256), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 225/324 (69%), Positives = 276/324 (85%), Gaps = 1/324 (0%)

Query: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDREIV 62
           R PIK Y  ENP  +L++DGGQGTELENRGINVANPVWST+PF+N+SFWS  +SKDR IV
Sbjct: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61

Query: 63  KQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKYL 122
           KQMF DF+EAGA+ILMT TYQTSFKSVSENT I+TL+EY+ LL RIV+FSR CIGE++YL
Sbjct: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121

Query: 123 IGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYELK 182
           IGCIG WGAH+CSEFTG+YG HP+ IDY+EYF+PQL NFVQ+ D+DIIGFETIPN++EL+
Sbjct: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181

Query: 183 TILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVSL 242
            ILSW   +L KPFYIGLSVHE GVLRDGT+M Q+AD+I+SL DKLN NL+ +GINC + 
Sbjct: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241

Query: 243 AHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAGAR 302
             S  IL+S+H++ P++PLIVYPNSGE+YDTVKKIWL  N+    +WD+VV+ Y++ GAR
Sbjct: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWL-KNENQLCTWDDVVKSYIENGAR 300

Query: 303 IIGGCCRTTPNDIKQISDAVHKYS 326
           IIGGCCRTT +DIK++  AV+KY+
Sbjct: 301 IIGGCCRTTVDDIKEVRLAVNKYA 324

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  488 bits (1255), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 236/326 (72%), Positives = 278/326 (85%), Gaps = 1/326 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R P+K  L++NPKK+L+LDGGQGTELENRGI VANPVWSTIPF+++SFWS +SS  R+
Sbjct: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSSSRK 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IVK+MFNDFL+AGAEILMTTTYQTS+KSVSENT IKTL EY+ LLTRIV+FSR CIGE+K
Sbjct: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIGCIGPWGAHIC EFTG+YG +PE ID+Y+YFKPQL NF +ND+LD+IGFETIPN++E
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSW   +L KPFYIGLSVHE+GVLRDGTTM +VA +I  L DK+NPN  LLGINCV
Sbjct: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S   SPDIL+S+H  LPD+ L+ YPNSGEVYDT KKIWL PN +   SWD VV+RY+ +G
Sbjct: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWL-PNSDKLNSWDAVVKRYISSG 299

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326
           ARIIGGCCRT+P DI++I  AV KY+
Sbjct: 300 ARIIGGCCRTSPKDIQEIFTAVKKYT 325

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  488 bits (1255), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 223/327 (68%), Positives = 274/327 (83%), Gaps = 3/327 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSG--QSSKD 58
           M R  IK++L +NP+++L+LDGGQGTELENRGI VANPVWSTIPF+++SFWS   QSSKD
Sbjct: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60

Query: 59  REIVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGE 118
           R+IVK+M++DFL+AGA +LMT TYQ SFKSVSENT IKTL+EYD LL RIV FSR+CIG+
Sbjct: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120

Query: 119 NKYLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNV 178
           +K+L+GCIG WGAH CSEFTG+YG  PE ID+ +YFKPQL NF  N+++D+IGFETIPN+
Sbjct: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180

Query: 179 YELKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGIN 238
           +EL+ ILSW   I+ KPFYIGLSVHENG+LRDGTTM QVA++I S  D+LNPN  LLGIN
Sbjct: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240

Query: 239 CVSLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLK 298
           CVS   S DIL S+H  LP++PLI YPNSGEVYDTVKKIW P N +T +SW+++V+ Y+ 
Sbjct: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQT-LSWEQIVKSYID 299

Query: 299 AGARIIGGCCRTTPNDIKQISDAVHKY 325
           +GARIIGGCCRT+P DI+ I +AV KY
Sbjct: 300 SGARIIGGCCRTSPKDIEAIHEAVQKY 326

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  473 bits (1218), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 219/325 (67%), Positives = 265/325 (81%), Gaps = 1/325 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R  +K  L  NP +ILI+DGGQGTELENRGINVANPVWSTIPF+NDSFWS +SS+DR+
Sbjct: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWSDRSSRDRQ 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IV  MF +++ AGA +LMT TYQ+SFKSVSENT+IKTL+EY++LL RIV FSR CIG + 
Sbjct: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YL+GCIG WGAHIC+EF+G+YGEHPE I Y +YF+PQL NF   +D+D+IGFETIPN++E
Sbjct: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           L  ILSW   I+ KPFYIG+SVHE+G LRDGTTMSQVA +  SL  KLNPN + LGINC 
Sbjct: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S  +S  IL+S+H  LP +PLI YPNSGE+YDTVKKIWL  N+   ++WDE+V+ YL++G
Sbjct: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWL-KNENCIVTWDEIVKSYLQSG 299

