Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F00220singletonON26626614010.0
NDAI0D044804.226ON26626610621e-147
NCAS0A023904.226ON2982649511e-129
KNAG0D042704.226ON2882649281e-126
KAFR0G031204.226ON2912608981e-122
YDL052C (SLC1)4.226ON3032558941e-121
Suva_4.1984.226ON3022568831e-119
Skud_4.2034.226ON3022668741e-118
Smik_4.1874.226ON3022558711e-117
CAGL0I04070g4.226ON3042618561e-115
Kpol_483.24.226ON2642638471e-114
TPHA0B009104.226ON2642568261e-111
KLTH0D13772g4.226ON3662538261e-110
TDEL0E014604.226ON2962638061e-107
Kwal_26.93264.226ON3542518081e-107
ZYRO0B07326g4.226ON2882537981e-106
SAKL0H03762g4.226ON3382607961e-105
SAKL0E05742gsingletonON3122617741e-102
TBLA0A081504.226ON2662577551e-100
KLLA0E01233g4.226ON3152557541e-99
AFR592W4.226ON3192567411e-97
Ecym_27734.226ON2852507182e-94
Kpol_472.14.226ON2862576801e-88
TPHA0B023704.226ON3272406831e-88
TPHA0M008703.244ON3831111022e-04
KNAG0A078703.478ON348199790.14
Skud_4.2703.244ON40878780.25
KLTH0C08096g3.244ON40080760.35
Ecym_74543.328ON49460760.37
Kwal_56.229433.244ON40982760.38
Smik_4.2523.244ON41292730.92
Smik_2.1603.244ON39880711.7
NDAI0C028605.141ON32072701.7
TPHA0A041103.244ON40967701.9
NCAS0I017603.244ON39480702.2
TDEL0D038103.244ON39980702.3
NCAS0A104003.244ON384193693.1
NDAI0A058903.244ON43689683.5
KAFR0J008902.230ON78676674.8
TBLA0D050907.433ON106689668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F00220
         (266 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00220 Chr6 complement(42144..42944) [801 bp, 266 aa] {ON}       544   0.0  
NDAI0D04480 Chr4 complement(1051289..1052089) [801 bp, 266 aa] {...   413   e-147
NCAS0A02390 Chr1 (453019..453915) [897 bp, 298 aa] {ON} Anc_4.226     370   e-129
KNAG0D04270 Chr4 (773359..774225) [867 bp, 288 aa] {ON} Anc_4.22...   362   e-126
KAFR0G03120 Chr7 (649148..650023) [876 bp, 291 aa] {ON} Anc_4.22...   350   e-122
YDL052C Chr4 complement(362672..363583) [912 bp, 303 aa] {ON}  S...   348   e-121
Suva_4.198 Chr4 complement(350506..351414) [909 bp, 302 aa] {ON}...   344   e-119
Skud_4.203 Chr4 complement(357878..358786) [909 bp, 302 aa] {ON}...   341   e-118
Smik_4.187 Chr4 complement(343919..344827) [909 bp, 302 aa] {ON}...   340   e-117
CAGL0I04070g Chr9 complement(356476..357390) [915 bp, 304 aa] {O...   334   e-115
Kpol_483.2 s483 (1245..2039) [795 bp, 264 aa] {ON} (1245..2039) ...   330   e-114
TPHA0B00910 Chr2 complement(210738..211532) [795 bp, 264 aa] {ON...   322   e-111
KLTH0D13772g Chr4 (1122242..1123342) [1101 bp, 366 aa] {ON} simi...   322   e-110
TDEL0E01460 Chr5 complement(290087..290977) [891 bp, 296 aa] {ON...   315   e-107
Kwal_26.9326 s26 (1165510..1166574) [1065 bp, 354 aa] {ON} YDL05...   315   e-107
ZYRO0B07326g Chr2 complement(575727..576593) [867 bp, 288 aa] {O...   311   e-106
SAKL0H03762g Chr8 complement(349686..350702) [1017 bp, 338 aa] {...   311   e-105
SAKL0E05742g Chr5 (473086..474024) [939 bp, 312 aa] {ON} similar...   302   e-102
TBLA0A08150 Chr1 complement(2013023..2013823) [801 bp, 266 aa] {...   295   e-100
KLLA0E01233g Chr5 complement(127544..128491) [948 bp, 315 aa] {O...   295   1e-99
AFR592W Chr6 (1503183..1504142) [960 bp, 319 aa] {ON} Syntenic h...   290   1e-97
Ecym_2773 Chr2 (1503107..1503964) [858 bp, 285 aa] {ON} similar ...   281   2e-94
Kpol_472.1 s472 complement(175..1035) [861 bp, 286 aa] {ON} comp...   266   1e-88
TPHA0B02370 Chr2 complement(544512..545495) [984 bp, 327 aa] {ON...   267   1e-88
TPHA0M00870 Chr13 complement(171415..172566) [1152 bp, 383 aa] {...    44   2e-04
KNAG0A07870 Chr1 (1253496..1254542) [1047 bp, 348 aa] {ON} Anc_3...    35   0.14 
Skud_4.270 Chr4 complement(473227..474453) [1227 bp, 408 aa] {ON...    35   0.25 
KLTH0C08096g Chr3 (690559..691761) [1203 bp, 400 aa] {ON} simila...    34   0.35 
Ecym_7454 Chr7 (931514..932998) [1485 bp, 494 aa] {ON} similar t...    34   0.37 
Kwal_56.22943 s56 complement(340249..341478) [1230 bp, 409 aa] {...    34   0.38 
Smik_4.252 Chr4 complement(463285..464523) [1239 bp, 412 aa] {ON...    33   0.92 
Smik_2.160 Chr2 complement(301290..302486) [1197 bp, 398 aa] {ON...    32   1.7  
NDAI0C02860 Chr3 complement(659616..660578) [963 bp, 320 aa] {ON...    32   1.7  
TPHA0A04110 Chr1 (921380..922609) [1230 bp, 409 aa] {ON} Anc_3.2...    32   1.9  
NCAS0I01760 Chr9 (325595..326779) [1185 bp, 394 aa] {ON} Anc_3.2...    32   2.2  
TDEL0D03810 Chr4 (697491..698690) [1200 bp, 399 aa] {ON} Anc_3.2...    32   2.3  
NCAS0A10400 Chr1 complement(2069371..2070525) [1155 bp, 384 aa] ...    31   3.1  
NDAI0A05890 Chr1 (1336132..1337442) [1311 bp, 436 aa] {ON} Anc_3...    31   3.5  
KAFR0J00890 Chr10 complement(157808..160168) [2361 bp, 786 aa] {...    30   4.8  
TBLA0D05090 Chr4 complement(1260428..1263628) [3201 bp, 1066 aa]...    30   8.5  

