Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F002305.710ON48647017370.0
NCAS0G001905.710ON4432128831e-114
Smik_9.155.710ON3442107861e-100
Skud_9.145.710ON3512107851e-100
YIL154C (IMP2')5.710ON3462117831e-100
Suva_9.345.710ON3202097771e-99
KAFR0D021805.710ON3872116952e-86
CAGL0H06677g5.710ON3382116885e-86
TBLA0E017405.710ON3752166707e-83
KNAG0L021805.710ON4392126565e-80
TDEL0B021005.710ON3402116414e-79
ZYRO0B16500g5.710ON3422106268e-77
Kpol_1043.765.710ON3722136253e-76
SAKL0E15092g5.710ON3522105642e-67
TPHA0E001605.710ON4402575545e-65
KLTH0E00858g5.710ON3242135185e-61
Kwal_55.196555.710ON3242094932e-57
KLLA0A00440g5.710ON3552154168e-46
AFR294W5.710ON3402143843e-41
Ecym_40115.710ON4222353542e-36
Suva_13.488.880ON59175704.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F00230
         (486 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00230 Chr6 complement(43491..44951) [1461 bp, 486 aa] {ON}...   673   0.0  
NCAS0G00190 Chr7 complement(27710..29041) [1332 bp, 443 aa] {ON}...   344   e-114
Smik_9.15 Chr9 complement(31597..32631) [1035 bp, 344 aa] {ON} Y...   307   e-100
Skud_9.14 Chr9 complement(30986..31686,31717..32071) [1056 bp, 3...   306   e-100
YIL154C Chr9 complement(53981..55021) [1041 bp, 346 aa] {ON}  IM...   306   e-100
Suva_9.34 Chr9 complement(48616..49131,49133..49438,49501..49641...   303   1e-99
KAFR0D02180 Chr4 complement(438301..439464) [1164 bp, 387 aa] {O...   272   2e-86
CAGL0H06677g Chr8 (663303..664319) [1017 bp, 338 aa] {ON} simila...   269   5e-86
TBLA0E01740 Chr5 (424870..425997) [1128 bp, 375 aa] {ON} Anc_5.7...   262   7e-83
KNAG0L02180 Chr12 (390307..391626) [1320 bp, 439 aa] {ON} Anc_5....   257   5e-80
TDEL0B02100 Chr2 complement(375013..376035) [1023 bp, 340 aa] {O...   251   4e-79
ZYRO0B16500g Chr2 (1338095..1339123) [1029 bp, 342 aa] {ON} simi...   245   8e-77
Kpol_1043.76 s1043 (164489..165607) [1119 bp, 372 aa] {ON} (1644...   245   3e-76
SAKL0E15092g Chr5 (1255185..1256243) [1059 bp, 352 aa] {ON} some...   221   2e-67
TPHA0E00160 Chr5 complement(14950..16272) [1323 bp, 440 aa] {ON}...   218   5e-65
KLTH0E00858g Chr5 complement(86253..87227) [975 bp, 324 aa] {ON}...   204   5e-61
Kwal_55.19655 s55 complement(68638..69612) [975 bp, 324 aa] {ON}...   194   2e-57
KLLA0A00440g Chr1 complement(37134..38201) [1068 bp, 355 aa] {ON...   164   8e-46
AFR294W Chr6 (968616..969638) [1023 bp, 340 aa] {ON} Syntenic ho...   152   3e-41
Ecym_4011 Chr4 complement(27848..29116) [1269 bp, 422 aa] {ON} s...   140   2e-36
Suva_13.48 Chr13 (73725..75500) [1776 bp, 591 aa] {ON} YMR239C (...    32   4.8  

>NDAI0F00230 Chr6 complement(43491..44951) [1461 bp, 486 aa] {ON}
           Anc_5.710 YIL154C
          Length = 486

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/470 (73%), Positives = 346/470 (73%)

Query: 17  KSLGGPGINKRSILLTTPEGSETKLMKDAKNXXXXXXXXXXXXXXLQPPPSINISHIDST 76
           KSLGGPGINKRSILLTTPEGSETKLMKDAKN              LQPPPSINISHIDST
Sbjct: 17  KSLGGPGINKRSILLTTPEGSETKLMKDAKNDDTIIDSPTTSTSDLQPPPSINISHIDST 76

Query: 77  ADQMANLSPKTSLTVTADSPVSVTAANIGMTTPTTAVQFDAEEIERGRSRIKXXXXXXXX 136
           ADQMANLSPKTSLTVTADSPVSVTAANIGMTTPTTAVQFDAEEIERGRSRIK        
Sbjct: 77  ADQMANLSPKTSLTVTADSPVSVTAANIGMTTPTTAVQFDAEEIERGRSRIKNSTTHANV 136

Query: 137 XXXXXXXXXXXXXMERSNXXXXXXXXXXXXXXXXXXXXXXXEEEFLKWTVLRQDPSMRLQ 196
                        MERSN                       EEEFLKWTVLRQDPSMRLQ
Sbjct: 137 NTNANPNNNTNNNMERSNRRIGGSLSTSRSRSRSRASSRIREEEFLKWTVLRQDPSMRLQ 196

Query: 197 NLNENIAXXXXXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 256
           NLNENIA                    R                                
Sbjct: 197 NLNENIAKYNKKKKKNELKEQKNLKKKRSETDDEQTEEEEEEEEDVTDTDSDEDDEDDDE 256

Query: 257 XXXXXXXXXXXXXXIENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIK 316
                         IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIK
Sbjct: 257 DESDEESDEEQVSDIENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIK 316

Query: 317 GKENEGVNFTTLDGGYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYM 376
           GKENEGVNFTTLDGGYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYM
Sbjct: 317 GKENEGVNFTTLDGGYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYM 376

Query: 377 MGAVLNNGDTLYIVHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLT 436
           MGAVLNNGDTLYIVHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLT
Sbjct: 377 MGAVLNNGDTLYIVHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLT 436

Query: 437 HPYPKHLLNEMIHGLKPVSIACSLTIILSTLQNFVCSVPTLVIRKKLKRS 486
           HPYPKHLLNEMIHGLKPVSIACSLTIILSTLQNFVCSVPTLVIRKKLKRS
Sbjct: 437 HPYPKHLLNEMIHGLKPVSIACSLTIILSTLQNFVCSVPTLVIRKKLKRS 486

>NCAS0G00190 Chr7 complement(27710..29041) [1332 bp, 443 aa] {ON}
           Anc_5.710 YIL154C
          Length = 443

 Score =  344 bits (883), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 189/212 (89%), Gaps = 3/212 (1%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKEN+ V    LDG
Sbjct: 218 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENDNVEIGRLDG 277

Query: 331 GYIRAMQLLTKGKGASMDFDPMK---PAGRCYILYTDLSSESTYALTYMMGAVLNNGDTL 387
           GY+RAMQLLTKGKGA ++ +      PAGRCYILYTDLSSESTYALTY MGAV+NNGDTL
Sbjct: 278 GYLRAMQLLTKGKGAYLNTESTATPTPAGRCYILYTDLSSESTYALTYTMGAVINNGDTL 337

Query: 388 YIVHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEM 447
           Y+VH E+S + +E LM +NVGR+RKHVMHMFDC+SAV+DD+DV+ LSLTHPYPKHLLNEM
Sbjct: 338 YVVHSENSNIFDEPLMLKNVGRIRKHVMHMFDCISAVVDDVDVVALSLTHPYPKHLLNEM 397

Query: 448 IHGLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           IHGLKPV++   L+I+LS+LQNFVCSVPTLVI
Sbjct: 398 IHGLKPVALCVPLSIMLSSLQNFVCSVPTLVI 429

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 73/180 (40%), Gaps = 33/180 (18%)

Query: 23  GINKRSILLTTPEGSETKLMKDAKNXXXXXXXXXXXXXXLQPPPSINISHIDSTADQMAN 82
           G   +SILLTTPEG E  L     N              L PP  +  +    T  +  +
Sbjct: 13  GKGHKSILLTTPEGKEAPLHHSESNPLPTEDK-------LLPPQKLEDADNMLTPSKSTD 65

Query: 83  LSPKTSLTVTADSPVSVTAANIGMTTPTTAVQFDAEEIERGRSRIKXXXXXXXXXXXXXX 142
           LSP+TS                    P+T VQFDAE+IERGRSRIK              
Sbjct: 66  LSPRTS-------------------APSTGVQFDAEQIERGRSRIKKSNAISAGAATMGT 106

Query: 143 XXXXXXXMERSNXXXXXXXXXXXXXXXXXXXXXXXEEEFLKWTVLRQDPSMRLQNLNENI 202
                   +                          EEEFLKWTVLRQDPSMRLQN+NENI
Sbjct: 107 S-------QTGGNIGSLSGSKSRSRSRSRASSRIREEEFLKWTVLRQDPSMRLQNVNENI 159

>Smik_9.15 Chr9 complement(31597..32631) [1035 bp, 344 aa] {ON}
           YIL154C (REAL)
          Length = 344

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 149/210 (70%), Positives = 179/210 (85%), Gaps = 8/210 (3%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           +END+EIDE F+YDLGMKVLPNFC+SIN++L+++KPWIAKYE SI+G E+EGV+   LDG
Sbjct: 128 VENDLEIDEEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYEISIRGHEDEGVSLEQLDG 187

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPAG-RCYILYTDLSSESTYALTYMMGAVLNNGDTLYI 389
           GY+RAMQLLTKG GA       +P   R +ILYTDLSSESTYALTY+MGAV+N GDTLYI
Sbjct: 188 GYVRAMQLLTKGAGA-------EPGNQRSFILYTDLSSESTYALTYLMGAVVNQGDTLYI 240

Query: 390 VHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMIH 449
           VHWE SK  ++  M  NV R+RKHVMH+FDCV+ V+DDLDV++LSLTHPYPKHLLNEMIH
Sbjct: 241 VHWEPSKPTDDAQMFANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKHLLNEMIH 300

Query: 450 GLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           GLKPV++ CSL++ILSTLQNFVCSVP L +
Sbjct: 301 GLKPVALCCSLSVILSTLQNFVCSVPILAV 330

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/19 (94%), Positives = 19/19 (100%)

Query: 178 EEEFLKWTVLRQDPSMRLQ 196
           EEEFLKWTVLRQDPSMRL+
Sbjct: 74  EEEFLKWTVLRQDPSMRLR 92

>Skud_9.14 Chr9 complement(30986..31686,31717..32071) [1056 bp, 351
           aa] {ON} YIL154C (REAL)
          Length = 351

 Score =  306 bits (785), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 177/210 (84%), Gaps = 8/210 (3%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           +END EIDE F+YDLGMKVLPNFC+SIN++L+++KPWIAKYE SI+G ENEGV+   LDG
Sbjct: 135 VENDAEIDEEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYEISIRGHENEGVSLEQLDG 194

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPAG-RCYILYTDLSSESTYALTYMMGAVLNNGDTLYI 389
           GY+RAMQLLTKG GA       +P   R +ILYTDLSSESTYALTY+MGAV+N GDTLYI
Sbjct: 195 GYVRAMQLLTKGAGA-------EPGNQRSFILYTDLSSESTYALTYLMGAVVNQGDTLYI 247