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKY 325
           ARIIGGCCRTTPNDI+QI  AV KY
Sbjct: 300 ARIIGGCCRTTPNDIRQIVTAVKKY 324

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  442 bits (1137), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 208/329 (63%), Positives = 255/329 (77%), Gaps = 2/329 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R PIK  + E+ K+IL+LDGGQGTELENRGI VANPVWSTIPF+++SFW+  SSK+R+
Sbjct: 1   MVRIPIKKLVIES-KEILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWTDSSSKERK 59

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IV+ +F+DF ++G+ ILMT TYQTSF S+ ENT  KTL EY+ LL RIV FSR CIG+ +
Sbjct: 60  IVESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDER 119

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIG +GPWGAH+C EFTGNYG HPE IDYYEYFKPQL NF   D++D+IGFET+PN +E
Sbjct: 120 YLIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHE 179

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSW    + KPFYIGLSVH NGVLRDGTTM ++ + I  L +K++ N +LLG+NCV
Sbjct: 180 LKAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCV 239

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S   S D++ SIH  LPD+PL+ YPNSGEVYDT KKIW   N +   SWD VV  Y+  G
Sbjct: 240 SFNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWF-DNKDKLDSWDSVVRSYIDNG 298

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYSNTK 329
           ARIIGGCCRT+P DI ++S AV KY+  +
Sbjct: 299 ARIIGGCCRTSPRDIAEVSAAVKKYNKVQ 327

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  434 bits (1116), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 202/273 (73%), Positives = 235/273 (86%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R P+K  L+++PKK+L+LDGGQGTELENRGI VANPVWSTIPF+++SFWS +SS +R+
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IVK+MFNDFL AGAEILMT TYQTSFKSVSENT IKTL  YD LLTRIV+FSRDCIGE K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           +LIGCIGPWGAH+C EFTGNYG +PE ID+Y+YFKPQL NF +ND LD++GFETIPN++E
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSW   IL KPFYIGLSVHE+GVLRDGTTM  VA +I  L DK+NPN +LLGINCV
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDT 273
           S   SPDIL+S+H  LP++PL+ YPNSGEVYDT
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDT 273

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  422 bits (1085), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 193/326 (59%), Positives = 252/326 (77%), Gaps = 2/326 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R PI+  L E+P+K+L+LDGGQGTELENRGIN+ +PVWS  PFV+DSFW  +SS++R+
Sbjct: 1   MKRIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFWE-KSSRERK 59

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           +V++M+ DF+ AGA +LMT TYQ +FKS+S+NT IKTL  Y   L +IV FSR  IGE +
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEER 119

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIG IGPW AH+ SE+TGNYG HPE IDYYE+F+PQL  F +N+D+D+IGFETIPN +E
Sbjct: 120 YLIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHE 179

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSWG DI+ +PFY+GLSVH+NG+LRDGTT+ +++  I  L  K+N N +LLG+NC+
Sbjct: 180 LKAILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCI 239

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S   S  IL ++H  LPD PL+VYPNSGE+YD  +K W  P D+   SWD  V +++ +G
Sbjct: 240 SFNQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKL-DSWDVTVRKFIDSG 298

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326
           ARIIGGCCRT+P DI +I+ +V  YS
Sbjct: 299 ARIIGGCCRTSPKDIAEIAASVDTYS 324

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  419 bits (1078), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 192/325 (59%), Positives = 250/325 (76%), Gaps = 2/325 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R  I+  + E P ++L+LDGGQGTELENRGIN+  PVWS  PF +DSFW  QSS DRE
Sbjct: 1   MKRISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFWE-QSSHDRE 59

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           +V++M+ DF+ AGA +LMT TYQ +FKS+SENT+I+TL  Y+  L RIV+F+R  IGE +
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEER 119

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YL+G IGPW AH+ SE+TGNYG HPE IDYY +FKPQL +F +N D+D+IGFET+PN +E
Sbjct: 120 YLVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHE 179

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSWG DI+ KPFY+GLSVH+NG+LRDGTTM +V+  I  L  ++N +L+L+G+NC+
Sbjct: 180 LKAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCI 239