>NDAI0F00220 Chr6 complement(42144..42944) [801 bp, 266 aa] {ON} 
          Length = 266

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/266 (100%), Positives = 266/266 (100%)

Query: 1   MGLNVLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGID 60
           MGLNVLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGID
Sbjct: 1   MGLNVLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGID 60

Query: 61  VKIIGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGT 120
           VKIIGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGT
Sbjct: 61  VKIIGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGT 120

Query: 121 VFLDRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGE 180
           VFLDRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGE
Sbjct: 121 VFLDRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGE 180

Query: 181 LPIVPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKEL 240
           LPIVPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKEL
Sbjct: 181 LPIVPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKEL 240

Query: 241 KELGYCPANNITSLPPVVLELQKKNL 266
           KELGYCPANNITSLPPVVLELQKKNL
Sbjct: 241 KELGYCPANNITSLPPVVLELQKKNL 266

>NDAI0D04480 Chr4 complement(1051289..1052089) [801 bp, 266 aa] {ON}
           Anc_4.226
          Length = 266

 Score =  413 bits (1062), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 191/266 (71%), Positives = 231/266 (86%)

Query: 1   MGLNVLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGID 60
           MG N++YYLR TL + +L I AIYG+I SI+CT+IGKQHL+QYLTAR Y   MKY M ID
Sbjct: 1   MGSNIVYYLRSTLGIFVLIICAIYGVIASIVCTLIGKQHLAQYLTARCYSNAMKYIMNID 60

Query: 61  VKIIGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGT 120
           VK+I EENL  LP++++SNHQS LD+LM+GK FPPGCT+TAK +LK  P LGWFM+LSGT
Sbjct: 61  VKVIDEENLKNLPFIVVSNHQSMLDILMLGKLFPPGCTITAKKSLKYVPFLGWFMALSGT 120