Query: 390 VHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMIH 449
           +HWE SK  ++  M  NV R+RKHVMH+FDC + V+DDLDV++LSLTHPYPKHLLNEMIH
Sbjct: 248 LHWEPSKPTDDSQMFANVARIRKHVMHLFDCAAGVLDDLDVVVLSLTHPYPKHLLNEMIH 307

Query: 450 GLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           GLKPV++ CSL++ILSTLQNFVCSVP L +
Sbjct: 308 GLKPVALCCSLSVILSTLQNFVCSVPILAV 337

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 44/103 (42%), Gaps = 26/103 (25%)

Query: 100 TAANIGMT---TPTTAVQFDAEEIERG---RSRIKXXXXXXXXXXXXXXXXXXXXXMERS 153
           T +N+  T   TPTT V+FD+E++ERG   R R K                      +  
Sbjct: 13  TQSNLHRTKTETPTT-VEFDSEQMERGHRERGRSKKKR-------------------DER 52

Query: 154 NXXXXXXXXXXXXXXXXXXXXXXXEEEFLKWTVLRQDPSMRLQ 196
           +                       EEEFLKWTVLRQDPSMRL+
Sbjct: 53  DSYASSLSRSRSRASRASSRSRVREEEFLKWTVLRQDPSMRLK 95

>YIL154C Chr9 complement(53981..55021) [1041 bp, 346 aa] {ON}
           IMP2'Transcriptional activator involved in maintenance
           of ion homeostasis and protection against DNA damage
           caused by bleomycin and other oxidants, contains a
           C-terminal leucine-rich repeat
          Length = 346

 Score =  306 bits (783), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 177/211 (83%), Gaps = 10/211 (4%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           IEND+EIDE F+YDLGMKVLPNFC+SIN++LD++KPWIAKYE SI+G ENE V+   LDG
Sbjct: 130 IENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEISIRGHENEDVSLEQLDG 189

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPAG--RCYILYTDLSSESTYALTYMMGAVLNNGDTLY 388
           GY+RAMQLLTKG GA         AG  R +ILYTDLSSESTYALTY+MGA +N GDT+Y
Sbjct: 190 GYVRAMQLLTKGAGAE--------AGNQRSFILYTDLSSESTYALTYLMGAAVNQGDTVY 241

Query: 389 IVHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMI 448
           IVHWE SK  ++  M  NV R+RKHVMH+FDCV+ V+DDLDV++LSLTHPYPKHLLNEMI
Sbjct: 242 IVHWEPSKPTDDSQMFANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKHLLNEMI 301

Query: 449 HGLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           HGLKPV++ CSL++ILSTLQNFVCSVP L +
Sbjct: 302 HGLKPVALCCSLSVILSTLQNFVCSVPILAV 332

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 41/97 (42%), Gaps = 26/97 (26%)

Query: 103 NIGMTTPTTAVQFDAEEIERG---RSRIKXXXXXXXXXXXXXXXXXXXXXMERSNXXXXX 159
           +I   TPTT V+FD+E++ERG   R R K                      ++       
Sbjct: 19  SIKTETPTT-VEFDSEQMERGHRERGRSK----------------------KKRGERDSN 55

Query: 160 XXXXXXXXXXXXXXXXXXEEEFLKWTVLRQDPSMRLQ 196
                             EEEFLKWTVLRQDPSMRL+
Sbjct: 56  VSSLSRSRSRASSRSRVREEEFLKWTVLRQDPSMRLR 92

>Suva_9.34 Chr9 complement(48616..49131,49133..49438,49501..49641)
           [963 bp, 320 aa] {ON} YIL154C (REAL)
          Length = 320

 Score =  303 bits (777), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 174/209 (83%), Gaps = 9/209 (4%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           ++ND+EIDE F+YDLGMKVLPNFC+SIND+LD+AKPWIAKYE    G EN+GV+   L G
Sbjct: 107 VDNDLEIDEEFHYDLGMKVLPNFCTSINDVLDSAKPWIAKYE---MGHENDGVSLERLAG 163

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYMMGAVLNNGDTLYIV 390
           GY+RAMQLLTKG GA         A RC+ILYTDLSSESTYALTY+MGAVLN GDTLYIV
Sbjct: 164 GYVRAMQLLTKGAGAE------PGAQRCFILYTDLSSESTYALTYLMGAVLNQGDTLYIV 217

Query: 391 HWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMIHG 450
           HWE S   ++  M  NV R+RKHVMH+FDCV+ V+DDLDV++LSLTHPYPKHLLNEMIHG
Sbjct: 218 HWEPSTPVDDAQMLANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKHLLNEMIHG 277

Query: 451 LKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           LKPV++ CSL++IL TLQNFVCSVPTL +
Sbjct: 278 LKPVALCCSLSVILGTLQNFVCSVPTLAV 306

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/19 (89%), Positives = 19/19 (100%)

Query: 178 EEEFLKWTVLRQDPSMRLQ 196
           EE+FLKWTVLRQDPSMRL+
Sbjct: 48  EEQFLKWTVLRQDPSMRLR 66

>KAFR0D02180 Chr4 complement(438301..439464) [1164 bp, 387 aa] {ON}
           Anc_5.710 YIL154C
          Length = 387

 Score =  272 bits (695), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 171/211 (81%), Gaps = 7/211 (3%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGK-ENEGVNFTTLD 329
           I+N+VEIDE  ++DLGMKVLPNFC SIN++L++ KPW+ +YE+ I+    +E      ++
Sbjct: 168 IDNEVEIDEKLDFDLGMKVLPNFCVSINEVLESRKPWVQQYEKEIESVLPDETTKLDEIE 227