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S   S  IL ++H +LPD PL+VYPNSGEVYD  +K W  P D+   SWD  V+ ++ +G
Sbjct: 240 SFNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKP-ESWDITVKTFIDSG 298

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKY 325
           ARIIGGCCRT+P DI +I+ AV +Y
Sbjct: 299 ARIIGGCCRTSPKDIAEIATAVRRY 323

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  414 bits (1064), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 190/326 (58%), Positives = 253/326 (77%), Gaps = 1/326 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R PIK+YL  N  KIL+LDGGQGTELE RGIN+++PVWST+PF+N+SFWS  SS DR+
Sbjct: 1   MGRVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWSNSSSNDRK 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           I+K M++DF+ AGA++L TTTYQTSF S+SENTNI+TLK+Y ELL RI  F+R+CIG++K
Sbjct: 61  IIKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSK 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YL+G IG + A++ +E+TG++G+  + IDY+ YFKPQL NF ++ ++DIIGFETIPN++E
Sbjct: 121 YLVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           L+ ILS     L KPFYI LS +    LRDGT++  V D+I S    LNPNL+LLGINC+
Sbjct: 181 LRAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCI 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
            L  S   ++ ++++LP  PLIVYPNSGE YD V+KIWL   D  + +W+ +V RYL AG
Sbjct: 241 GLNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAF-TWEYIVHRYLDAG 299

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326
           ARI+GGCCRTTP+DI+ IS+A+  Y+
Sbjct: 300 ARIVGGCCRTTPSDIRSISEAIKCYT 325

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  411 bits (1057), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 191/327 (58%), Positives = 250/327 (76%), Gaps = 1/327 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R P+K YL ENP+K+L+ DGGQG ELE RG+++ + +WST PF++ SFWS  SS D  
Sbjct: 1   MVRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWSDPSSNDIR 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IVK MF DF+ AGAEILMTTTYQTSFK+VSE+T +K+L+EY+ELL +IV F+R CIG+N+
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIG IG +GA +  E++G+YG+ PE +D+Y YFKPQL NF+ ND++DI+GFETI N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK++LSW    + KPFYI LSVH+NG LRDGT M  + D I SL+  +NPNL  LG+NCV
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           +   + +I+DSIH+ LP +PL V+PNSGEV++  K IW   N E   SW+ VV+R++ +G
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIW-TANPEAAASWEAVVKRFISSG 299

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYSN 327
            RI+GGCCRT P+DI+QIS AV K SN
Sbjct: 300 VRIVGGCCRTRPHDIEQISKAVKKLSN 326

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  410 bits (1053), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 185/326 (56%), Positives = 249/326 (76%), Gaps = 2/326 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R  I+  + E+P+K+L+LDGGQGTELENRGI++ +PVWS  PF++DSFW   SS DR 
Sbjct: 1   MGRIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFWESTSS-DRT 59

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           +V++M+ DF++AGA +LMT TYQ +F S+SENT+IKTL +Y+  L R+V+F+R  IGE++
Sbjct: 60  LVEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDR 119

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIG IGPW AH+ SE+TG+YG HPE IDY ++FK QL NF ++ ++D+IGFET+PN +E
Sbjct: 120 YLIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHE 179

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSW  +I+ KPFY+GLSVH+NG+LRDGTTM ++A  + SL  K+N + +LLG+NC+
Sbjct: 180 LKAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCI 239

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S   S  IL S+H  LPD+PL+ YPNSGEVYDT  K W     +   SW+ VVE ++  G
Sbjct: 240 SFNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQ-NSWEVVVEEFIDNG 298

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326
           ARIIGGCCRT+  DI +I+ AV K+S
Sbjct: 299 ARIIGGCCRTSAKDISEIASAVDKHS 324

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  405 bits (1042), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 189/326 (57%), Positives = 250/326 (76%), Gaps = 2/326 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R PIK+ + E+P K+LILDGGQGTELENRGIN+ +PVWS  PF ++SFW   SS++R+
Sbjct: 1   MKRIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFWE-PSSQERK 59

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           +V++M+ DF+ AGA ILMT TYQ +F+S+SENT+IKTL  Y   L +IV+F+R+ IGE +
Sbjct: 60  VVEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEER 119

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YLIG IGPW AH+  E+TG+YG HPE IDYY +FKPQL NF QN D+D+IGFETIPN +E
Sbjct: 120 YLIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHE 179

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSW  DI+ KPFYIGLSV +N +LRDGTT+ +++  I  L +K+N NL+L+G+NCV
Sbjct: 180 LKAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCV 239