Query: 121 VFLDRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGE 180
           +FLDR++RTKSVTTL+N LT I+ NKRA+ IFPEGTRS++T+L MLPFKKGAFHLAQQG+
Sbjct: 121 LFLDRSNRTKSVTTLHNGLTKIRNNKRAIWIFPEGTRSHTTDLEMLPFKKGAFHLAQQGK 180

Query: 181 LPIVPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKEL 240
           LPIVPVVVANTS++ S KWK +N+GCM+VKVLKP+ T+GL+K+DI AFSEKVR +M+KEL
Sbjct: 181 LPIVPVVVANTSTIKSSKWKVYNTGCMVVKVLKPLSTEGLQKDDIPAFSEKVRDLMDKEL 240

Query: 241 KELGYCPANNITSLPPVVLELQKKNL 266
           KELGYCPANNIT+LPP VLE QKKNL
Sbjct: 241 KELGYCPANNITNLPPNVLEAQKKNL 266

>NCAS0A02390 Chr1 (453019..453915) [897 bp, 298 aa] {ON} Anc_4.226
          Length = 298

 Score =  370 bits (951), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 176/264 (66%), Positives = 211/264 (79%), Gaps = 1/264 (0%)

Query: 2   GLN-VLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGID 60
           G N +LYY RC L +V+L + A+YG++ SI+CT+IGKQ  SQYLTAR Y   MKY MGID
Sbjct: 3   GFNTILYYNRCVLGIVVLLLCAVYGVLASIVCTLIGKQQYSQYLTARCYSNAMKYIMGID 62

Query: 61  VKIIGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGT 120
           VK+IGEENL  LPY+++SNHQS +D+LM+G+ FPPGCT+TAK +LK  P LGWFM+LSGT
Sbjct: 63  VKVIGEENLKNLPYIVVSNHQSAMDILMLGRMFPPGCTITAKKSLKYVPFLGWFMALSGT 122

Query: 121 VFLDRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGE 180
           +FLDRT+R KSV TLN  L  +K+NKRA+ IFPEGTRSYS  L MLPFKKGAFHLAQQGE
Sbjct: 123 LFLDRTNREKSVGTLNTGLAKVKENKRALWIFPEGTRSYSINLEMLPFKKGAFHLAQQGE 182

Query: 181 LPIVPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKEL 240
           LPIVPVVV+NTSS+ S K+  FN G +IVKVLKPI T+GLKKED+  FSE+VR  M  EL
Sbjct: 183 LPIVPVVVSNTSSIFSPKYNVFNRGTIIVKVLKPISTEGLKKEDVGKFSEQVRETMVAEL 242

Query: 241 KELGYCPANNITSLPPVVLELQKK 264
           KE+GY  A N T+LPP V+EL  K
Sbjct: 243 KEVGYSDAFNETNLPPSVVELNGK 266

>KNAG0D04270 Chr4 (773359..774225) [867 bp, 288 aa] {ON} Anc_4.226
           YDL052C
          Length = 288

 Score =  362 bits (928), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 166/264 (62%), Positives = 207/264 (78%)

Query: 1   MGLNVLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGID 60
           M   +LYY RC LA+++L IAA+YG+I SI+ T+IGKQ+L+Q+LTAR YY LMKY MG D
Sbjct: 1   MANTILYYARCFLAVIVLMIAALYGVIASIVATLIGKQYLAQWLTARCYYNLMKYTMGFD 60

Query: 61  VKIIGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGT 120
           VK+IGEE L   P++ +SNHQS LD+LM+G+ FP GCTVTAK +LK  P LGWFMSLSGT
Sbjct: 61  VKVIGEEKLENKPFIAVSNHQSTLDILMLGRMFPQGCTVTAKSSLKYVPFLGWFMSLSGT 120

Query: 121 VFLDRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGE 180
            FLDR+ R KSV TLN  L  +K+ KR + IFPEGTRSY+T+L++LPFKKGAFHLAQQG+
Sbjct: 121 YFLDRSSREKSVNTLNKGLEQVKREKRGLWIFPEGTRSYATDLNILPFKKGAFHLAQQGK 180

Query: 181 LPIVPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKEL 240
           +PI+P+VV+NTS+L++ KWK FN G M VKVL PIPT  L KEDI   +E+VR +M  EL
Sbjct: 181 IPIIPIVVSNTSTLMNPKWKVFNRGVMTVKVLDPIPTDELAKEDIGKLAEQVRDMMLTEL 240

