Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F002405.709ON46446421260.0
NCAS0G002005.709ON43834012981e-177
Kpol_2001.775.709ON41333210821e-144
ZYRO0B16478g5.709ON39132510581e-141
TPHA0D046505.709ON42133310581e-141
YIL153W (RRD1)5.709ON39332310541e-141
Suva_9.355.709ON39332810491e-140
TDEL0B021105.709ON38932610421e-139
Skud_9.155.709ON40232610411e-138
Smik_9.165.709ON39332310351e-138
TBLA0E016905.709ON48834810011e-131
KLTH0E00880g5.709ON3713289881e-131
SAKL0E15070g5.709ON3853289711e-128
KAFR0D021905.709ON4263289751e-128
CAGL0H06655g5.709ON4243229641e-126
Kwal_55.196615.709ON3713289551e-126
Ecym_40125.709ON3953359281e-121
KLLA0A00462g5.709ON3533229111e-119
AFR293C5.709ON3653288971e-117
KNAG0L021705.709ON3963278561e-111
KLTH0D11176g8.674ON3532984402e-49
Kwal_26.87838.674ON3553004341e-48
TPHA0D012408.674ON3593034341e-48
CAGL0M02255g8.674ON3583004332e-48
TDEL0A062008.674ON3552984297e-48
KNAG0J016908.674ON3633024291e-47
NDAI0E024108.674ON3593014281e-47
KAFR0H024408.674ON3532984272e-47
YPL152W (RRD2)8.674ON3583004227e-47
Ecym_23998.674ON3512954227e-47
NCAS0C016908.674ON3593014211e-46
ACR139C8.674ON3592954201e-46
Smik_6.3498.674ON3583064202e-46
Skud_16.1308.674ON3582994165e-46
ZYRO0F07326g8.674ON3522984157e-46
Kpol_1013.48.674ON3583054132e-45
Suva_16.1588.674ON3582994113e-45
SAKL0H06622g8.674ON3552994104e-45
KLLA0F11187g8.674ON3602494081e-44
TBLA0C018608.674ON3563073965e-43
ADL177C3.32ON90561790.50
TPHA0G009502.322ON380131722.3
NCAS0F037803.523ON907107696.7
Kpol_1002.636.189ON27847687.0
TPHA0N006505.196ON95794688.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F00240
         (464 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      823   0.0  
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      504   e-177
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   421   e-144
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   412   e-141
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   412   e-141
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   410   e-141
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   408   e-140
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   405   e-139
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   405   e-138
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   403   e-138
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   390   e-131
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   385   e-131
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   378   e-128
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   380   e-128
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   375   e-126
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   372   e-126
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   362   e-121
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   355   e-119
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   350   e-117
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   334   e-111
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   174   2e-49
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   171   1e-48
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   171   1e-48
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   171   2e-48
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   169   7e-48
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   169   1e-47
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   169   1e-47
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   169   2e-47
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   167   7e-47
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   167   7e-47
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   166   1e-46
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   166   1e-46
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   166   2e-46
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   164   5e-46
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   164   7e-46
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   163   2e-45
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   162   3e-45
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   162   4e-45
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   161   1e-44
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   157   5e-43
ADL177C Chr4 complement(383367..386084) [2718 bp, 905 aa] {ON} S...    35   0.50 
TPHA0G00950 Chr7 complement(183625..184767) [1143 bp, 380 aa] {O...    32   2.3  
NCAS0F03780 Chr6 complement(760976..763699) [2724 bp, 907 aa] {O...    31   6.7  
Kpol_1002.63 s1002 complement(172616..173452) [837 bp, 278 aa] {...    31   7.0  
TPHA0N00650 Chr14 complement(141967..144840) [2874 bp, 957 aa] {...    31   8.6  

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/464 (87%), Positives = 408/464 (87%)

Query: 1   MSHKIHKPTPIYLLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANV 60
           MSHKIHKPTPIYLLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANV
Sbjct: 1   MSHKIHKPTPIYLLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANV 60

Query: 61  EIPPHPDSYVSEILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPK 120
           EIPPHPDSYVSEILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPK
Sbjct: 61  EIPPHPDSYVSEILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPK 120

Query: 121 LLEKAIPSPDLQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTG 180
           LLEKAIPSPDLQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTG
Sbjct: 121 LLEKAIPSPDLQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTG 180

Query: 181 KDLLIMFNAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEI 240
           KDLLIMFNAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEI
Sbjct: 181 KDLLIMFNAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEI 240

Query: 241 TNSRLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMD 300
           TNSRLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMD
Sbjct: 241 TNSRLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMD 300

Query: 301 EVLNKFPVVQHFWFGTGFYPWINFQTLRELPVYEHSPEXXXXXXXXXXXXXXLVQRXXXX 360
           EVLNKFPVVQHFWFGTGFYPWINFQTLRELPVYEHSPE              LVQR    
Sbjct: 301 EVLNKFPVVQHFWFGTGFYPWINFQTLRELPVYEHSPEDDDNNNNNNNNNNNLVQRSSSS 360

Query: 361 XXXXXXRPLPHTSTAFPQSSGRMGSTKLXXXXXXXXXXXXRQIGGXXXXXXXXXXXXXXX 420
                 RPLPHTSTAFPQSSGRMGSTKL            RQIGG               
Sbjct: 361 TSTVTSRPLPHTSTAFPQSSGRMGSTKLPSMMGSMTSPSTRQIGGMTAATTTTKMARTTM 420

Query: 421 XXXXXNFLTRPMHPSNTRTTRDGTSSIRSNVNTNTINKNLKNSQ 464
                NFLTRPMHPSNTRTTRDGTSSIRSNVNTNTINKNLKNSQ
Sbjct: 421 PPPTTNFLTRPMHPSNTRTTRDGTSSIRSNVNTNTINKNLKNSQ 464

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  504 bits (1298), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 235/340 (69%), Positives = 278/340 (81%), Gaps = 12/340 (3%)

Query: 9   TPIYLLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDS 68
           T + +LDLK T FSLP KRIFDSQTTQDFQSSIAL RLRFFLQ+YI +V NV+ PP  + 
Sbjct: 28  THMAVLDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPP--EG 85

Query: 69  YVSEILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAI-- 126
            +S + +VNSI+ LLN LST++ +TPPL GPRRYGNLACRDWH+K+E +LP LL + +  
Sbjct: 86  TLSSVTLVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDP 145

Query: 127 -------PSPDLQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPD-L 178
                   S  + P I ELNYYI+N+FGSSTRLD+GTGHELSFMAFIAA+DMLGL+ D +
Sbjct: 146 YLPKVSGESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGM 205

Query: 179 TGKDLLIMFNAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPK 238
            G D+L++FN YY+LVR+LILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW+ NAP+ P+
Sbjct: 206 QGTDILLLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRNAPMRPR 265

Query: 239 EITNSRLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMY 298
           ++ +  LVK Y+  NLYCQCI F+  VKSGPF+EHSPILYDI+TSV+ W KVQRGLIKMY
Sbjct: 266 DVKDISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMY 325

Query: 299 MDEVLNKFPVVQHFWFGTGFYPWINFQTLRELPVYEHSPE 338
           MDEVL KFPVVQHFWFG GFYPWIN  T + LP+YEHSPE
Sbjct: 326 MDEVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPE 365

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  421 bits (1082), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 201/332 (60%), Positives = 256/332 (77%), Gaps = 11/332 (3%)

Query: 13  LLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSE 72
           LL+ +   F LPVKRI+DSQ T  FQSS+A+ RL++F+ +YI+LV NV+IP   +SYVSE
Sbjct: 7   LLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPD--ESYVSE 64

Query: 73  ILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIP----- 127
           I  VN ++ L++ELS +V +TPP  GPRR+GNL+CR+WH K+++ L  LL K +      
Sbjct: 65  IPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQN 124

Query: 128 -SPDLQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPD-LTGKDLLI 185
            S   + S++EL+YY+ NSFGSSTRLDYGTGHELSF+A IA +DMLGL+ + + G DLLI
Sbjct: 125 ISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI 184

Query: 186 MFNAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW--LNNAPLTPKEITNS 243
           +FN YY L+++LILTYTLEPAGSHGVWGLDDHFH AYILGS+QW   NN PL P +I N 
Sbjct: 185 IFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNK 244