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S   S  IL  +H +LP +PL+VYPNSGE+Y+  +K W  P ++    W+  V++++  G
Sbjct: 240 SFNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNK-LDDWETTVKKFVDNG 298

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326
           ARIIGGCCRT+P DI +I+ AV KYS
Sbjct: 299 ARIIGGCCRTSPKDIAEIASAVDKYS 324

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  405 bits (1041), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 185/328 (56%), Positives = 253/328 (77%), Gaps = 2/328 (0%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R P++  L+++ +KIL+LDGGQGTE+ENRGI VANPVWS+IPFV++SFW+ + SK+R+
Sbjct: 1   MGRVPLRKVLTDS-RKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWTDEWSKERK 59

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IV++++ DF+ +G+++LMT TYQ SFK+++ENT ++TL EY+ LL RIV FSR CIG+ +
Sbjct: 60  IVEEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDER 119

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YL+G +GPW A+  SE+TG+YG H + IDYY Y+KPQL NF + +++D+IG ET+PN +E
Sbjct: 120 YLVGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHE 179

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           LK ILSW    + KPFY+ L+ H++GVLRDGT M  +A  I  L + LNPN +LLGINCV
Sbjct: 180 LKAILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCV 239

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300
           S   S DIL+ +H+ LP++ L+ YPNSGEVY+  KKIWL    +T  SWD VV+ ++ +G
Sbjct: 240 SFNDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLANKCKT-TSWDSVVKSFINSG 298

Query: 301 ARIIGGCCRTTPNDIKQISDAVHKYSNT 328
           ARIIGGCCRT+P DI  +S AV KYS T
Sbjct: 299 ARIIGGCCRTSPQDIADVSIAVKKYSMT 326

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  393 bits (1009), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 183/330 (55%), Positives = 240/330 (72%), Gaps = 5/330 (1%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M R PI+ YL E+P ++L++DGGQGTELENRGI VA+PVWS  PF++ + W    S++R 
Sbjct: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120
           IV  +  DF+ AGAE++MT TYQ SF SV+ NT I TL++Y+ LL RIV F R+ +G++K
Sbjct: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120

Query: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           YL+G IG WGAH+C+EFTG+YG  P+ IDY  YFKPQL NF     LD+IGFETIPN +E
Sbjct: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180

Query: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240
           L+ ILSW   ++ KPFY+ LSVH+ G LRDGT M+ VA  I + +  LNPN + LGINC 
Sbjct: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVA-AIVAAAAPLNPNFLGLGINCS 239

Query: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETY-MSWDEVVERYLKA 299
           SL+ +P IL  +H+ LP LP+ +YPNSGE+YD VKK+W   N   + + W  VV  Y+++
Sbjct: 240 SLSRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVW---NASPHVVDWGAVVASYIRS 296

Query: 300 GARIIGGCCRTTPNDIKQISDAVHKYSNTK 329
           GARIIGGCCRT PNDI+QI+DAV  ++   
Sbjct: 297 GARIIGGCCRTIPNDIRQIADAVRTHARAS 326

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  382 bits (982), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 180/250 (72%), Positives = 209/250 (83%), Gaps = 1/250 (0%)

Query: 77  LMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKYLIGCIGPWGAHICSE 136
           LMT TYQTSFKSVSENT IKTL  YD LLTRIV+FSRDCIGE K+LIGCIGPWGAH+C E
Sbjct: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70

Query: 137 FTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYELKTILSWGTDILPKPF 196
           FTGNYG +PE ID+Y+YFKPQL NF +ND LD++GFETIPN++ELK ILSW   IL KPF
Sbjct: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130

Query: 197 YIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVSLAHSPDILDSIHSNL 256
           YIGLSVHE+GVLRDGTTM  VA +I  L DK+NPN +LLGINCVS   SPDIL+S+H  L
Sbjct: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190

Query: 257 PDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAGARIIGGCCRTTPNDIK 316
           P++PL+ YPNSGEVYDT KKIWL PN +   SWD VV++Y+ +GARIIGGCCRTTP DI+
Sbjct: 191 PNMPLLAYPNSGEVYDTEKKIWL-PNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQ 249

Query: 317 QISDAVHKYS 326
           ++S AV KY+
Sbjct: 250 EVSAAVKKYT 259

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  348 bits (893), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 223/321 (69%), Gaps = 3/321 (0%)