Query: 241 KELGYCPANNITSLPPVVLELQKK 264
           +ELGY  ANN T+LPP  +E  KK
Sbjct: 241 QELGYSKANNDTNLPPQFIEQAKK 264

>KAFR0G03120 Chr7 (649148..650023) [876 bp, 291 aa] {ON} Anc_4.226
           YDL052C
          Length = 291

 Score =  350 bits (898), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 164/260 (63%), Positives = 205/260 (78%)

Query: 1   MGLNVLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGID 60
           M  N LYY R  LA+V+L ++A+YG + SI+C IIGKQHL+Q+ TARFYY   KY MGID
Sbjct: 1   MANNFLYYFRTFLAVVVLMVSALYGTLASIVCLIIGKQHLAQWTTARFYYYASKYIMGID 60

Query: 61  VKIIGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGT 120
           VK+I E N++ LP + +SNHQS LD+L++G+ FP GCTV+AK +L+  PILGWFM+LSGT
Sbjct: 61  VKVINEHNITNLPCIAVSNHQSALDILVLGRMFPKGCTVSAKKSLRYVPILGWFMALSGT 120

Query: 121 VFLDRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGE 180
           +FLDR +R KSV TLNNSL  IK NKRA+ IFPEGTRSY+T+L  LPFKKGAFHLAQQG 
Sbjct: 121 LFLDRGNREKSVKTLNNSLRKIKDNKRALWIFPEGTRSYTTDLETLPFKKGAFHLAQQGN 180

Query: 181 LPIVPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKEL 240
           +PIVPVVV+NTS+++  KW  FN G +I+KVL PIPT  LKKEDI AF+EKVR ++ KEL
Sbjct: 181 IPIVPVVVSNTSTIMFSKWNVFNRGTLIIKVLDPIPTSDLKKEDIGAFTEKVRDLISKEL 240

Query: 241 KELGYCPANNITSLPPVVLE 260
           KE+GY      T+LPP ++E
Sbjct: 241 KEVGYSIPIVDTNLPPNLVE 260

>YDL052C Chr4 complement(362672..363583) [912 bp, 303 aa] {ON}
           SLC11-acyl-sn-glycerol-3-phosphate acyltransferase,
           catalyzes the acylation of lysophosphatidic acid to form
           phosphatidic acid, a key intermediate in lipid
           metabolism; enzymatic activity detected in lipid
           particles and microsomes
          Length = 303

 Score =  348 bits (894), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 205/255 (80%)

Query: 6   LYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKIIG 65
           LYYLR  L ++ L+    YG+I SILCT+IGKQHL+Q++TAR +Y +MK  +G+DVK++G
Sbjct: 8   LYYLRSVLVVLALAGCGFYGVIASILCTLIGKQHLAQWITARCFYHVMKLMLGLDVKVVG 67

Query: 66  EENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDR 125
           EENL+K PY++I+NHQS LD+ M+G+ FPPGCTVTAK +LK  P LGWFM+LSGT FLDR
Sbjct: 68  EENLAKKPYIMIANHQSTLDIFMLGRIFPPGCTVTAKKSLKYVPFLGWFMALSGTYFLDR 127

Query: 126 TDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPIVP 185
           + R +++ TLN  L N+KKNKRA+ +FPEGTRSY++EL MLPFKKGAFHLAQQG++PIVP
Sbjct: 128 SKRQEAIDTLNKGLENVKKNKRALWVFPEGTRSYTSELTMLPFKKGAFHLAQQGKIPIVP 187

Query: 186 VVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKELGY 245
           VVV+NTS+L+S K+  FN GCMIV++LKPI T+ L K+ I  F+EKVR  M   LKE+GY
Sbjct: 188 VVVSNTSTLVSPKYGVFNRGCMIVRILKPISTENLTKDKIGEFAEKVRDQMVDTLKEIGY 247

Query: 246 CPANNITSLPPVVLE 260
            PA N T+LPP  +E
Sbjct: 248 SPAINDTTLPPQAIE 262

>Suva_4.198 Chr4 complement(350506..351414) [909 bp, 302 aa] {ON}
           YDL052C (REAL)
          Length = 302

 Score =  344 bits (883), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 157/256 (61%), Positives = 203/256 (79%)

Query: 5   VLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKII 64
           +LYYLR  LA+++LS   +YG++ SI CT+IGKQHLSQ+ TAR +Y  MK  +G+DVK+I
Sbjct: 7   ILYYLRTVLAVLVLSGCGLYGVVASIFCTLIGKQHLSQWTTARSFYYAMKLVLGLDVKVI 66