Query: 244 RLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVL 303
            LV +Y+  N+YC  I+F+  VKSGPF+EHSP+LYDIS SV  W KV+ GL+KMYM EVL
Sbjct: 245 DLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVL 304

Query: 304 NKFPVVQHFWFGTGFYPWINFQTLRELPVYEH 335
           NKFPVVQHFWFGTG +PWI+  T + LP+YE+
Sbjct: 305 NKFPVVQHFWFGTGLFPWIDNNTKKSLPLYEN 336

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  412 bits (1058), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 190/325 (58%), Positives = 249/325 (76%), Gaps = 8/325 (2%)

Query: 13  LLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSE 72
           +L  + T F+ PVKRIFDSQ T +FQ+S+A+ RL++F+Q+Y +++  V IP  P    S 
Sbjct: 3   MLTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGP----SR 58

Query: 73  ILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQ 132
           I +VN  + +LN +S +V  TPPL+GPRRYGNLACRDWH+KI+ ++P L  K +P     
Sbjct: 59  ISVVNEFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPD-RFH 117

Query: 133 PSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPD-LTGKDLLIMFNAYY 191
             I+EL +Y+ NSFGS+TRLDYGTGHELSF+A + A+DMLGLF D   G+D L++ NAYY
Sbjct: 118 HCIVELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYY 177

Query: 192 SLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLN--NAPLTPKEITNSRLVKDY 249
           ++VR+LILTYTLEPAGSHGVWGLDDHFHLAY+ GS+QW N   APL P++I N  LV++Y
Sbjct: 178 AVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEY 237

Query: 250 STKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVV 309
           +  NLYCQ I F+  VK GPF EHS +LYD++T+V  W K++ GL+KMY  EVLNKFPVV
Sbjct: 238 AHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVV 297

Query: 310 QHFWFGTGFYPWINFQTLRELPVYE 334
           QHFWFGTGFYPW++ QT ++L +Y+
Sbjct: 298 QHFWFGTGFYPWVDNQTGKQLLIYD 322

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  412 bits (1058), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 202/333 (60%), Positives = 252/333 (75%), Gaps = 15/333 (4%)

Query: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73
           +++K  +FSLP+KRI+DSQ+T  FQSSIA+ RL+++L +YI +V NVEIP    +YVSEI
Sbjct: 7   INIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDL--TYVSEI 64

Query: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPD--- 130
            +VN +  LL ELS  +   PP +GPRRYGNLACR+WHS I+ ++P LLEK +   +   
Sbjct: 65  TIVNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHAT 124

Query: 131 -------LQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPD-LTGKD 182
                  L+  IIELNYY+ NS GS+TRLDYGTGHELSF+A IAA+DMLGL+ +   G D
Sbjct: 125 EKGEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGVD 184

Query: 183 LLIMFNAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNA--PLTPKEI 240
           LL MF+ YY LV++LI+TYTLEPAGSHGVWGLDDHFHL+YILGSSQ   N   P +P +I
Sbjct: 185 LLHMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSDI 244

Query: 241 TNSRLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMD 300
            N ++V +Y  KN YC  I+F+  VKSGPF+EHSPILYDIST+V++W KV  GL+KMYM 
Sbjct: 245 INKKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMV 304

Query: 301 EVLNKFPVVQHFWFGTGFYPWINFQTLRELPVY 333
           EVLNKFPVVQHFWFG GFYPW N +T + L VY
Sbjct: 305 EVLNKFPVVQHFWFGEGFYPWKNVKTHKLLDVY 337

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  410 bits (1054), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 190/323 (58%), Positives = 243/323 (75%), Gaps = 5/323 (1%)

Query: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73
           +D     FS PVKRIFD+QTT DFQSS+A+ R+++ L +Y  L+++    P P +  S I
Sbjct: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCS-DPDPHATASSI 64

Query: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133
            MVN ++ +L++L+ ++ +TPPL GPRRYGNLACR+WH K++  LP+ L++ +PS +   
Sbjct: 65  AMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPS-EYHE 123

Query: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYYSL 193
            + EL YY+ NSFGSSTRLDYGTGHELSFMA +AALDMLG+FP + G D+ ++FN YY++
Sbjct: 124 VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYYTI 183

Query: 194 VRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWL---NNAPLTPKEITNSRLVKDYS 250
           +R LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      APL P+EI +  LV++Y 
Sbjct: 184 MRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYK 243

Query: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310
             N YCQ I F+  VK GPF EHSPILYDI+ +V  W KV +GL+KMY  EVL KFPVVQ
Sbjct: 244 DTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQ 303

Query: 311 HFWFGTGFYPWINFQTLRELPVY 333
           HFWFGTGF+PW+N Q   +LPV+
Sbjct: 304 HFWFGTGFFPWVNIQNGTDLPVF 326

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  408 bits (1049), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 190/328 (57%), Positives = 241/328 (73%), Gaps = 5/328 (1%)

Query: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73
           +D     FS PVKRIFD+QTTQDFQSS+A+ R+++ L +Y  L+++    P P +  S I
Sbjct: 6   VDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCA-DPDPHATASSI 64

Query: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133
            MVN ++ +L+  + ++ DTPPL GPRRYGNLACR+WH K++  L + L + +P+     
Sbjct: 65  PMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPA-QYHA 123

Query: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYYSL 193
            + EL YY+ NSFGSSTRLDYGTGHELSFMA +AALD+LGLFP L G D+ ++F+ YY++
Sbjct: 124 VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKYYAI 183

Query: 194 VRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWL---NNAPLTPKEITNSRLVKDYS 250
           +R LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      APL P+++ +  LV++Y 
Sbjct: 184 MRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQ 243

Query: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310
             N YCQ I F+  VK GPF EHSPILYDI+ +V  W KV +GL+KMY  EVL KFPVVQ
Sbjct: 244 DTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQ 303

Query: 311 HFWFGTGFYPWINFQTLRELPVYEHSPE 338
           HFWFGTGF+PWIN Q   +LPV+E   E
Sbjct: 304 HFWFGTGFFPWINVQNGTDLPVFEEKEE 331

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  405 bits (1042), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 189/326 (57%), Positives = 247/326 (75%), Gaps = 8/326 (2%)

Query: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73
           +D+  T F  PVK IFDSQ   DFQ S+A+ RL++ L++Y  ++    I   P    S I
Sbjct: 7   IDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEP----SGI 62

Query: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133
            +VN ++ LL+ LS +V +TPP  GPRRYGNLACRDWH K++  L +LL++ +P  D   
Sbjct: 63  EVVNRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQ-DYHK 121

Query: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF-PDLTGKDLLIMFNAYYS 192
            I EL+YY+ NSFGSSTRLDYGTGHELSF+A + ALDMLGL+  + +GKD+L++F+ YY 
Sbjct: 122 CIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYK 181

Query: 193 LVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNN--APLTPKEITNSRLVKDYS 250
           LVR+LILTYTLEPAGSHGVWGLDDHFH+ YILGSSQW ++   P+TP+++ N  LV+DY+
Sbjct: 182 LVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYA 241

Query: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310
             NLYCQ I+F+  VKSGPF+EHS +LYDI+++V  W KVQ GL+KMY  EVL KFPVVQ
Sbjct: 242 DTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQ 301

Query: 311 HFWFGTGFYPWINFQTLRELPVYEHS 336
           HFWFG GFYPWI+ +  ++LP+YE++
Sbjct: 302 HFWFGPGFYPWISDRNGQKLPIYENA 327

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  405 bits (1041), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 190/326 (58%), Positives = 244/326 (74%), Gaps = 9/326 (2%)

Query: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYV--S 71
           +D     FS PVKRIFD+QTT DFQSS+A+ R+++ L +Y  L+++    P PD++   S
Sbjct: 15  VDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHC---PDPDAHAASS 71

Query: 72  EILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDL 131
            I MVN ++ +L++L+ ++ +TPPL GPRRYGNLACR+WH K++  L + L++ +P+ + 
Sbjct: 72  SIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPA-EY 130

Query: 132 QPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYY 191
              + EL YY+ NSFGSSTRLDYGTGHELSFMA +AALD+LG+FP L G D+ ++FN YY
Sbjct: 131 HVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKYY 190