Query: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQ-SSKDREI 61
           R P + ++ E+P +IL+LDGGQGTELENRG+N+ +P+WSTI FVND FW     + +R+ 
Sbjct: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61

Query: 62  VKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKY 121
           +++MFNDF +AGA +  T TYQTSF SVSENT+IK+L+EY ELL +I  F R CI ++ Y
Sbjct: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121

Query: 122 LIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYEL 181
           L+GCIG + A I +E+ GNYG     IDY +YFKPQL  F  + ++DIIGFETIPN +EL
Sbjct: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181

Query: 182 KTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVS 241
           + ILSW  DI+ +PF+I LS+ +   LRDGT+  ++  +      + N NLV +G NC+S
Sbjct: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240

Query: 242 LAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAGA 301
            A+S D +  +H  +P L LI YPNSGE+YD   K W        +SW+EVV  Y  AG 
Sbjct: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQW-SSTSAIKISWEEVVNEYADAGV 299

Query: 302 RIIGGCCRTTPNDIKQISDAV 322
           +IIGGCCRTTP+DIKQI  AV
Sbjct: 300 KIIGGCCRTTPDDIKQIKKAV 320

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  343 bits (879), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 163/326 (50%), Positives = 231/326 (70%), Gaps = 2/326 (0%)

Query: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSG-QSSKDREI 61
           RQ  K+Y + +P  ++++DGGQGTELE RG++V++ VWST+PF+   FW   + S++  I
Sbjct: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61

Query: 62  VKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKY 121
           VK MF  F+ AG++ LM+ TYQ SF ++S NT I+ L+EY+ELL +IV F R+CIG +KY
Sbjct: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121

Query: 122 LIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYEL 181
           LIG IGP+ +H+ +E+TG+YG HPE +DY  YFKPQL NF  NDD+D+I  ET+PN YEL
Sbjct: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYEL 181

Query: 182 KTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVS 241
           K +LSW    + KPFYI LSV ++G LRDGT+M  ++ +  +   K NPNL+++G+NCVS
Sbjct: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240

Query: 242 LAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAGA 301
              +  I+  +   +PDLPL+ YPNSGEVYD + + W   ND    SW+ +V+  +  G 
Sbjct: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300

Query: 302 RIIGGCCRTTPNDIKQISDAVHKYSN 327
           R++GGCCRTTP+DI +I+ AV   S+
Sbjct: 301 RMVGGCCRTTPDDIHKIAQAVSHLSH 326

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  337 bits (865), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 230/324 (70%), Gaps = 6/324 (1%)

Query: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQS-SKDREI 61
           R PI++ +   P ++L+ DGG GT LE+RGINV++P+WST+PF+ D FW  ++ + DR I
Sbjct: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61

Query: 62  VKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKY 121
           ++ ++ D++ +G+ IL T TYQTSF  +S +T +KT++ Y +L+  I +F R  IGE+ Y
Sbjct: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121

Query: 122 LIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYEL 181
           LIG IGP+GA + +E+TGNYG+ P  I+Y EYFKPQL  F  NDD+DIIGFET+PN YEL
Sbjct: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181

Query: 182 KTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVS 241
           + ILSW   ++ KP+Y+ LS+ +NG LRDGT+  ++A I    S+  N NL+L G NC+S
Sbjct: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239

Query: 242 LAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETY-MSWDEVVERYLKAG 300
             ++ + +  +H  +P LPLIVYPNSGE+YD + K W    D+T+ ++W+++++    + 
Sbjct: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTI--DQTFGLTWEDLIKELRTSN 297

Query: 301 ARIIGGCCRTTPNDIKQISDAVHK 324
            RI+GGCCRTTP+DI +I D + K
Sbjct: 298 VRIVGGCCRTTPDDINKIKDMITK 321

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  335 bits (858), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 159/327 (48%), Positives = 229/327 (70%), Gaps = 9/327 (2%)

Query: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWS-GQSSKDREI 61
           RQ + + L +   ++L++DGGQGTELENRG+N++ P+WST+PF  + FW+  Q   DR++
Sbjct: 2   RQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60

Query: 62  VKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKY 121
           V  MF  +++AGA++L T TYQTS+K++  +T+I T  +YD+LL RIV F R CIG++ Y
Sbjct: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120

Query: 122 LIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYEL 181
           L+G IGP+ AH+ +E+TG+YG  PE IDY++YF+PQ+ NF +N+ +DIIG ET+PNV+EL
Sbjct: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180