Query: 65  GEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLD 124
           GEEN+ K P+++I+NHQS LD+ M+G+ FPPGCTVTAK ++K  P LGWFM+LSGT FLD
Sbjct: 67  GEENMPKKPFIMIANHQSTLDIFMLGRIFPPGCTVTAKKSMKYLPFLGWFMTLSGTYFLD 126

Query: 125 RTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPIV 184
           R+ R ++V TLN  L N+KKNKRA+ +FPEGTRSY+TEL MLPFKKGAFHLAQQG +PIV
Sbjct: 127 RSSRQQAVETLNRGLENVKKNKRALWVFPEGTRSYTTELTMLPFKKGAFHLAQQGHIPIV 186

Query: 185 PVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKELG 244
           PVVV+NTS+L + K+  FN GCMIVK+L+P  T+ L K+ +  FSE+VR+ M   LKE+G
Sbjct: 187 PVVVSNTSTLTNPKYGVFNRGCMIVKILEPFSTENLTKDKVGEFSEQVRTRMIDTLKEIG 246

Query: 245 YCPANNITSLPPVVLE 260
           Y PA N T+LPP  L+
Sbjct: 247 YSPAINDTTLPPEALK 262

>Skud_4.203 Chr4 complement(357878..358786) [909 bp, 302 aa] {ON}
           YDL052C (REAL)
          Length = 302

 Score =  341 bits (874), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 208/266 (78%), Gaps = 6/266 (2%)

Query: 6   LYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKIIG 65
           LYYLR  L ++ L+   +YG+I SI+CT+IGKQHL+Q++TAR +Y +MK  +G+DV+++G
Sbjct: 8   LYYLRSVLVVLALAAGGLYGVIASIICTLIGKQHLAQWITARCFYRVMKLVLGLDVQVVG 67

Query: 66  EENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDR 125
           EENL K PY++++NHQS LD+ M+G+ FPPGCTVTAK +LK  P LGWFM+LSGT FLDR
Sbjct: 68  EENLVKKPYIMVANHQSTLDIFMLGRIFPPGCTVTAKKSLKYVPFLGWFMALSGTYFLDR 127

Query: 126 TDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPIVP 185
           + R +S+ TLN  L ++KKNKRA+ +FPEGTRSY+++L MLPFKKGAFHLAQQG++PIVP
Sbjct: 128 SKRQESIETLNKGLEDVKKNKRALWVFPEGTRSYTSDLTMLPFKKGAFHLAQQGKIPIVP 187

Query: 186 VVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKELGY 245
           VVV+NTS+L+S K+  FN G MIV++LKPI T+ L K+ I  F+EKVR  M   L+E+GY
Sbjct: 188 VVVSNTSTLVSPKYGVFNRGRMIVRILKPISTENLTKDKIGEFAEKVREQMLDTLQEIGY 247

Query: 246 CPANNITSLPPVVLEL------QKKN 265
            PA N T+LPP  +E       QKKN
Sbjct: 248 SPAINDTTLPPQAVEYAARQHDQKKN 273

>Smik_4.187 Chr4 complement(343919..344827) [909 bp, 302 aa] {ON}
           YDL052C (REAL)
          Length = 302

 Score =  340 bits (871), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 155/255 (60%), Positives = 203/255 (79%)

Query: 6   LYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKIIG 65
           LYYLR  L ++ L+   +YG+IVSI+CT+IGKQHL+Q++TAR +Y +MK  +G++V +IG
Sbjct: 8   LYYLRSVLVVLALASGGLYGVIVSIICTLIGKQHLAQWITARCFYHVMKLVLGLEVTVIG 67

Query: 66  EENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDR 125
           EENL+K PY++++NHQS LD+ M+G+ FPPGCTVTAK +LK  P LGWFM+LSGT FLDR
Sbjct: 68  EENLAKKPYIMVANHQSTLDIFMLGRIFPPGCTVTAKKSLKYVPFLGWFMALSGTYFLDR 127

Query: 126 TDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPIVP 185
           T R +++ TLN  L N+KKNKRA+ +FPEGTRSY++EL M PFKKGAFHLAQQG++PIVP
Sbjct: 128 TKRQEAIDTLNKGLENVKKNKRALWVFPEGTRSYTSELTMAPFKKGAFHLAQQGKIPIVP 187