Query: 192 SLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWL---NNAPLTPKEITNSRLVKD 248
           +++R LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      APL P+E+ +  LV D
Sbjct: 191 TIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHD 250

Query: 249 YSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPV 308
           Y   N YCQ I F+  VK GPF EHSPILYDI+ +V  W KV +GL+KMY  EVL KFPV
Sbjct: 251 YKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPV 310

Query: 309 VQHFWFGTGFYPWINFQTLRELPVYE 334
           VQHFWFGTGF+PW+N Q   +LPV+E
Sbjct: 311 VQHFWFGTGFFPWVNIQNGTDLPVFE 336

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  403 bits (1035), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 188/323 (58%), Positives = 239/323 (73%), Gaps = 5/323 (1%)

Query: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73
           +D     FS PVKRIFD+QTT DFQSS+A+ R+++ L +Y  L+++    P P +  S I
Sbjct: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCA-DPDPQAVASSI 64

Query: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133
            M N ++ +L++L+ ++ +TPPL GPRRYGNLACR+WH K++  LP+ L + +P P+   
Sbjct: 65  PMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLP-PEYHV 123

Query: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYYSL 193
            + EL YY+ NSFGSSTRLDYGTGHELSFMA + ALD+LG+FP L G D+ ++FN YY++
Sbjct: 124 VVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKYYTI 183

Query: 194 VRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWL---NNAPLTPKEITNSRLVKDYS 250
           +R LILTYTLEPAGSHGVWGLDDHFHL YILGSSQW      APL P+EI +  LV++Y 
Sbjct: 184 MRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYK 243

Query: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310
             N YCQ I F+  VK GPF EHSPILYDI+ +V  W KV +GL+KMY  EVL KFPVVQ
Sbjct: 244 NTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQ 303

Query: 311 HFWFGTGFYPWINFQTLRELPVY 333
           HFWFGTGF+PW+N Q    LPV+
Sbjct: 304 HFWFGTGFFPWVNIQNGTNLPVF 326

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  390 bits (1001), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 187/348 (53%), Positives = 239/348 (68%), Gaps = 22/348 (6%)

Query: 10  PIYLLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSY 69
           PIY LD     FS P K+IFDSQ TQ F  SIA  R+++F+ +Y +L+    IPP    Y
Sbjct: 5   PIYKLDSNCV-FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPP--TDY 61

Query: 70  VSEILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSP 129
            S    ++ +  ++N+L  +V++TPPL GPRRYGNL+CR WH +++  + +L EK +   
Sbjct: 62  TSSNDTISGVSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTIS 121

Query: 130 DLQPS----IIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLI 185
           + + +     +EL YY   S GS TRLDYGTGHELSF+AFI ALDML L  D++G D+L 
Sbjct: 122 NTKFNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILF 181

Query: 186 MFNAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLN-------------- 231
           +FN YY L+R+LIL YTLEPAGSHGVWGLDDHFHL YI GSSQW                
Sbjct: 182 IFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPK 241

Query: 232 -NAPLTPKEITNSRLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKV 290
             AP+ P +I N  L++ + + N YCQ I F+LTVK+GPF EHSPIL+DI+ +V  W+KV
Sbjct: 242 FKAPIKPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKV 301

Query: 291 QRGLIKMYMDEVLNKFPVVQHFWFGTGFYPWINFQTLRELPVYEHSPE 338
           + GL+KMYM EVLNKFPVVQHFWFGTGFYPWIN  TL +LP YE +P+
Sbjct: 302 RSGLLKMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPD 349

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  385 bits (988), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 230/328 (70%), Gaps = 9/328 (2%)

Query: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73
           +D  +  F+ P KRIFDS+ +  FQSS+A+ RL+ +L +Y+  ++ V+IP    ++    
Sbjct: 6   IDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNH---- 61

Query: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133
             V S   LL  LS +V  TP L GPRRYGNLACR WH K++  L  LL K +P P    
Sbjct: 62  -EVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEP-CHK 119

Query: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF-PDLTGKDLLIMFNAYYS 192
           SI+EL YY+ N+FGS  RLDYGTGHELSF A I ALDMLG++  D    D+L +F+ YY+
Sbjct: 120 SIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYA 179

Query: 193 LVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNN--APLTPKEITNSRLVKDYS 250
           LVR+L+LTYTLEPAGSHGVWGLDDHFHL YI G+SQW++   AP+ P+E+ +  +V +Y+
Sbjct: 180 LVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYT 239

Query: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310
             N YCQ I F+  VKSGPF+EHSP+L+DIS SV  W KVQRGL+KMY  EVLNKFPVVQ
Sbjct: 240 KTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQ 299

Query: 311 HFWFGTGFYPWINFQTLRELPVYEHSPE 338
           HFWFGTG +PW +      LP YE S E
Sbjct: 300 HFWFGTGLFPWTSLGDGYALPTYEASQE 327

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  378 bits (971), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 235/328 (71%), Gaps = 9/328 (2%)

Query: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73
           +D+  T F+ PVK+IFD+Q TQDFQSS+ + RL+ +L +YI LV    IP       S  
Sbjct: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPS-----TSNN 64

Query: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133
             VN    +++ LS  + +TPPL GPRR+GN ACR WH K+   L  LL+  IP      
Sbjct: 65  DAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPE-KYHV 123

Query: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF-PDLTGKDLLIMFNAYYS 192
            I+E+ YY+ N+FGS  RLDYGTGHELSF+A ++A+DML L+  + +G+D+L +FN YY+
Sbjct: 124 CIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYT 183

Query: 193 LVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW--LNNAPLTPKEITNSRLVKDYS 250
           LV++LI TYTLEPAGSHGVWGLDDHFHLAYILGSSQ   +++ PL P +I +   V+DY+
Sbjct: 184 LVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYA 243

Query: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310
             NLY Q I F+  VKSG F+EHSP+LYDI+ +VS W KVQRGL+KMY  EVLNKFPVVQ
Sbjct: 244 KTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQ 303

Query: 311 HFWFGTGFYPWINFQTLRELPVYEHSPE 338
           HFWFGTGF+PW+N ++   LP YE + E
Sbjct: 304 HFWFGTGFFPWVNVKSGAILPTYEANQE 331

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  380 bits (975), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 184/328 (56%), Positives = 237/328 (72%), Gaps = 7/328 (2%)

Query: 13  LLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSE 72
           ++D  A+ FS+P KRIFDSQTTQ FQ S+A  RL++F  +YI LV  V   P P S    
Sbjct: 9   VVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGV---PLPVSRNIT 65

Query: 73  ILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAI---PSP 129
           + +   I+ LL++ S  + +TPPL  PRR+GNL+CR WH KI   LP  L+  I    + 
Sbjct: 66  MTITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTI 125

Query: 130 DLQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNA 189
           + +    ELNYY+ NSFGS TRLDYGTGHELSF+AFI+ +DM+ +  D+T  D L+++ +
Sbjct: 126 ENENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQS 185

Query: 190 YYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNN-APLTPKEITNSRLVKD 248
           YY+L R+LILTYTLEPAGSHGVWGLDDHFHLAYI GSSQ +++ + L PK+I    +V +
Sbjct: 186 YYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVAE 245

Query: 249 YSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPV 308
           +   NLYCQ I F+ TVK GPF EHSPILYDIS +V +W KV +GL+KMY DEVLNKFPV
Sbjct: 246 HKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPV 305

Query: 309 VQHFWFGTGFYPWINFQTLRELPVYEHS 336
           VQHFWFG GF+PW +  + ++LPV+EHS
Sbjct: 306 VQHFWFGDGFFPWKDNNSGKDLPVFEHS 333

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  375 bits (964), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 236/322 (73%), Gaps = 11/322 (3%)

Query: 21  FSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSII 80
           FS PVKRI+DSQ    FQSS A++RL   + +Y +LV + ++    D  +S ++     +
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVA---DLELSGVVGGVVKV 58

Query: 81  HLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPS--PDLQPSIIEL 138
             L+ L  +V +TPP+ GPRRYGN+ACRDWH KIE E+P LLE  I S  P     ++EL
Sbjct: 59  --LDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVEL 116