Query: 330 GGYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYMMGAVLNNGDTLYI 389
            GYIRA+ L+TKG+G+S + D     G+ YIL+ DLSSES YALTY+MG V+NNGDTLYI
Sbjct: 228 DGYIRAIDLVTKGEGSSKNGD-----GQSYILFMDLSSESIYALTYVMGCVINNGDTLYI 282

Query: 390 VHWESS-KVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMI 448
           V+WES+ K  +E ++  N+ RV+K  +H+FDC+S VID+LDVII+SLTHPYPKHLL+EMI
Sbjct: 283 VNWESTLKHIDETIIYNNLKRVKKMTLHLFDCISGVIDNLDVIIVSLTHPYPKHLLSEMI 342

Query: 449 HGLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           +GLKP+++ CSL+I+LSTLQNFVCSVPTLV+
Sbjct: 343 YGLKPMALCCSLSIMLSTLQNFVCSVPTLVV 373

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 22/25 (88%)

Query: 178 EEEFLKWTVLRQDPSMRLQNLNENI 202
           EEEFLKWTVLRQDPSMRL N NE +
Sbjct: 93  EEEFLKWTVLRQDPSMRLFNANEKL 117

>CAGL0H06677g Chr8 (663303..664319) [1017 bp, 338 aa] {ON} similar
           to uniprot|P32351 Saccharomyces cerevisiae YIL154c IMP2
          Length = 338

 Score =  269 bits (688), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 135/211 (63%), Positives = 169/211 (80%), Gaps = 6/211 (2%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIK-GKENEGVNFTTLD 329
           IEND EIDE F++DLG KVLPNF +SIND+L+ +KPWI KY  ++   KE  GVNF TL+
Sbjct: 118 IENDAEIDEEFHFDLGTKVLPNFSTSINDVLENSKPWIQKYLSTLDMEKERAGVNFETLE 177

Query: 330 GGYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYMMGAVLNNGDTLYI 389
           GGY RA++L+ KGKGA    +      + YIL TDLSSESTYALTY+MG++++NGDTLYI
Sbjct: 178 GGYSRALELVRKGKGA----EAHPETSKNYILCTDLSSESTYALTYVMGSLVSNGDTLYI 233

Query: 390 VHWES-SKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMI 448
           VHW+  S  + +    +N  RV+KHV H+ DCVS ++DDLDV+I+SLTHPYPKHLLNEMI
Sbjct: 234 VHWDGDSTTSTKDSFIDNALRVKKHVRHLMDCVSVIVDDLDVVIISLTHPYPKHLLNEMI 293

Query: 449 HGLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           HGLKPV++ACSL++ILS+LQNFVCSVPTLVI
Sbjct: 294 HGLKPVTLACSLSLILSSLQNFVCSVPTLVI 324

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (87%)

Query: 178 EEEFLKWTVLRQDPSMRLQNLNEN 201
           EEEFLKWTVLR+DPSMRL  L +N
Sbjct: 57  EEEFLKWTVLRRDPSMRLTTLKKN 80

>TBLA0E01740 Chr5 (424870..425997) [1128 bp, 375 aa] {ON} Anc_5.710
           YIL154C
          Length = 375

 Score =  262 bits (670), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 160/216 (74%), Gaps = 8/216 (3%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           IEN+ E+DE F ++ G K+LPNFC+ IN  L+  K WI  YE  +KGKENEG+N   LD 
Sbjct: 163 IENEAELDEEFQFEQGNKILPNFCTYINLTLEGGKKWIRNYESQVKGKENEGINLIKLDN 222

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYMMGAVLNNGDTLYIV 390
           GY RA++  +KGKG S D       G+ Y+LY+DLSSESTYAL Y++G+++ NGD +Y+V
Sbjct: 223 GYARAIEGYSKGKGCSAD-------GKSYLLYSDLSSESTYALAYLIGSIIKNGDMIYLV 275

Query: 391 HWE-SSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMIH 449
           HWE ++K   EK + +NV R+R+HV+H+ D  S +IDD +++++SLTHPYPKH LNE+IH
Sbjct: 276 HWEGNNKKIPEKQLSDNVFRMRRHVLHLLDAASTIIDDAEIMMVSLTHPYPKHFLNELIH 335

Query: 450 GLKPVSIACSLTIILSTLQNFVCSVPTLVIRKKLKR 485
           GL    + CSLT+ILS LQNFV S+P L++RKKLK+
Sbjct: 336 GLDISMLCCSLTMILSGLQNFVSSIPMLIVRKKLKK 371

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 40/93 (43%), Gaps = 21/93 (22%)

Query: 106 MTTPT---TAVQFDAEEIERGRSRIKXXXXXXXXXXXXXXXXXXXXXMERSNXXXXXXXX 162
           +TTP    TAVQFD+E+IE  R R K                      +++N        
Sbjct: 9   LTTPEGTGTAVQFDSEQIENDRGRSKKRFK------------------DKTNTSRSATGG 50

Query: 163 XXXXXXXXXXXXXXXEEEFLKWTVLRQDPSMRL 195
                          +EEFLKWTVLR+DPSMRL
Sbjct: 51  SSISRSRSRASSRVRDEEFLKWTVLRKDPSMRL 83

>KNAG0L02180 Chr12 (390307..391626) [1320 bp, 439 aa] {ON} Anc_5.710
           YIL154C
          Length = 439