Query: 182 KTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVS 241
           K+ILSW    + KPFY+ L V ++G LRDGT + Q+  +    +++ N NL+L+GINC S
Sbjct: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPL---FANRSNKNLLLVGINCCS 237

Query: 242 LAHSPDILDSIHSNLPDLP--LIVYPNSGEVYDTVKKIWLPPN--DETYMSWDEVVERYL 297
           L+ S   L  ++  L   P  L+VYPNSGE+YD   + W  P   D   +SW  +V+ Y 
Sbjct: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297

Query: 298 KAGARIIGGCCRTTPNDIKQISDAVHK 324
           K GAR IGGCCRTTP DI++I   V +
Sbjct: 298 KFGARAIGGCCRTTPLDIQEICKVVDR 324

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  320 bits (821), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 153/200 (76%), Positives = 170/200 (85%)

Query: 78  MTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKYLIGCIGPWGAHICSEF 137
           MTTTYQTS+KSVSENT IKTL EY+ LLTRIV+FSRDCIGENKYLIGCIGPWGAHIC EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 138 TGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYELKTILSWGTDILPKPFY 197
           TG+YG  PE ID+YEYFKPQL NF +ND LD+IGFETIPNV+EL+ ILSW   IL KPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 IGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVSLAHSPDILDSIHSNLP 257
           IGLSVHE+GVLRDGTTM +VA +I  L DK+NPN  LLGINCVS   SPDIL+S+H  LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 258 DLPLIVYPNSGEVYDTVKKI 277
           D+ L+ YPNSGEVYDT KKI
Sbjct: 181 DMALLAYPNSGEVYDTEKKI 200

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  308 bits (789), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 147/200 (73%), Positives = 169/200 (84%)

Query: 78  MTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKYLIGCIGPWGAHICSEF 137
           MTTTYQTS+KSVSENT IKTL EY+ LLTRIV+FSR CIGE+KYLIGCIGPWGAHIC EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 138 TGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYELKTILSWGTDILPKPFY 197
           TG+YG  P+ ID+Y+YFKPQL NF ++D LD+IGFETIPNV+EL+ ILSW   IL KPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 IGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVSLAHSPDILDSIHSNLP 257
           IGLSVHE+GVLRDGTTM +VA +I  L DK+NPN  LLGINCVS   SPDIL+S+H  LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 258 DLPLIVYPNSGEVYDTVKKI 277
           ++ L+ YPNSGEVYDT KKI
Sbjct: 181 NMALLAYPNSGEVYDTEKKI 200

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  283 bits (724), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 148/336 (44%), Positives = 222/336 (66%), Gaps = 23/336 (6%)

Query: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
           M RQPI +YL  +   IL+LDGGQGTE+E RGI+V +P+WST+PF+       ++     
Sbjct: 1   MRRQPIAEYLESS---ILVLDGGQGTEMERRGIDVIHPLWSTLPFIK------KNPTHLN 51

Query: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTN--IKTLKEYDELLTRIVNFSRD-CIG 117
            +K M++DF  +GA  L T TYQ SF ++ + ++  + T ++Y + L  I+ F+RD CI 
Sbjct: 52  HIKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCIS 111

Query: 118 ENKYLIGCIGPWGAHIC--SEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETI 175
           +++YLIGC+GP+ A++C  +E++G+YG   E ID+ +YFKPQL  F ++D +D++GFETI
Sbjct: 112 DSQYLIGCVGPYAAYLCNGAEYSGDYGS--EKIDFKQYFKPQLDVFSRDDRIDMVGFETI 169

Query: 176 PNVYELKTILS--WGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLV 233
           PN+ ELKT+LS  + + +  KPFYI +S   NG LRDGT ++++ + I        PNL+
Sbjct: 170 PNIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLL 229

Query: 234 LLGINCVSLAHSPDILDSIHSNLPD----LPLIVYPNSGEVYDTVKKIWLPPND-ETYMS 288
            LGINCV   HS +IL  ++  L D    L   VYPNSGE+YD     W   ++    ++
Sbjct: 230 FLGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELT 289

Query: 289 WDEVVERYLKAGARIIGGCCRTTPNDIKQISDAVHK 324
           W+ +V ++ +   ++IGGCCRTTP+DIKQI+DAV+K
Sbjct: 290 WNYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNK 325

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  244 bits (624), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 133/335 (39%), Positives = 201/335 (60%), Gaps = 26/335 (7%)