Query: 186 VVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKELGY 245
           VVV+NTS+L+S K+   N G MIVK+LKPI T+ L K+ I  F+E+VR  M   LKE+GY
Sbjct: 188 VVVSNTSTLMSPKYGVLNRGRMIVKILKPISTENLTKDKIGEFAEQVRDQMVTTLKEIGY 247

Query: 246 CPANNITSLPPVVLE 260
            PA N T+LPP  +E
Sbjct: 248 SPAINDTTLPPQAIE 262

>CAGL0I04070g Chr9 complement(356476..357390) [915 bp, 304 aa] {ON}
           similar to uniprot|P33333 Saccharomyces cerevisiae
           YDL052c SLC1 fatty acyltransferase
          Length = 304

 Score =  334 bits (856), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 156/261 (59%), Positives = 199/261 (76%)

Query: 5   VLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKII 64
            LYYLR    ++IL +AA YG + S+  T+IGKQHL+Q+ TARFYY  M   MGIDVKII
Sbjct: 7   ALYYLRTVSWVLILMVAAAYGTVASVFLTLIGKQHLAQWATARFYYYAMSMLMGIDVKII 66

Query: 65  GEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLD 124
            E+ L   P++ +SNHQS LD+L +G+ FP GCTVTAK +LK  P LGWFM+LSGT FLD
Sbjct: 67  NEDVLKGKPFIAVSNHQSTLDILFLGRIFPQGCTVTAKKSLKYVPFLGWFMALSGTYFLD 126

Query: 125 RTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPIV 184
           R++R KSV+TLN  L NI++ KRA+ IFPEGTRSYST   +LPFKKGAFHLAQQG++PIV
Sbjct: 127 RSNREKSVSTLNRGLQNIREKKRALWIFPEGTRSYSTTPKILPFKKGAFHLAQQGQIPIV 186

Query: 185 PVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKELG 244
           PVV++NTS+++  K+  FN GC+  KVL PIPTK LKKE++   +EKVR++MEKE+ +LG
Sbjct: 187 PVVISNTSTIMCSKYNVFNRGCITCKVLDPIPTKDLKKEEVGELAEKVRNMMEKEIMDLG 246

Query: 245 YCPANNITSLPPVVLELQKKN 265
           Y  A N T+LPP  +E  +KN
Sbjct: 247 YSKAINDTNLPPEAIEYMQKN 267

>Kpol_483.2 s483 (1245..2039) [795 bp, 264 aa] {ON} (1245..2039)
           [795 nt, 265 aa]
          Length = 264

 Score =  330 bits (847), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 157/263 (59%), Positives = 201/263 (76%), Gaps = 2/263 (0%)

Query: 4   NVLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKI 63
           + LYYLR   ++VIL IAA+YG++ S+LCTI+ K   SQY+ ARFYY++MKY  GIDVK+
Sbjct: 3   SALYYLRVVYSVVILVIAALYGVVASMLCTILNKSEYSQYVCARFYYSVMKYFFGIDVKV 62

Query: 64  IGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFL 123
           I E  L  LP++ +SNHQS LD+LM+GK FPPGCT+TAK +L   P+ GWFM  SGT F+
Sbjct: 63  INEHYLRNLPFIAVSNHQSTLDILMLGKCFPPGCTITAKKSLSYIPVFGWFMIASGTYFI 122

Query: 124 DRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPI 183
           +RT+R KSV TLN  L ++K  KR + IFPEGTRSY+T+L MLPFKKGAFHLAQQG +PI
Sbjct: 123 ERTNREKSVKTLNRGLQDVKDKKRGLWIFPEGTRSYTTDLTMLPFKKGAFHLAQQGGIPI 182

Query: 184 VPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKE- 242
           +P+VV+NTS+L+S KW  FN GC+ VKVL+PIPT+ LK ED++ F+E VR  M KELKE 
Sbjct: 183 LPIVVSNTSTLMSPKWGVFNRGCITVKVLEPIPTENLKPEDVSEFAETVREKMIKELKEN 242

Query: 243 LGYCPANNITSLPPVVLELQKKN 265
           +GY    N TS+PP + E +K N
Sbjct: 243 VGYSDYVNDTSIPPGI-EDKKTN 264

>TPHA0B00910 Chr2 complement(210738..211532) [795 bp, 264 aa] {ON}
           Anc_4.226 YDL052C
          Length = 264