 Score =  257 bits (656), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 114/212 (53%), Positives = 156/212 (73%), Gaps = 11/212 (5%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           +END EIDE F YDLG K LPNFC SIN+++ +A+PWI +Y+    G+  E ++   ++G
Sbjct: 222 VENDAEIDEKFTYDLGTKTLPNFCVSINEVISSAEPWIRQYDAD-HGESQEKIDVRDVEG 280

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYMMGAVLNNGDTLYIV 390
           GY+RA++LLT+GKGAS       P    YI+Y+DLSSES YAL Y++G ++ NGDT+Y+V
Sbjct: 281 GYVRAVELLTRGKGAS-------PQADTYIVYSDLSSESNYALLYVLGTLVGNGDTVYVV 333

Query: 391 HWESSK---VANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEM 447
           HW S +         ++ NV  +R+  +H+FDC+SA +DDLD+++LS THPYPKHLLNEM
Sbjct: 334 HWHSDRGGGAVTHSEVRSNVRNLRRKALHLFDCLSATVDDLDIVLLSTTHPYPKHLLNEM 393

Query: 448 IHGLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           I+ L PV++ CSL+I+LS LQNFVCSVPT VI
Sbjct: 394 INALHPVALCCSLSIVLSLLQNFVCSVPTFVI 425

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 44/106 (41%), Gaps = 11/106 (10%)

Query: 100 TAANIGMTTPTTA--------VQFDAEEIERGRSRIKXXXXXXXXXXXXXXXXXXXXXME 151
           T A  G+ T T A        VQFD+E+IERGRSR+K                       
Sbjct: 56  TPAATGVATSTGAGAGAGAGAVQFDSEQIERGRSRMKRRDAKRAEARSNSGSRSRSGSRS 115

Query: 152 RSNXXXXXXXXXXXXXXXXXXXXXXXEEEFLKWTVLRQDPSMRLQN 197
           RS                        EEEFLKWTVLRQDPSMRL +
Sbjct: 116 RSRSRSFSRSRSRTSSRASSRIR---EEEFLKWTVLRQDPSMRLHH 158

>TDEL0B02100 Chr2 complement(375013..376035) [1023 bp, 340 aa] {ON}
           Anc_5.710 YIL154C
          Length = 340

 Score =  251 bits (641), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 162/211 (76%), Gaps = 14/211 (6%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           ++ND +IDE F+YDLGMKVLPNF  S+ND+LD++K WI ++  + +  E   +   TL G
Sbjct: 128 VDNDFDIDEEFHYDLGMKVLPNFVQSLNDVLDSSKQWIREFRANTQEPE---IPLATLAG 184

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYMMGAVLNNGDTLYIV 390
           GY RAM  L+KGKG++ D        R YIL +DL+SES YALTY+MGA+++NGDTLY+V
Sbjct: 185 GYKRAMLPLSKGKGSTTD--------RSYILCSDLTSESQYALTYVMGALVSNGDTLYVV 236

Query: 391 HW--ESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMI 448
           HW  +SS  A+ KL Q+N+  +R++V HMFD + AVI+D DV++LSL HP+PK LL EMI
Sbjct: 237 HWDNQSSSDADAKL-QKNILTIRENVEHMFDSIGAVIEDFDVVVLSLQHPFPKQLLTEMI 295

Query: 449 HGLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           HGL+PV++ CSL++ILSTLQN+VCSVPTLVI
Sbjct: 296 HGLQPVALCCSLSMILSTLQNYVCSVPTLVI 326

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 42/99 (42%), Gaps = 24/99 (24%)

Query: 98  SVTAANIGMTTPTTAVQFDAEEIERGRSRIKXXXXXXXXXXXXXXXXXXXXXMERSNXXX 157
           S +  N+    P   VQFD+E++ERGRSR K                       R+N   
Sbjct: 17  SQSPLNVNDNEPAGGVQFDSEQLERGRSRTKI----------------------RNNGSS 54

Query: 158 XXXXXXXXXXXXXXXXXXXXEEEFLKWTVLRQDPSMRLQ 196
                               +EEFLKWTVLR+DPSMRLQ
Sbjct: 55  QLSASSSRSRSRASSRIR--DEEFLKWTVLRRDPSMRLQ 91

>ZYRO0B16500g Chr2 (1338095..1339123) [1029 bp, 342 aa] {ON} similar
           to uniprot|P32351 Saccharomyces cerevisiae YIL154C IMP2'
           Transcriptional activator involved in maintenance of ion
           homeostasis and protection against DNA damage caused by
           bleomycin and other oxidants contains a C- terminal
           leucine-rich repeat
          Length = 342

 Score =  245 bits (626), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 111/210 (52%), Positives = 159/210 (75%), Gaps = 12/210 (5%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           +END+EIDE  +YD+G +VLPN+ +SIN++L + K WI+ YE     +  + V+FT L G
Sbjct: 130 VENDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQ---ETTQDVSFTKLPG 186

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYMMGAVLNNGDTLYIV 390
           GY R  QLL++GKGA+          R ++L TDL++ES YAL Y++GA+LNNGDTLYIV
Sbjct: 187 GYSRCCQLLSRGKGATTR--------RSFVLCTDLTTESHYALAYVIGALLNNGDTLYIV 238

Query: 391 HWESSKVANEK-LMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMIH 449
           HW+  +  + K  ++++V  +R+HV+H  DC SA + DLDV++LSL+HPYPKHLL+EMI+
Sbjct: 239 HWDGKQPGSSKETLEQSVKSLRQHVLHKLDCASASLQDLDVVLLSLSHPYPKHLLSEMIY 298