Query: 139 NYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYYSLVRELI 198
            YY+ANSFGS+TRLD+GTGHELSF+A +AALDMLG   D  G  +L +F+ YYSLV  LI
Sbjct: 117 RYYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFD--GDQVLYIFDRYYSLVHRLI 174

Query: 199 LTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLT--PKEITNSRLVKDYSTKNLYC 256
           L+YTLEPAGSHGVWGLDDHFHLAYILGSSQW N   L   P ++++  LV+ YS  N++C
Sbjct: 175 LSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFC 234

Query: 257 QCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWFGT 316
           + + FV TVKSG F EHSP+L+DIS SV  W KV++GL KMY DEVLNKFPV+QHFWFGT
Sbjct: 235 KTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGT 294

Query: 317 GFYPWINFQTLRELPVYEHSPE 338
           GFYPW++++  + LP YE+SP+
Sbjct: 295 GFYPWVDYKNGKPLPNYENSPD 316

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  372 bits (955), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 180/328 (54%), Positives = 231/328 (70%), Gaps = 9/328 (2%)

Query: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73
           +D+  T F+ PVKRIFDS+ T  FQSS+A+ RL+  L +Y+ +++   IP    +    +
Sbjct: 6   IDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSN--PNV 63

Query: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133
           + +  I+H  ++L   V +TP L GPRRYGNLACRDWH K+E ++ + L++ +P     P
Sbjct: 64  ISLRKILHFFSKL---VDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPE-KYYP 119

Query: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF-PDLTGKDLLIMFNAYYS 192
           SI+EL YY+ N+FGS  RLDYGTGHELSF + I ALDMLG++      KDLL +FN YYS
Sbjct: 120 SIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYS 179

Query: 193 LVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLN--NAPLTPKEITNSRLVKDYS 250
           LVR+LI  Y+LEPAGSHGVWGLDDHFHL YI G+SQW +  +A  +P+EI +  +V +Y+
Sbjct: 180 LVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYA 239

Query: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310
             N YCQ I F+  VKSGPF+EHSP+LYDIS SV  W KVQRGL+KMY  EVLNKFPVVQ
Sbjct: 240 GSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQ 299

Query: 311 HFWFGTGFYPWINFQTLRELPVYEHSPE 338
           HFWFGT  +PW +      LP YE S E
Sbjct: 300 HFWFGTALFPWTSTDGGDVLPTYEVSQE 327

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  362 bits (928), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 179/335 (53%), Positives = 231/335 (68%), Gaps = 19/335 (5%)

Query: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73
           ++L+ T FS PVKRIFDS  T DFQ S+ + RL+  L+RY+ LV N E+P      VS  
Sbjct: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPK-----VSTN 57

Query: 74  LMVNSIIHL-LNELSTIVQDTPPLKG-PRRYGNLACRDWHSKIEVELPKLLEKAIP---S 128
             V+S + + L+    ++ +TPP    PRR+GN+ACRDWH+K++ E+  L  + +P    
Sbjct: 58  GSVSSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERD 117

Query: 129 PDLQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFP------DLTGKD 182
              +  IIEL YY+ N+FGS  RLDYGTGHELSF+A + A+DMLGL+        LTG D
Sbjct: 118 AAYENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTD 177

Query: 183 LLIMFNAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLN---NAPLTPKE 239
           LL ++N YYS+V +LILTYTLEPAGSHGVWGLDDH HLAYI+G+SQW +   NAP+   +
Sbjct: 178 LLYLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSD 237

Query: 240 ITNSRLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYM 299
           I + + +  Y   NLYC  I FV+ VKSGPF++HSP+LYDIS +V  W K   GLIKMY 
Sbjct: 238 ILDMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQ 297

Query: 300 DEVLNKFPVVQHFWFGTGFYPWINFQTLRELPVYE 334
            EVLNKFPVVQHFWFGTGF+PW++ +    LP YE
Sbjct: 298 VEVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYE 332

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  355 bits (911), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 170/322 (52%), Positives = 228/322 (70%), Gaps = 7/322 (2%)

Query: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73
            D +   FS+P KRIFDSQ T DFQ+S+A+ R+++ LQ+YI L    +IP      + E 
Sbjct: 3   FDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIP----DTIKES 58

Query: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133
              N ++ LL  LS ++ +TPP +   RYGNL+ RDW +K + +L   L + +P      
Sbjct: 59  FFTNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPE-KYNN 117

Query: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYYSL 193
           SIIEL+YYI+N+FGS  R+DYGTGHELSF+A I  LDML +   + G  LL  FN+YY +
Sbjct: 118 SIIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI-ETIKGPALLYCFNSYYDV 176

Query: 194 VRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLN-NAPLTPKEITNSRLVKDYSTK 252
           +++LILTY LEPAGSHGVWGLDDHFH +YILG++Q L+ N  L PK+I+N+RL++  S+ 
Sbjct: 177 IQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDISNTRLMEQNSSS 236

Query: 253 NLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHF 312
           NL+C+ I F+  VKSGPF+ HSP+LY+IS SV  W K+Q+GLIKMY  EVLNKFPVVQHF
Sbjct: 237 NLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHF 296

Query: 313 WFGTGFYPWINFQTLRELPVYE 334
           WFGT F+PW ++     LP+Y+
Sbjct: 297 WFGTAFFPWTSYGNNHSLPIYQ 318

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  350 bits (897), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 173/328 (52%), Positives = 224/328 (68%), Gaps = 11/328 (3%)

Query: 16  LKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILM 75
           ++ T FS PVKRIFD+  T DFQ S+ + RL+  L+RY++LV   +IP       S+   
Sbjct: 5   VEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKS-----SQNRA 59

Query: 76  VNSIIHLLNELSTIVQDTPPLKG-PRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPS 134
           V   + +L  L  ++ +TPP  G  RR+G+LACRDWH +++ EL  LLE  +P    + S
Sbjct: 60  VVRFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEA-ARRS 118

Query: 135 IIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPD--LTGKDLLIMFNAYYS 192
             EL YY+ ++FGS  RLDYGTGHEL+F+A + ALDMLGL+ +   TG+D+L ++  YY+
Sbjct: 119 AAELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYA 178

Query: 193 LVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLN--NAPLTPKEITNSRLVKDYS 250
           LV  LILTY LEPAGSHGVWGLDDH HLAYILG+SQW    N P+ P +I + + V  YS
Sbjct: 179 LVHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYS 238

Query: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310
             NLYC  I F+L VK+G FA+HSP+L+DI+ +V  W KV  GLIKMY  EVLNKFPVVQ
Sbjct: 239 ETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQ 298

Query: 311 HFWFGTGFYPWINFQTLRELPVYEHSPE 338
           HFWFGTGF+PW++      LP YE   E
Sbjct: 299 HFWFGTGFFPWVDMAHGMSLPNYEAPSE 326

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  334 bits (856), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 220/327 (67%), Gaps = 10/327 (3%)

Query: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73
           LD++   F  P KRIFDSQTT  FQ S+AL R+RF +++Y+ ++         D+     
Sbjct: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG-------DTSGGIS 68

Query: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133
             V  ++ +L+ L  +V +TPPL GPRRYGNLACRDWH K++  LP L  + +       
Sbjct: 69  ASVARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQ-VDCLAGGG 127

Query: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYYSL 193
           + IE  YY+ NSFGS  RLDYGTGHELSF+AF+AALDM+     +T  +L  +++ YY L
Sbjct: 128 ACIEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRL 187

Query: 194 VRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNN-APLTPKEITNSRL-VKDYST 251
           VR LI+ Y LEPAGSHGVWGLDDHFHLAY+ G+SQ+ NN   + P+++ +  +  +D + 
Sbjct: 188 VRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVIPGRDDAP 247

Query: 252 KNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQH 311
            N   + I FV +VK GPF E+SP+L DI + VS+WRK+QRGL +MY  EVLNKFPVVQH
Sbjct: 248 ANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307

Query: 312 FWFGTGFYPWINFQTLRELPVYEHSPE 338
           FWFGT F+PW + +    LPVYE S +
Sbjct: 308 FWFGTAFFPWTSVRDGTPLPVYEQSAD 334

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  174 bits (440), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 107/298 (35%), Positives = 159/298 (53%), Gaps = 10/298 (3%)