 Score =  322 bits (826), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 153/256 (59%), Positives = 199/256 (77%), Gaps = 1/256 (0%)

Query: 4   NVLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKI 63
           + LYY R  L +++L I+A+YG IVS++CT++ KQ  SQYL ARF+Y +MK   GIDVK+
Sbjct: 3   SALYYARFVLFIILLMISALYGAIVSVICTLVNKQEYSQYLCARFFYFVMKNFFGIDVKV 62

Query: 64  IGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFL 123
           I E+ +S LPY+++SNHQS LD+LM+G+ FPPGCTVTAK +LK  P LGWFMSLSGT FL
Sbjct: 63  INEQYISNLPYIVVSNHQSTLDILMLGRMFPPGCTVTAKKSLKWIPFLGWFMSLSGTYFL 122

Query: 124 DRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPI 183
           +RT+R KSV TLN  L  +K  K+A+ IFPEGTRSY+T+L +LPFKKGAFHLAQQG++PI
Sbjct: 123 ERTNREKSVATLNRGLQAVKDEKKALWIFPEGTRSYTTDLEILPFKKGAFHLAQQGKIPI 182

Query: 184 VPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKE- 242
           +PVVV+NTS+L++ K   FN GC+ VKVL+PI T+ LK ED+  FSEK+R  M KELKE 
Sbjct: 183 LPVVVSNTSTLMNPKNGVFNRGCITVKVLEPISTENLKPEDVGTFSEKIREKMLKELKEN 242

Query: 243 LGYCPANNITSLPPVV 258
           +GY    N T++P  +
Sbjct: 243 VGYSEYINDTNIPATI 258

>KLTH0D13772g Chr4 (1122242..1123342) [1101 bp, 366 aa] {ON} similar
           to uniprot|P33333 Saccharomyces cerevisiae YDL052C SLC1
           fatty acyltransferase
          Length = 366

 Score =  322 bits (826), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 149/253 (58%), Positives = 200/253 (79%)

Query: 6   LYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKIIG 65
           +YY R  L + +LS  A+YG++ SI+ + IGK+HL+Q+ TAR +Y +M   +GI+V++I 
Sbjct: 8   VYYSRSVLGVTLLSTCALYGVVASIVLSCIGKRHLAQWTTARSFYYVMGTFLGIEVEVIN 67

Query: 66  EENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDR 125
           EENL KLP +L++NHQS LD+LM+G+ FPPGCTVTAK +LK  P LGWFM LSG++FL+R
Sbjct: 68  EENLKKLPAILVANHQSALDILMLGRIFPPGCTVTAKSSLKWVPFLGWFMMLSGSLFLER 127

Query: 126 TDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPIVP 185
            +R KSV TLNN+L  ++  KRAV IFPEGTRS+ST+L +LPFKKGAFHLAQQG++PIVP
Sbjct: 128 GNREKSVRTLNNALDVMRTKKRAVWIFPEGTRSHSTKLGLLPFKKGAFHLAQQGKIPIVP 187

Query: 186 VVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKELGY 245
           +VV+NTS+L++ K+K FN G + VKVL PIPT  LKKED+TAF+++V  +M KE++ LGY
Sbjct: 188 IVVSNTSTLMNSKYKVFNRGVITVKVLDPIPTDDLKKEDVTAFTKRVEELMLKEVENLGY 247

Query: 246 CPANNITSLPPVV 258
             A   T+LPP V
Sbjct: 248 SDAMLDTNLPPEV 260

>TDEL0E01460 Chr5 complement(290087..290977) [891 bp, 296 aa] {ON}
           Anc_4.226 YDL052C
          Length = 296

 Score =  315 bits (806), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 147/263 (55%), Positives = 201/263 (76%)

Query: 4   NVLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKI 63
           +++YY R  LA VI+   +++G+I S++ T++GKQ+L+Q+ TAR +Y  M    GIDV++
Sbjct: 6   SLIYYTRSFLAAVIICGGSVFGVIASVVLTLVGKQYLAQWATARCFYYSMALFFGIDVRV 65

Query: 64  IGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFL 123
             E+ L+ LP ++ISNHQS LD+ M+G+ FP GCTVTAK +LK  P LGWFM+LSGT+FL
Sbjct: 66  ENEQYLNNLPCIIISNHQSALDIFMLGRLFPRGCTVTAKKSLKYVPFLGWFMALSGTLFL 125