Query: 450 GLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
            L+P+++ CSL+++L+TLQNFVCSVPTLVI
Sbjct: 299 ALQPIALCCSLSLVLTTLQNFVCSVPTLVI 328

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 32/85 (37%), Gaps = 27/85 (31%)

Query: 112 AVQFDAEEIERGRSRIKXXXXXXXXXXXXXXXXXXXXXMERSNXXXXXXXXXXXXXXXXX 171
            VQFD+E++ERGRSR+K                                           
Sbjct: 34  GVQFDSEQLERGRSRVKAARGIKSNSGSRSRSRNPSHV---------------------- 71

Query: 172 XXXXXXEEEFLKWTVLRQDPSMRLQ 196
                   EFLKWTVL++DPSMRL 
Sbjct: 72  -----RNGEFLKWTVLKRDPSMRLH 91

>Kpol_1043.76 s1043 (164489..165607) [1119 bp, 372 aa] {ON}
           (164489..165607) [1119 nt, 373 aa]
          Length = 372

 Score =  245 bits (625), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 112/213 (52%), Positives = 159/213 (74%), Gaps = 4/213 (1%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           IEN+ +IDE   +DLG KVLPN+C SINDI++++K WI+ Y    +   N+ V+   ++G
Sbjct: 146 IENENDIDEDITFDLGTKVLPNYCMSINDIMESSKKWISDYLSRPENLRNDNVHIEKMEG 205

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYMMGAVLNNGDTLYIV 390
           G+++AM+L++K + +S         G  YILYTDL+SESTYAL Y++GA++NNGDTLY+V
Sbjct: 206 GFVKAMELISKKEDSSTSISSSGKEGDSYILYTDLTSESTYALAYVLGALVNNGDTLYVV 265

Query: 391 HWESSKV--ANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMI 448
           HWE +      +  + +N+ R+RKHVMH+ DC SAVID +D++++SLTHPYPKHLLNEMI
Sbjct: 266 HWEGNNTHGVTDTRIYDNIFRIRKHVMHLLDCSSAVIDRIDILLISLTHPYPKHLLNEMI 325

Query: 449 HGLKPVSIACSLTIIL--STLQNFVCSVPTLVI 479
           HGLKP ++ CSL+++L  S LQN+V S+P LVI
Sbjct: 326 HGLKPKTLCCSLSVVLSPSGLQNYVSSIPMLVI 358

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 34/88 (38%), Gaps = 23/88 (26%)

Query: 111 TAVQFDAEEIERGRSRIKXXXXXXXXXXXXXXXXXXXXXMERSNXXXXXXXXXXXXXXXX 170
           + VQFD+ +IE  R R K                       R N                
Sbjct: 34  SGVQFDSAQIENDRGRSK-----------------------RRNGEFRNGSGASLSRSRS 70

Query: 171 XXXXXXXEEEFLKWTVLRQDPSMRLQNL 198
                  +EEFLKWTVLR+DPSMRL+ +
Sbjct: 71  RANSRVRDEEFLKWTVLRRDPSMRLRTI 98

>SAKL0E15092g Chr5 (1255185..1256243) [1059 bp, 352 aa] {ON} some
           similarities with uniprot|P32351 Saccharomyces
           cerevisiae YIL154C IMP2' Transcriptional activator
           involved in maintenance of ion homeostasis and
           protection against DNA damage caused by bleomycin and
           other oxidants contains a C-terminal leucine-rich repeat
          Length = 352

 Score =  221 bits (564), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 153/210 (72%), Gaps = 9/210 (4%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGK-ENEGVNFTTLD 329
           IEND EID   +YDLG +VLPNF +SI+++L++ KPW  KY +++  K E   +   +L 
Sbjct: 137 IENDQEIDSELDYDLGARVLPNFSTSISNVLESNKPWTKKYLQTVDQKAERAKIKLDSLP 196

Query: 330 GGYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYMMGAVLNNGDTLYI 389
           GGY+RAM L+T+GKG S         G  YILY DLSSES YALTY +GAV+N+GDTLY+
Sbjct: 197 GGYMRAMSLVTRGKGGSSTH------GSSYILYADLSSESMYALTYTLGAVVNSGDTLYV 250

Query: 390 VHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMIH 449
           VH ESS    E  + +N+ ++ +    + DC S V++DL V++LSL+HPYPKHL+N+MIH
Sbjct: 251 VHVESS--TTETRLLQNIDKLTQQTAFLLDCTSGVVNDLSVVLLSLSHPYPKHLVNQMIH 308

Query: 450 GLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           GLKP+ +  SL+++L++LQN+VC++PTLV+
Sbjct: 309 GLKPLLLVVSLSLVLTSLQNYVCNIPTLVV 338

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 18/24 (75%)

Query: 178 EEEFLKWTVLRQDPSMRLQNLNEN 201
           +E +LKWTVLR+DPS RL    EN
Sbjct: 88  DESYLKWTVLRRDPSERLHKNEEN 111

>TPHA0E00160 Chr5 complement(14950..16272) [1323 bp, 440 aa] {ON}
           Anc_5.710 YIL154C
          Length = 440

 Score =  218 bits (554), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 159/257 (61%), Gaps = 49/257 (19%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESI---KGKENEGVNFTT 327
           +EN++EID+ F +DLGMKVLPN+C SIN++L+ +KPW + Y E +   K   N  V    
Sbjct: 171 LENELEIDD-FTFDLGMKVLPNYCISINEVLERSKPWKSAYNEDLVKNKIDPNANVLINE 229

Query: 328 LDGGYIRAMQLLTKGKGASMDFDPMKPAGRC----------------------------- 358
           L+GG+++AM+L++K      D D    +                                
Sbjct: 230 LEGGFVKAMELISKNNKYDDDIDSGSGSFSSNSELNKQDSEHHASTSATIASSNTNNTTS 289