Query: 24  PVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSIIHLL 83
           P KR+        +  S     L  FL    E V  +E   +     S I    S   LL
Sbjct: 3   PQKRLLTQDDMDIWSHSETFNNLISFLSGLAESVKGLENNEYQKPTGSSI---ESCCQLL 59

Query: 84  NELSTIVQDTPPLKGPR--RYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIELNYY 141
            E++++ +  P  +     R+G +  R ++  ++ +   L+++A  + D      EL+ Y
Sbjct: 60  EEVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAFDALD-GTQCEELSVY 118

Query: 142 IANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF--PDLTGKDLLIMFNAYYSLVRELIL 199
            A S+G  +R+DYG+GHEL+F+ F+  L   G+F  P      +L +F  Y  ++R L  
Sbjct: 119 FAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVLKLFIKYLGVMRTLET 178

Query: 200 TYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLYCQCI 259
            Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L PK I NS +V+ +  + LY  CI
Sbjct: 179 KYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPKSIHNSEVVEMFGKRYLYFGCI 238

Query: 260 EFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWFGT 316
           +F+  VK +     HSP+L DIS  V  W KV  G+IKMY  EVLNK P++QHF+FG+
Sbjct: 239 DFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLNKLPIMQHFFFGS 295

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  171 bits (434), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 160/300 (53%), Gaps = 14/300 (4%)

Query: 24  PVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSIIHLL 83
           P KR+  SQ  + +       +L  F+    E V  +E   + +   + I   +    LL
Sbjct: 3   PQKRLLTSQDIETWVDCATFDQLIEFISELAESVKGLENNQYQEPIGASI---DKCCSLL 59

Query: 84  NELSTIVQDTPPLKGPR--RYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIELNYY 141
           +E+ +I +  P  +     R+G +  R ++  + ++   L+ K       Q    EL  Y
Sbjct: 60  DEVFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFDQLS-QDQAEELVAY 118

Query: 142 IANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKD----LLIMFNAYYSLVREL 197
              S+G   R+DYG+GHEL+F+ F+  L   GLF     +D    +L +F  Y  L+R L
Sbjct: 119 FVESWGDRERIDYGSGHELNFICFLYGLKDCGLFE--RSRDYRNLVLKVFIHYLELMRVL 176

Query: 198 ILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLYCQ 257
             TY LEPAGSHGVWGLDD+  L ++ G+SQ   +  L PK I N+ LV  ++++ LY  
Sbjct: 177 ETTYWLEPAGSHGVWGLDDYHFLPFLFGASQLAPHKHLKPKSIHNNELVDMFASRYLYFG 236

Query: 258 CIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWFGT 316
           CI+F+  VK +     HSP+L DIS + S W KV  G+IKMY  EVL K P++QHF FG+
Sbjct: 237 CIDFINRVKTTASLRWHSPMLDDISGAKS-WSKVAEGMIKMYRKEVLAKLPIMQHFLFGS 295

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  171 bits (434), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 114/303 (37%), Positives = 167/303 (55%), Gaps = 14/303 (4%)

Query: 23  LPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSIIHL 82
           LP KR+  +   + +  S     L  FL+   +L  +VE   + D  +     V S++ L
Sbjct: 2   LPQKRLLTNADMEIWDRSQTQADLLNFLK---QLAKSVEGKENTDYTLPISQPVESMMKL 58

Query: 83  LNELSTIVQDTPPLKGPR--RYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIELNY 140
           L+++ +I+   P +K     R+G +  RD++  +  +   LL++  PS  L  S IE  Y
Sbjct: 59  LHKVQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPS--LTDSQIEQLY 116

Query: 141 -YIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFP---DLTGKDLLIMFNAYYSLVRE 196
            Y+  S+G+  R+DYG+GHEL+FM FI  L    +F    D T   +L +F  Y  L+R 
Sbjct: 117 VYVDESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNL-VLKVFIQYLKLMRV 175

Query: 197 LILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLYC 256
           L L Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L P  I N  L++ ++ K LY 
Sbjct: 176 LELQYWLEPAGSHGVWGLDDYHFLPFLFGAYQLSTHKHLKPSSIHNDDLIEMFADKYLYF 235

Query: 257 QCIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWFG 315
            CIEF+ +VK +     HSP+L DIS  V  W KV  G+ KMY  EV+ K P++QHF+F 
Sbjct: 236 GCIEFINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPIMQHFYFN 294

Query: 316 TGF 318
             F
Sbjct: 295 DMF 297

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  171 bits (433), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/300 (36%), Positives = 167/300 (55%), Gaps = 16/300 (5%)

Query: 23  LPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVE----IPPHPDSYVSEILMVNS 78
           +P KRI   +  + ++ S   + +  F++   + V   E      P  DS  S I ++  
Sbjct: 2   IPSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVSEPVSDSVQSTIAVLTE 61

Query: 79  IIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIEL 138
           I  L+ +L  ++QD    K   R+G +  RD++  +  +   LL    P+   +  I +L
Sbjct: 62  IDKLI-KLHPVIQD----KNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTSE-QIEQL 115

Query: 139 NYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLT--GKDL-LIMFNAYYSLVR 195
           + Y+  S+G+  R+DYG+GHEL+F+ F+  L    +F DL    ++L L++F  Y  ++R
Sbjct: 116 SIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIF-DLQRDARNLVLVLFIEYLKIMR 174

Query: 196 ELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLY 255
           E+   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L PK I N  LV+ ++ K LY
Sbjct: 175 EIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHKHLKPKSIHNEELVEMFADKYLY 234

Query: 256 CQCIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWF 314
             CI F+ +VK S     HSP+L DIS  V  W KV  G+IKMY  EVL K P++QHF+F
Sbjct: 235 FGCIAFINSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPIMQHFYF 293

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  169 bits (429), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 162/298 (54%), Gaps = 13/298 (4%)

Query: 23  LPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSIIHL 82
           LP KR+      Q +Q+      L  FL    + V  +E   +       I  V ++I  
Sbjct: 3   LPEKRLLTKDDMQLWQNCQTKSDLLKFLCELADAVKGLENSQYSQPIGGSIQSVEALIEC 62

Query: 83  LNELSTIVQDTP-PLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPS-PDLQPSIIELNY 140
           +++    +++ P    GP R+G    RD +  I      L+++   S  D Q  + +L+ 
Sbjct: 63  VDQ---CIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLTDEQ--VAQLSV 117

Query: 141 YIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKD---LLIMFNAYYSLVREL 197
           Y   S+G  +R+DYG+GHEL+F+ F+  L   G+F DL   +   +LI+F  Y   +R +
Sbjct: 118 YFNESWGDKSRIDYGSGHELNFLCFLYGLYRCGVF-DLAKDNRNLVLIVFMKYLKTMRVI 176

Query: 198 ILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLYCQ 257
              Y LEPAGSHGVWGLDD+  L ++ G+SQ   +  L PK I N  +V+ +S K LY  
Sbjct: 177 ETVYWLEPAGSHGVWGLDDYHFLPFLFGASQLSTHRHLKPKSIHNPEVVEMFSEKYLYFG 236

Query: 258 CIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWF 314
           CI+F+ +VK +     HSP+L DIS  V  W KV +G++KMY  EVL K P++QHF+F
Sbjct: 237 CIDFINSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEVLCKLPIMQHFYF 293

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  169 bits (429), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 163/302 (53%), Gaps = 16/302 (5%)

Query: 22  SLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI-LMVNSII 80
           ++P KR+   +    ++SS      R  L  +IE +A+       + Y   I   V +++
Sbjct: 4   AMPCKRLLMKRDLDLWESS----ETRAHLVHFIEQLADAVRGRENEQYDLPISASVEALM 59

Query: 81  HLLNELSTIVQDTPPLKG---PRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIE 137
            LL ++  +++  P  K      R+G +  RD++ ++  E   L+  A P    Q  + +
Sbjct: 60  GLLQQVRGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQL-TQNQVRQ 118

Query: 138 LNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKD----LLIMFNAYYSL 193
           L  Y+  S+G   R+DYG+GHEL+FM F+  L    +F DL G D    +L  F  Y  +
Sbjct: 119 LQTYLEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVF-DLGGTDRANLVLKPFIEYLKI 177