Query: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDREIV 62
           R  +++YL     +IL+LDGGQGTELE RGIN+A+P+WST+P+V       +  K  +I+
Sbjct: 2   RLQLEEYLKH---EILLLDGGQGTELEKRGINIAHPLWSTLPYVT------KDKKHLKII 52

Query: 63  KQMFNDFLEAGAEILMTTTYQTSFKSVSENTN--IKTLKEYDELLTRIVNFSRD-CIGEN 119
           K+M++ F  AG   LMT TYQ SF S+  +++  I   KEY   L  +++++ + CI  N
Sbjct: 53  KEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCISPN 112

Query: 120 KYLIGCIGPWGAHIC--SEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPN 177
            YL+G +GP+ A++   +E++G+Y E  + ID+ E+F+PQ+ +F  +  +D+IG ETIPN
Sbjct: 113 SYLVGSVGPYAAYLSNGAEYSGHYIE--DNIDFIEFFRPQVQHFAVSSRIDLIGIETIPN 170

Query: 178 VYELKTIL--SWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLL 235
             E K +L   +      KP+YI ++    G LRDGT    + + I   +  L PNLV  
Sbjct: 171 FEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLVFF 230

Query: 236 GINCVSLAHSPDILDSIHSNLPDLPL-------IVYPNSGEVYDTVKKIWLP-PNDETYM 287
           GINCVS AH  DIL  ++ +L D+ +        VYPNSGEVY      W P P      
Sbjct: 231 GINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGPAD 290

Query: 288 SWDEVVERYLKAGARIIGGCCRTTPNDIKQISDAV 322
           +W+ +  + ++ G  +IGGCCRT+P D++QI+  V
Sbjct: 291 TWENLASKVVQQGCLMIGGCCRTSPADLRQIASVV 325

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  238 bits (607), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 123/327 (37%), Positives = 197/327 (60%), Gaps = 21/327 (6%)

Query: 6   IKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDREIVKQM 65
           I ++L  N   +L++DGG G ELE RG++V +P+WST PF+       +++ D   ++ +
Sbjct: 51  ITEFLERN---VLVMDGGMGVELERRGMDVKSPLWSTAPFLR----GDRAALD--TIRGL 101

Query: 66  FNDFLEAGAEILMTTTYQTSFKS-VSENTNIKTLKEYDELLTRIVNFS-RDCIGENK-YL 122
           + +F  AG+  + T TYQ SF S V  + ++ +  +Y++ L ++V+F+ R+C+   + Y+
Sbjct: 102 YREFRAAGSRGISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPARDYI 161

Query: 123 IGCIGPWGAHIC--SEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180
           IG +GP+ A +C  +E+TG+YG   E I+++ YF+PQ+  F  +  +D I FET+PNV E
Sbjct: 162 IGSVGPYAAFLCNGAEYTGDYGF--ETINFFNYFEPQVSKFATDPRIDAIAFETVPNVVE 219

Query: 181 LKTILS--WGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGIN 238
           L  +L   +   +  KPFYI +S  +  VLRDGT ++ V  +I    D L PNL+  G+N
Sbjct: 220 LMAMLQPEFHALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCFGLN 279

Query: 239 CVSLAHSPDILDSIHSNLPDLPL---IVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVER 295
           CV L  S  +L  ++  L D P+    +YPN   V+D     W P  D   ++W E V+ 
Sbjct: 280 CVDLTRSAAMLAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAEAVKL 339

Query: 296 YLKAGARIIGGCCRTTPNDIKQISDAV 322
           YL    R+IGGCC TTP D++QI++A+
Sbjct: 340 YLNQDCRMIGGCCGTTPQDMRQIAEAL 366

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  217 bits (553), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 194/343 (56%), Gaps = 34/343 (9%)

Query: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDREIV 62
           R+P+K++   N   IL+LDGGQGTELE +G+++++P+WST+PF+       ++    E +
Sbjct: 2   RKPLKEFFKNN---ILLLDGGQGTELEKKGVSISHPLWSTLPFII------KNKTHLEAI 52

Query: 63  KQMFNDFLEAGAEILMTTTYQTSFKSVSENTN--IKTLKEYDELLTRIVNFS-RDCIGEN 119
           K+M+ DF EAG+  LMT TYQ SF S+ + +   + + ++Y   L  ++ F+ R+CI  +
Sbjct: 53  KEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECITPD 112