Query: 359 ----------YILYTDLSSESTYALTYMMGAVLNNGDTLYIVHWESSKVAN----EKLMQ 404
                     +ILYTDLSSESTYALTY+MG ++ N DTLYIVHWE S  +N    +K M 
Sbjct: 290 SSGSSDSGDSFILYTDLSSESTYALTYVMGTLVKNNDTLYIVHWEGSTTSNNDAMKKKMT 349

Query: 405 ENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMIHGLKPVSIACSLTIIL 464
            N+ ++R++VM++ DC +++ID LDV+++S+THPYPKH LNEMI+GLKP S+ CSL I+L
Sbjct: 350 SNLQKIRENVMYLNDCNNSIIDRLDVVVISMTHPYPKHFLNEMIYGLKPKSLICSLNIML 409

Query: 465 --STLQNFVCSVPTLVI 479
             S LQN+VCS+P LVI
Sbjct: 410 SPSGLQNYVCSIPVLVI 426

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 66/174 (37%), Gaps = 48/174 (27%)

Query: 25  NKRSILLTTPEGSETKLMKDAKNXXXXXXXXXXXXXXLQPPPSINISHIDSTADQMANLS 84
           N++SILLT PEG    ++ +                        N +H    A+     S
Sbjct: 3   NRKSILLTGPEGGTVDILNE------------------------NETHSKDAANTKN--S 36

Query: 85  PKTSLTVTADSPVSVTAANIGMTTPTTAVQFDAEEIE--RGRSRIKXXXXXXXXXXXXXX 142
           P   L+ +A    S  A N      ++ V+FD+E+IE  RGR+R +              
Sbjct: 37  PIMELSNSAGDYFSAGANN-----ESSGVKFDSEQIENDRGRTRSRNNREDSSGTGNSFS 91

Query: 143 XXXXXXXMERSNXXXXXXXXXXXXXXXXXXXXXXXEEEFLKWTVLRQDPSMRLQ 196
                    RS                        +EEFLKWTVLR+DPSMRL+
Sbjct: 92  YSSNNNSKSRS---------------RSRASSMVRDEEFLKWTVLRKDPSMRLK 130

>KLTH0E00858g Chr5 complement(86253..87227) [975 bp, 324 aa] {ON}
           some similarities with uniprot|P32351 Saccharomyces
           cerevisiae YIL154C IMP2' Transcriptional activator
           involved in maintenance of ion homeostasis and
           protection against DNA damage
          Length = 324

 Score =  204 bits (518), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 150/213 (70%), Gaps = 15/213 (7%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           +EN+++ID A  YDLG +VLPNF SS+ D++   KPW+AK+ +S++GK++ GV    L G
Sbjct: 109 VENEIDIDAALGYDLGARVLPNFTSSLWDVVQNQKPWVAKFNKSVEGKDS-GVKLEDLQG 167

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPA----GRCYILYTDLSSESTYALTYMMGAVLNNGDT 386
           GY RA++++  GK       P + A    GR YI+Y DL+ ES YAL Y+ GAVL + DT
Sbjct: 168 GYARAIKIV-HGK-------PQQGAEAREGRSYIIYLDLTPESFYALLYVFGAVLASNDT 219

Query: 387 LYIVHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNE 446
           LY+VH  S +V NE+L + NV R+     ++ D  SA ++ ++V++LS++HPYPKHLLNE
Sbjct: 220 LYVVHI-SQRVPNEQL-RANVERLEAEAAYLLDASSAALNAVNVVLLSVSHPYPKHLLNE 277

Query: 447 MIHGLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           ++  LKP+++   L+++LS+LQN+VC +PT+VI
Sbjct: 278 LVIALKPMALCVPLSLVLSSLQNYVCPIPTVVI 310

>Kwal_55.19655 s55 complement(68638..69612) [975 bp, 324 aa] {ON}
           YIL154C (IMP2') - transcription factor [contig 159] FULL
          Length = 324

 Score =  194 bits (493), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 142/209 (67%), Gaps = 7/209 (3%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           ++N++ ID A  YDLG +VLPNF +S+ D+L T KPWIAKY E++  + N  V    L G
Sbjct: 109 VDNEINIDAALGYDLGARVLPNFTNSLWDVLQTEKPWIAKYNETVD-ENNTDVKLDELQG 167

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYMMGAVLNNGDTLYIV 390
           GY RA+Q++   K    +  P    G  YI+Y DL+ ES YAL Y+ GAVL+  DTLY+V
Sbjct: 168 GYARAIQVMHSAKSQKTELKP----GASYIVYLDLTPESFYALLYVFGAVLSPNDTLYVV 223

Query: 391 HWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMIHG 450
           H  S +V +++L + NV R+R    ++ D  SA +D + V+ILS++HPYPKHLLNEM+  
Sbjct: 224 HI-SPRVPSDQL-RSNVARLRAQTAYLLDASSAALDSVSVVILSVSHPYPKHLLNEMVLA 281

Query: 451 LKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           LKP+++   L+++LS LQN+VC +PT+VI
Sbjct: 282 LKPMALCVPLSLVLSVLQNYVCPIPTVVI 310

>KLLA0A00440g Chr1 complement(37134..38201) [1068 bp, 355 aa] {ON}
           similar to uniprot|Q753L8 Ashbya gossypii AFR294W
           AFR294Wp and weakly similar to YIL154C uniprot|P32351
           Saccharomyces cerevisiae YIL154C IMP2' Transcriptional
           activator involved in maintenance of ion homeostasis and
           protection against DNA damage caused by bleomycin and
           other oxidants contains a C-terminal leucine-rich repeat
          Length = 355