Query: 194 VRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKN 253
           +R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L P  I N  +V+ ++ K 
Sbjct: 178 MRVLETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPLSIHNEEVVELFADKY 237

Query: 254 LYCQCIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHF 312
           LY  CI F+ +VK +     HSP+L DIS  V  W KV  G++KMY  EVL+K P++QHF
Sbjct: 238 LYFGCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVLSKLPIMQHF 296

Query: 313 WF 314
           +F
Sbjct: 297 YF 298

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  169 bits (428), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 108/301 (35%), Positives = 166/301 (55%), Gaps = 18/301 (5%)

Query: 23  LPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEIL--MVNSII 80
           LP KR+      + +++S   + L  F+    E V   E     +S +SE +   +N++ 
Sbjct: 2   LPEKRLLTEDDMKLWEASSTKKELLDFISTLAEAVKGCE-----NSQISEPISPAINTLE 56

Query: 81  HLLNELSTIVQDTPPLKGPR--RYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIEL 138
            +L  +  I+   P L+     R+G    R ++ +I     KL+ +  PS      + +L
Sbjct: 57  QILVSIDKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSL-THEQLEQL 115

Query: 139 NYYIANSFGSSTRLDYGTGHELSFMAFIAAL---DMLGLFPDLTGKDL-LIMFNAYYSLV 194
             Y+  S+G+  R+DYG+GHEL+FM F+  L   D+L L  D+  +++ LI+F  Y  ++
Sbjct: 116 TIYLDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKL--DIDARNMVLIIFIKYLDIM 173

Query: 195 RELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNL 254
           R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L P  I N  LV+ ++ K L
Sbjct: 174 RSLETKYWLEPAGSHGVWGLDDYHFLPFLFGAYQLATHKHLKPLSIHNEELVEMFAKKYL 233

Query: 255 YCQCIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFW 313
           Y  CI F+ +VK +     HSP+L DIS  V  W KV  G++KMY  EVL+K P++QHF+
Sbjct: 234 YFGCIAFINSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSKLPIMQHFY 292

Query: 314 F 314
           F
Sbjct: 293 F 293

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  169 bits (427), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 162/298 (54%), Gaps = 11/298 (3%)

Query: 22  SLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSIIH 81
           S P KR+      + + SS   + L  F+    E V + +     +   +E   V+S + 
Sbjct: 3   SCPQKRLLTKDDMEIWDSSQTKKELINFITDLAEAVKDRDNTQFKEPISAE---VSSTLA 59

Query: 82  LLNELSTIVQDTPPLKGP-RRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIELNY 140
           LL+ + ++V + P L     R+G    R ++  ++     LL KA  +      I +L+ 
Sbjct: 60  LLDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTN-QIEQLSI 118

Query: 141 YIANSFGSSTRLDYGTGHELSFMAFIAAL---DMLGLFPDLTGKDLLIMFNAYYSLVREL 197
           Y   S+G+  R+DYG+GHEL+F+ F+  L   D+  L  D T   ++++F  Y  ++R L
Sbjct: 119 YFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNI-VILVFVKYLKIMRRL 177

Query: 198 ILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLYCQ 257
              Y LEPAGSHGVWGLDD+  L ++ G+ Q  N+  L PK I N  +V  +  K LY  
Sbjct: 178 ETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSNHKHLKPKSIHNDEIVDMFKDKYLYFG 237

Query: 258 CIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWF 314
           CI F+ +VK +     HSP+L DIS  V  W KV  G+IKMY+ EVL+K PV+QHF+F
Sbjct: 238 CIAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLPVMQHFYF 294

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  167 bits (422), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 168/300 (56%), Gaps = 16/300 (5%)

Query: 23  LPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILM--VNSII 80
           LP KR+      + ++ S        F+   I+L  +V+   H +S   E +   +NS++
Sbjct: 2   LPEKRLLTPDDMKLWEESPTRAHFTKFI---IDLAESVK--GHENSQYKEPISESINSMM 56

Query: 81  HLLNELSTIVQDTPPLKGP--RRYGNLACRDWHSKIEVELPKLLEKAIPS-PDLQPSIIE 137
           +LL+++  I Q  P +K     R+G +  RD++ ++     K+L    PS  D Q  + +
Sbjct: 57  NLLSQIKDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQ--LEQ 114

Query: 138 LNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF--PDLTGKDLLIMFNAYYSLVR 195
           L+ Y+  S+G+  R+DYG+GHEL+FM  +  L   G+F   + +   +L +F  Y  ++R
Sbjct: 115 LSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMR 174

Query: 196 ELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLY 255
            L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L P  I N+ LV+ ++ + LY
Sbjct: 175 ILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEMFAHRYLY 234

Query: 256 CQCIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWF 314
             CI F+  VK S     HSP+L DIS  V  W KV  G+IKMY  EVL+K P++QHF+F
Sbjct: 235 FGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYF 293

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  167 bits (422), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 158/295 (53%), Gaps = 9/295 (3%)

Query: 26  KRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSIIHLLNE 85
           KR+      Q + +S   + +  F+ +  E V   E   +     S+I    ++  LL+ 
Sbjct: 5   KRLLTEDDLQKWLNSETYESVVSFVTQLGEAVNGKENAAYEQPISSQI---ENLCALLDT 61

Query: 86  LSTIVQDTPPL--KGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIELNYYIA 143
           ++ IV   P +  KG  R+G +  RD++ ++  E  K L  ++ S      + EL  Y  
Sbjct: 62  VAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVR-ETTKELISSLSSELTDEQVEELAVYFT 120

Query: 144 NSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLI-MFNAYYSLVRELILTYT 202
            S+G   R+DYG+GHEL+F+ F+  L    +  D    +L++ +F  Y  ++R L   Y 
Sbjct: 121 ESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLKVFIKYLDVMRLLETKYW 180

Query: 203 LEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLYCQCIEFV 262
           LEPAGSHGVWGLDD+  L ++ G+ Q   +  L PK I N  +V+ +  + +Y +C+ F+
Sbjct: 181 LEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPKSIHNPEIVEVFEKRYMYFECVAFI 240

Query: 263 LTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWFGT 316
             VK +     HSP+L DIS  V  W KV  G++KMY  EVL K P++QHF+F T
Sbjct: 241 NKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKAEVLGKLPIMQHFFFST 294

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  166 bits (421), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 108/301 (35%), Positives = 169/301 (56%), Gaps = 18/301 (5%)

Query: 23  LPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILM--VNSII 80
           +P KRI      + +++S   + L  F+    E V       H +S + E +   + S+ 
Sbjct: 2   VPEKRILTENDMEVWKNSATRKDLLNFISTLAESVEG-----HENSQIVEPISPSIASLS 56

Query: 81  HLLNELSTIVQDTPPLKGPR--RYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIEL 138
            LL+E++ +V   P +K  +  R+G +  RD++ ++  +   L++    +      + +L
Sbjct: 57  SLLDEVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFSTLS-DEQLEQL 115

Query: 139 NYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKD----LLIMFNAYYSLV 194
           + Y+  S+G+  R+DYG+GHEL+F+ F+  L   GLF DL  KD    +L++F  Y +++
Sbjct: 116 SIYLDESWGNKRRIDYGSGHELNFICFLFGLYSYGLF-DLE-KDAINLVLVVFLKYLNIM 173

Query: 195 RELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNL 254
           R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q + +  L P  I N  LV+ +  K L
Sbjct: 174 RVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLVPHKHLKPMSIHNEELVELFKDKFL 233

Query: 255 YCQCIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFW 313
           Y  CI F+ +VK +     HSP+L DIS  V  W KV  G+IKMY  EVL K P++QHF+
Sbjct: 234 YFGCISFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEVLGKLPIMQHFY 292

Query: 314 F 314
           F
Sbjct: 293 F 293

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  166 bits (420), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 155/295 (52%), Gaps = 13/295 (4%)

Query: 26  KRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSIIHLLNE 85
           KR+        +++S   + L  F+    + V   E   H +     I  + +   LL E
Sbjct: 13  KRLLTGSDLDKWKASKTFEELLRFVSSLAQSVRGRENSEHAEPVSPAIEALEA---LLEE 69