Query: 120 KYLIGCIGPWGAHIC--SEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPN 177
           KYL+G +GP+   +   +E++G YGE    ID+ +Y+ PQ+ +F  +  +D+IG ETIPN
Sbjct: 113 KYLVGSVGPYAGLLSNGAEYSGYYGEGK--IDFIDYYSPQVKHFALSPRIDLIGIETIPN 170

Query: 178 VYELKTILS--WGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLL 235
           + E K +LS  +      KP+YI ++   NG LRDGT+++++   I   +  L  N V  
Sbjct: 171 IDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFVFF 230

Query: 236 GINCVSLAHSPDILDSIHSNLPDLPL-------IVYPNSGEVYDTVKKIW-----LPPND 283
            INCV   H  +IL S++  L    +         YPNSGE+Y      W       P D
Sbjct: 231 AINCVEFLHCVEILQSLNDCLEMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAGPED 290

Query: 284 ETYMSWDEVVERYLKAGARIIGGCCRTTPNDIKQISDAVHKYS 326
               +W+ +    L     ++GGCCRT   +I+Q++    K S
Sbjct: 291 ----TWENLTLGLLSQECLMLGGCCRTGSEEIRQMALTTKKNS 329

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  159 bits (402), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 85/96 (88%)

Query: 1  MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60
          M R P+K  L +NPKK+L+LDGGQGTELENRGI VANPVWSTIPF++DSFWS +SS +R+
Sbjct: 1  MVRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWSDESSANRK 60

Query: 61 IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIK 96
          IVK MFNDFL AGAEILMTTTYQTS+KSVSENT IK
Sbjct: 61 IVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPIK 96

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  145 bits (366), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (79%), Gaps = 1/103 (0%)

Query: 224 LSDKLNPNLVLLGINCVSLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPND 283
           L DK+NPNL  LGINCVS   SPDIL+S+H  LP++ L+ YPNSGEVYDT KKIWL PN 
Sbjct: 4   LGDKINPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWL-PNS 62

Query: 284 ETYMSWDEVVERYLKAGARIIGGCCRTTPNDIKQISDAVHKYS 326
           +   SWD VV++Y+ +GARIIGGCCRT+P DI++IS AV KY+
Sbjct: 63  DKLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKYT 105

>ZYRO0G16588g Chr7 complement(1356025..1358808) [2784 bp, 927 aa]
           {ON} similar to uniprot|P31111 Saccharomyces cerevisiae
           YDR285W ZIP1 Synaptonemal complex (SC) protein that
           connects homologous chromosomes partially during
           zygotene and entirely during pachytene potential Cdc28p
           substrate synaptonemal complex protein
          Length = 927

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 17/90 (18%)

Query: 110 NFSRDCIGENKYLIGCIGPWGAHICSEFTGNYGE-HPELIDYYEYFKPQLVNFVQNDDLD 168
           NFS   I +   L  CIG    +I SEF  ++GE +  L+DYY           Q   ++
Sbjct: 356 NFSESSISK---LTECIGTLRTNISSEFKTSFGENNRSLVDYY-----------QKSFIE 401

Query: 169 IIG-FETIPNVYE-LKTILSWGTDILPKPF 196
            +G F  I   Y+ L T +  GT++    F
Sbjct: 402 FMGRFNQIDGYYDKLSTSIKEGTELQSAKF 431

>SAKL0H02376g Chr8 complement(238421..239188) [768 bp, 255 aa] {ON}
           similar to uniprot|P38858 Saccharomyces cerevisiae
           YHR163W SOL3 Glucose-6-phosphate dehydrogenase weak
           multicopy suppressor of los1-1 mutation homologous to
           Sol2p and Sol1p
          Length = 255

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 38/82 (46%), Gaps = 10/82 (12%)

Query: 68  DFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKYLIGCIG 127
           D L  G E L  T Y  +   V  N N K  +EY+ LL +         G +  L+GC G
Sbjct: 95  DPLLDGNENLGPTVYAINESLVGLNENDKIAEEYESLLPQGDG------GMDLILLGC-G 147

Query: 128 PWGAHICSEFTGNYGEHPELID 149
           P G H CS F G   +H  L+D
Sbjct: 148 PDG-HTCSLFPGE--KHKYLLD 166

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,612,587
Number of extensions: 1955108
Number of successful extensions: 5572
Number of sequences better than 10.0: 48
Number of HSP's gapped: 5686
Number of HSP's successfully gapped: 48
Length of query: 329
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 219
Effective length of database: 40,868,139
Effective search space: 8950122441
Effective search space used: 8950122441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)