 Score =  164 bits (416), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 88/215 (40%), Positives = 126/215 (58%), Gaps = 12/215 (5%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           +EN++EIDE  +YDLG KVLPNF + I  +LD+ KPW+AK  E     +   +    +  
Sbjct: 133 VENEIEIDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQH 192

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSES----TYALTYMMGAVLNNGDT 386
           G  RA+  ++KG   +         G  +++Y D   ES     YAL Y  G+V  NGDT
Sbjct: 193 GIHRAVYHMSKGDNITA---ATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDT 249

Query: 387 LYIVHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAV--IDDLDVIILSLTHPYPKHLL 444
           LYI++ +     N+ L Q N  R+  H+ ++F+C + V  +D +DV+I S+ HPYPK LL
Sbjct: 250 LYIIN-QCDDDTNDMLFQMN--RICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLL 306

Query: 445 NEMIHGLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
            EM H L+P SI   L  +L++LQNF+ SVP LVI
Sbjct: 307 TEMAHSLQPSSIIIPLQTVLASLQNFITSVPMLVI 341

>AFR294W Chr6 (968616..969638) [1023 bp, 340 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL154C (IMP2')
          Length = 340

 Score =  152 bits (384), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/214 (37%), Positives = 119/214 (55%), Gaps = 18/214 (8%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDG 330
           +END ++D   +YDLG +VLPNF +SI  +LD    W+A+Y  S   +         L  
Sbjct: 128 VENDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRAS---QPAGAARVDVLQD 184

Query: 331 GYIRAMQLLTKGKGASMDFDPMKPAGRCYILY-TDL---SSESTYALTYMMGAVLNNGDT 386
              RA++   +  GA        PAG+ ++ Y  DL   ++E  YALTY  GAVL N DT
Sbjct: 185 TCTRAVRHFARHSGAP------GPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDT 238

Query: 387 LYIVHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNE 446
           LYI       + +   ++ ++ RV + V  + DC +A +DDLDV++L+L H YP+HLL E
Sbjct: 239 LYIF-----VLCDAVDVESHLNRVAEQVAFLLDCSAAALDDLDVVVLALQHAYPRHLLTE 293

Query: 447 MIHGLKPVSIACSLTIILSTLQNFVCSVPTLVIR 480
            IH  +P  +   L I   +L  +V SVPTL++R
Sbjct: 294 TIHAFRPAGLIVPLQIATRSLAGYVSSVPTLIVR 327

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%)

Query: 178 EEEFLKWTVLRQDPSMRLQ 196
           ++EFL+WT+LR DPS RL 
Sbjct: 88  DQEFLRWTILRADPSERLH 106

>Ecym_4011 Chr4 complement(27848..29116) [1269 bp, 422 aa] {ON}
           similar to Ashbya gossypii AFR294W
          Length = 422

 Score =  140 bits (354), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 125/235 (53%), Gaps = 37/235 (15%)

Query: 271 IENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIK-GKENEGVNFTTLD 329
           +END E+D A +YDLG +VLPNF +SI   LD+   W+A Y   I   +E + V    L+
Sbjct: 185 VENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQVDVLE 244

Query: 330 GGYIRAMQLLTK--------------------GKGASMDFDPMKPAGRCYILY-TDLS-- 366
               RA+Q + K                    G  A+ +     P  + ++LY  DL+  
Sbjct: 245 NCK-RAIQHIAKRALSPAPAGAAGQAGHAPLAGSAAAHEC----PQKKAFLLYLEDLNTS 299

Query: 367 -SESTYALTYMMGAVLNNGDTLYIV-HWESSKVANEKLMQENVGRVRKHVMHMFDCVSAV 424
            SE  YALTY  GAVL N DTLYIV   +++ V      + ++ +VR+ V  + D  SA 
Sbjct: 300 HSEKLYALTYTFGAVLANRDTLYIVVQCDAADV------EAHLVKVREQVAFLLDATSAA 353

Query: 425 IDDLDVIILSLTHPYPKHLLNEMIHGLKPVSIACSLTIILSTLQNFVCSVPTLVI 479
           +D LD+IIL+L HPYP+HLL E+    +P ++   L I   +L  +V  VPTLV+
Sbjct: 354 LDHLDIIILTLHHPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPTLVV 408

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (73%)

Query: 178 EEEFLKWTVLRQDPSMRLQ 196
           E E L+WT+LR DPS RL 
Sbjct: 120 EHELLRWTILRHDPSERLH 138

>Suva_13.48 Chr13 (73725..75500) [1776 bp, 591 aa] {ON} YMR239C
           (REAL)
          Length = 591

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 359 YILYTDLSSESTYALTYMMGAVLNNGDTLYIVHWESSKVANEKLMQENVGRVR-----KH 413
           YILY         AL+ M  A++NN +   +    S K+  ++ ++EN+ R +     K 
Sbjct: 158 YILYRKYPFSDEGALSRMKSAIVNNNNLERL----SQKLGFKERLKENIPRSKMRIKDKP 213

Query: 414 VMHMFDCVSAVIDDL 428
             H  DCV A I  L
Sbjct: 214 FKHYADCVEAYIGAL 228

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,419,377
Number of extensions: 1314922
Number of successful extensions: 3666
Number of sequences better than 10.0: 26
Number of HSP's gapped: 3700
Number of HSP's successfully gapped: 48
Length of query: 486
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 372
Effective length of database: 40,409,475
Effective search space: 15032324700
Effective search space used: 15032324700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)