Query: 86  LSTIVQDTPPLK--GPRRYGNLACRDWHSKIEVELPKLLEKAIPS-PDLQPSIIELNYYI 142
           +  I    P L+     R+G +  RD+H +++     L+ +  PS  D Q    EL  Y+
Sbjct: 70  MQGIAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALVLQVDPSLTDEQAQ--ELAVYL 127

Query: 143 ANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFP--DLTGKDLLIMFNAYYSLVRELILT 200
            N++G   R+DYG+GHEL+F+ F+  L   G+    D T   +L +F  Y  ++R L   
Sbjct: 128 GNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTNA-VLRVFVKYMDVMRVLETK 186

Query: 201 YTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLYCQCIE 260
           Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L PK I N  +V+ +  + LY  CI 
Sbjct: 187 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLKPKSIHNPEVVELFENRYLYFGCIA 246

Query: 261 FVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWF 314
           F+  VK +     HSP+L DIS  V +W KV  G++KMY  EVL K P++QHF+F
Sbjct: 247 FINRVKTTASLRWHSPMLDDIS-GVRSWTKVSEGMVKMYKAEVLGKLPIMQHFFF 300

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  166 bits (420), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/306 (36%), Positives = 173/306 (56%), Gaps = 17/306 (5%)

Query: 23  LPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILM--VNSII 80
           LP KR+  S   + ++ S   Q    F +  I+L  +V+   H +S   E +   ++ ++
Sbjct: 2   LPEKRLLTSGDMKLWEES---QTRANFTKFIIDLAESVK--GHENSQYEEPVSEPISRMM 56

Query: 81  HLLNELSTIVQDTPPLKGPR--RYGNLACRDWHSKIEVELPKLLEKAIPS-PDLQPSIIE 137
           +LL+ +  I+Q  P +K     R+G +  RD++ ++     K L    PS  D Q  + +
Sbjct: 57  NLLSYIRDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLRSEFPSLTDEQ--LEQ 114

Query: 138 LNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF--PDLTGKDLLIMFNAYYSLVR 195
           L+ Y+  S+G+  R+DYG+GHEL+FM  +  L   G+F   + +   +L +F  Y  ++R
Sbjct: 115 LSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLKIMR 174

Query: 196 ELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLY 255
            L   Y LEPAGSHGVWGLDD+  L ++ G+ Q  ++  L P  I N+ LV+ ++ + LY
Sbjct: 175 ILETRYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTSHKHLKPISIHNNELVEMFANRYLY 234

Query: 256 CQCIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWF 314
             CI+F+  VK S     HSP+L DIS  V  W KV  G+IKMY  EVL+K P++QHF+F
Sbjct: 235 FGCIDFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF 293

Query: 315 GTGFYP 320
            + F P
Sbjct: 294 -SDFLP 298

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  164 bits (416), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 107/299 (35%), Positives = 166/299 (55%), Gaps = 14/299 (4%)

Query: 23  LPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEIL--MVNSII 80
           LP KR+  +   + ++ S   Q    F +  IEL  +V+   H +    E +   + S++
Sbjct: 2   LPEKRLLTAGDMKLWEES---QTRADFTKFIIELAESVK--GHENYQFKEPISEQIISMM 56

Query: 81  HLLNELSTIVQDTPPLKGP--RRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIEL 138
           +LL+++  I+Q  P ++     R+G +  RD++ ++     KLL    P       + +L
Sbjct: 57  NLLSQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRSEFPHL-TDEQLEQL 115

Query: 139 NYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF--PDLTGKDLLIMFNAYYSLVRE 196
           + Y+  S+G+  R+DYG+GHEL+FM  +  L   G+F   D +   +L +F  Y  ++R 
Sbjct: 116 SIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQIMRI 175

Query: 197 LILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLYC 256
           L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L P  I N+ LV+ ++ + LY 
Sbjct: 176 LETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEMFAHRYLYF 235

Query: 257 QCIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWF 314
            CI F+  VK S     HSP+L DIS  V  W KV  G+IKMY  EVL+K P++QHF+F
Sbjct: 236 GCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLSKLPIMQHFYF 293

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  164 bits (415), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 100/298 (33%), Positives = 164/298 (55%), Gaps = 10/298 (3%)

Query: 23  LPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSIIHL 82
           +P KR+  ++  + +  S  +  L  F+    + V   E   + +    ++      + L
Sbjct: 2   IPEKRLTTNKDMKIWMDSTTMDSLVEFVTILADSVRGRENTAYKEPISKDM---EPTMQL 58

Query: 83  LNELSTIVQDTPPLKGPR--RYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIELNY 140
           L +++ ++   P ++     R+G +  RD++  ++    +L+    PS + +  + EL  
Sbjct: 59  LKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSLN-KDQVEELAV 117

Query: 141 YIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFP-DLTGKDLLI-MFNAYYSLVRELI 198
           Y+  S+G+  R+DYG+GHEL+F+ FI  L +  +F  +    DL++ +F  Y  ++R L 
Sbjct: 118 YLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRIMRILE 177

Query: 199 LTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLYCQC 258
             Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L PK I N  +V+ +  K +Y  C
Sbjct: 178 TKYWLEPAGSHGVWGLDDYHFLPFLFGAHQLATHPHLRPKSIHNEEVVEMFMDKYIYFGC 237

Query: 259 IEFVLTVKS-GPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWFG 315
           I F+ +VKS      HSP+L DIS  V  W KV  G+IKMY  EVL+K P++QHF+FG
Sbjct: 238 IAFINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKLPIMQHFYFG 294

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  163 bits (413), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 106/305 (34%), Positives = 163/305 (53%), Gaps = 24/305 (7%)

Query: 23  LPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVE-------IPPHPDSYVSEILM 75
           +P KR+   +  + +  S     L  F+++  + V   E       I P  +S++  +  
Sbjct: 2   IPEKRLLTPEDLELWDKSQTKHDLLEFIEKLAKSVEGHENKQYQEPITPQIESFMGLLKS 61

Query: 76  VNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSI 135
           VN+II    +   +VQD        R+G +  RD++ ++  +   L+  A PS   +  +
Sbjct: 62  VNNII----DKHPVVQDAKS----SRFGKIEFRDFYDELTSQSKTLISNAYPSL-TEDQL 112

Query: 136 IELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKD----LLIMFNAYY 191
            +L  Y+  S+G+  R+DYG+GHEL+F+  +  L    +F +   KD    +L +F  Y 
Sbjct: 113 DQLYVYLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDE--SKDFTNMVLKIFIEYL 170

Query: 192 SLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYST 251
            ++R L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L P  I N  LV+ +  
Sbjct: 171 RVMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLKPLSIHNEELVEMFQD 230

Query: 252 KNLYCQCIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310
           K LY  C+ F+ +VK S     HSP+L DIS  V  W KV  G+IKMY  EVL+K P++Q
Sbjct: 231 KYLYFSCVAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKLPIMQ 289

Query: 311 HFWFG 315
           HF+FG
Sbjct: 290 HFYFG 294

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  162 bits (411), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 166/299 (55%), Gaps = 14/299 (4%)

Query: 23  LPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEIL--MVNSII 80
           LP KR+  ++  + ++ S   Q    F +  I+L  +VE   H +S   E +   +  ++
Sbjct: 2   LPEKRLLTAEDMKLWEKS---QTRADFTKFVIDLAKSVE--GHENSQYKEPVSEQITRML 56

Query: 81  HLLNELSTIVQDTPPLKG--PRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIEL 138
            LL+ +  I++  P +      R+G +  RD++ ++     KLL K+  S      + +L
Sbjct: 57  SLLSRVRDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLL-KSEFSLLTDEQLEQL 115

Query: 139 NYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF--PDLTGKDLLIMFNAYYSLVRE 196
           + Y+  S+G+  R+DYG+GHEL+FM  +  L   G+F   + +   +L +F  Y  ++R 
Sbjct: 116 SIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEYLDIMRV 175

Query: 197 LILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLYC 256
           L   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L P  I NS LV+ +S + LY 
Sbjct: 176 LETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNSELVEMFSDRYLYF 235

Query: 257 QCIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWF 314
            CI F+  VK S     HSP+L DIS  V  W KV  G+IKMY  EVL+K P++QHF+F
Sbjct: 236 GCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF 293

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  162 bits (410), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 157/299 (52%), Gaps = 14/299 (4%)

Query: 24  PVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILMVNSIIHLL 83
           P KR+      + +  S     L  F+ +  E V   E   + +   S I   + +  LL
Sbjct: 3   PQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRENTQYVEPISSSI---DELCSLL 59

Query: 84  NELSTIVQDTPPLKGPR--RYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSIIELNYY 141
           ++++ +V   P ++     R+G +  RD++  +       +  ++      P + EL  Y
Sbjct: 60  DKVNKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRS-SEMISSLSDKLSTPQVDELAAY 118

Query: 142 IANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKD----LLIMFNAYYSLVREL 197
              S+G+ TR+DYG+GHEL+F+ F+  L+    F DL  KD    +L +F  Y  ++R L
Sbjct: 119 FRKSWGNRTRIDYGSGHELNFICFLYGLNKCNFF-DLE-KDATNVVLRVFIKYLDVMRTL 176

Query: 198 ILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLYCQ 257
              Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L PK I N   V+ +  + LY  
Sbjct: 177 ETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLKPKSIHNKEFVEMFEKRYLYFG 236

Query: 258 CIEFVLTVKSG-PFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWFG 315
           CI F+ +VK+      HSP+L DIS  V  W KV  G++KMY  EVL K P++QHF+FG
Sbjct: 237 CIGFINSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLPIMQHFYFG 294

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  161 bits (408), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 142/249 (57%), Gaps = 12/249 (4%)

Query: 76  VNSIIHLLNELSTIVQDTPPLKGPR--RYGNLACRDWHSKIEVELPKLLEK---AIPSPD 130
           V  + +LL++++ I+     +K     R+G +  RD++  I     +L+ K    I  PD
Sbjct: 51  VQRVSNLLSKVTEIIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNELISKIFEGIEKPD 110

Query: 131 LQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKD---LLIMF 187
               + ++  Y  NS+G  +R+DYG+GHEL+F+ F+  L    +F DL       +L++F
Sbjct: 111 -TGKLDDICTYFINSWGDRSRIDYGSGHELNFICFLYCLTESKVF-DLENDSSNIVLMLF 168

Query: 188 NAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVK 247
             Y  ++R L L Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L PK I N  +V+
Sbjct: 169 IKYLGIMRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPKSIHNPEVVE 228

Query: 248 DYSTKNLYCQCIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKF 306
            +  + LY  CI F+  VK +     HSP+L DIS  V  W KV  G++KMY  EVL K 
Sbjct: 229 MFQDRYLYFGCIAFINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYKAEVLQKL 287

Query: 307 PVVQHFWFG 315
           P++QHF+FG
Sbjct: 288 PIMQHFYFG 296

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  157 bits (396), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 107/307 (34%), Positives = 164/307 (53%), Gaps = 17/307 (5%)

Query: 23  LPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILM--VNSII 80
           +P KR+  SQ    + +S   Q L  F    IE +AN  I  + +S +S  L   +N+  
Sbjct: 1   MPEKRLLSSQDLTIWINSKTKQDLVDF----IETLAN-SIVDYQNSQLSLPLSDSINNAF 55

Query: 81  HLLNELSTIVQDTPPLKG----PRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPSII 136
            LL ++  I++  P          R+G +  + ++  I     KL++      D    I 
Sbjct: 56  SLLQDIRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLIKSHFNGLDPN-QIQ 114

Query: 137 ELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIM--FNAYYSLV 194
           EL+ Y+  S+G+  R+DYG+GHEL+F+ F+  L    +F  L     L++  F  Y +++
Sbjct: 115 ELSIYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNLVLKIFMEYINIM 174

Query: 195 RELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNNAPLTPKEITNSRLVKDYSTKNL 254
           R +   Y LEPAGSHGVWGLDD+  L ++ G+ Q   +  L P  I N  +V+ +  K +
Sbjct: 175 RIIETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSKHKHLKPISIHNEEMVEMFKDKYM 234

Query: 255 YCQCIEFVLTVK-SGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQHFW 313
           Y  CI+F+ ++K +     HSP+L DIS  V  W KV  G+IKMY  EVL K P++QHF+
Sbjct: 235 YFGCIDFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSEGMIKMYSAEVLGKLPIMQHFY 293

Query: 314 FGTGFYP 320
           F + F P
Sbjct: 294 F-SDFLP 299

>ADL177C Chr4 complement(383367..386084) [2718 bp, 905 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL313C
          Length = 905

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 65  HPDSYVSEILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEK 124
           +PD  ++E +  NS +    EL    +   P++G    G+L C+DW  K    +  LL K
Sbjct: 826 NPDLEINEGVW-NSTVDTCEELVAAYESLGPMEGKHGAGDLVCKDWKYKARSTIKSLLNK 884

Query: 125 A 125
            
Sbjct: 885 G 885

>TPHA0G00950 Chr7 complement(183625..184767) [1143 bp, 380 aa] {ON}
           Anc_2.322 YDL115C
          Length = 380

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/131 (20%), Positives = 52/131 (39%), Gaps = 12/131 (9%)

Query: 53  YIELVANVEIPPHPDSYVSEILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHS 112
           ++E +   EIPP  D+ +  + +VN  + L+N+  +  +D  P+       N    D+  
Sbjct: 157 HLEPLNEKEIPP--DTKLGHVKIVNIDVELINDEKSDTEDQFPIDDDSNSENFYRNDYPE 214

Query: 113 KIEVELPKLLEKAIPSPDLQPSIIELNYYIANSFGSSTRLDYGTGHELS----------F 162
             + +   L    +   +++  I  LN Y    F    +  Y   +E+           F
Sbjct: 215 DEDDDRSILFGSDVDYKEIESEIKYLNEYRKQDFDPEEQYGYDDANEVINVMKDDFSDLF 274

Query: 163 MAFIAALDMLG 173
             F A+ D+L 
Sbjct: 275 DKFGASADILN 285

>NCAS0F03780 Chr6 complement(760976..763699) [2724 bp, 907 aa] {ON}
           Anc_3.523 YER033C
          Length = 907

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 5/107 (4%)

Query: 20  NFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYV----SEILM 75
           +  L +  I D  T+ ++  ++ +      + +    +A   IP  P SYV    SE   
Sbjct: 588 DLKLSLNAIKDINTSANYIKNVKVDDYDAGVDQSARSLAYYGIPKTPSSYVLSPLSESNN 647

Query: 76  VNSIIHLLNE-LSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKL 121
             + I++L++   T +  TPPL  P R  +L   D +S ++ E+P L
Sbjct: 648 SKTPINMLHQSFPTSLSYTPPLPPPARSQSLKYHDLNSNLDAEVPGL 694

>Kpol_1002.63 s1002 complement(172616..173452) [837 bp, 278 aa] {ON}
           complement(172616..173452) [837 nt, 279 aa]
          Length = 278

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 4/47 (8%)

Query: 213 GLDDHFHLAY----ILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLY 255
           G  D+FHL +    I G   WL   P  PK  +N  +V    T N Y
Sbjct: 68  GDGDNFHLFHTPGGIFGGWGWLRKVPKLPKSDSNGLIVSRKKTSNFY 114

>TPHA0N00650 Chr14 complement(141967..144840) [2874 bp, 957 aa] {ON}
           Anc_5.196 YLL013C
          Length = 957

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 223 ILGSSQWLNNAPLTPKEITNSRLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDIST 282
           I+ S Q+  +A L  +E  N+   K Y+ K+++   +EF        F +H   +   S 
Sbjct: 581 IISSQQYHRSALL--EEFRNNTTNKQYTLKDIHGHTLEFCKDQHGSRFIQHELAVVKPSE 638

Query: 283 SVSAWRKVQRGLIKMYMDEVLNKFPVVQHFWFGT 316
               + K++  ++++  D+V   + + + F FG+
Sbjct: 639 KEIIFNKIRDHILELS-DDVFGNYVIQKFFEFGS 671

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,766,062
Number of extensions: 1836444
Number of successful extensions: 6041
Number of sequences better than 10.0: 46
Number of HSP's gapped: 6063
Number of HSP's successfully gapped: 46
Length of query: 464
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 351
Effective length of database: 40,524,141
Effective search space: 14223973491
Effective search space used: 14223973491
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)