Query: 124 DRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPI 183
           +R++RTKSV TLN  L  IK+ KRA+ IFPEGTRSY+T+L MLPFKKGAFHLAQQG+LPI
Sbjct: 126 ERSNRTKSVETLNGGLRKIKEKKRAIWIFPEGTRSYTTDLDMLPFKKGAFHLAQQGKLPI 185

Query: 184 VPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKEL 243
           VP+VV+NTS+L++ K   +N G ++ +VLKPI T+ LKKED+  F E+VR  M  EL+ L
Sbjct: 186 VPIVVSNTSTLMNPKLSIYNRGYIVARVLKPISTENLKKEDVGKFCEQVRDNMLSELQTL 245

Query: 244 GYCPANNITSLPPVVLELQKKNL 266
           GY PA N T+LPP  +E ++K +
Sbjct: 246 GYSPAINDTTLPPQAIEYERKKI 268

>Kwal_26.9326 s26 (1165510..1166574) [1065 bp, 354 aa] {ON} YDL052C
           (SLC1) - putative 1-acyl-sn-gylcerol-3-phosphate acyl
           transferase [contig 72] FULL
          Length = 354

 Score =  315 bits (808), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 144/251 (57%), Positives = 195/251 (77%)

Query: 6   LYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKIIG 65
           +YY +  L + +LS  A+YG++ SI+ T IGKQHL+Q+ TAR +Y +M   +G+DV++I 
Sbjct: 8   VYYGKSILGVTLLSTCALYGVVASIVLTCIGKQHLAQWTTARSFYYIMGTFLGVDVEVIN 67

Query: 66  EENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDR 125
            ENL KLP + +SNHQS LD+LM+G+TFP GCTVTAK +LK  P LGWFMSLSGT+FL+R
Sbjct: 68  AENLEKLPAIFVSNHQSALDILMLGRTFPQGCTVTAKSSLKWMPFLGWFMSLSGTLFLER 127

Query: 126 TDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPIVP 185
            +R KSV TLN +L N+   KRA+ +FPEGTRS+ST+  +LPFKKGAFHLAQQG++PIVP
Sbjct: 128 GNRKKSVETLNKALANLSSKKRALWVFPEGTRSHSTKPCLLPFKKGAFHLAQQGKIPIVP 187

Query: 186 VVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKELGY 245
           VVV+NTS++++ K+  FN G + VKVL PI T+ LKKED+TAF+ +V+ +ME+E++ LGY
Sbjct: 188 VVVSNTSTIMNSKYHVFNRGVITVKVLDPISTEDLKKEDVTAFTHRVQELMEREVENLGY 247

Query: 246 CPANNITSLPP 256
                 T+LPP
Sbjct: 248 SDVIMDTNLPP 258

>ZYRO0B07326g Chr2 complement(575727..576593) [867 bp, 288 aa] {ON}
           similar to uniprot|P33333 Saccharomyces cerevisiae
           YDL052C SLC1 fatty acyltransferase
          Length = 288

 Score =  311 bits (798), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 145/253 (57%), Positives = 191/253 (75%), Gaps = 2/253 (0%)

Query: 5   VLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTAR-FYYTLMKYGMGIDVKI 63
            LYY R TLA  +L   ++YG++ SI+ T++GKQHL+Q+ TAR FYY  + + +GIDVK+
Sbjct: 5   ALYYFRFTLATAVLCGCSLYGVVASIVLTLVGKQHLAQWATARCFYYASILF-LGIDVKV 63

Query: 64  IGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFL 123
             E  L   PY+++SNHQS LD+LM+G+ FP GCTVT+K +LK  P LGWFM+LSGT+FL
Sbjct: 64  ENEHYLENKPYIIVSNHQSTLDILMLGRVFPQGCTVTSKKSLKYTPFLGWFMTLSGTLFL 123

Query: 124 DRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPI 183
           +R +R KSV TLN SL  +KK KRA+ IFPEGTRSY+T L++LPFKKGAFHLA+QG+LPI
Sbjct: 124 ERANRQKSVETLNRSLDVLKKEKRALWIFPEGTRSYTTNLNILPFKKGAFHLARQGKLPI 183

Query: 184 VPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKEL 243
           VPVVV+NTS+L++HKWK FN GC++ +V+KPI    L  ED+  FSE +R  M  EL++L
Sbjct: 184 VPVVVSNTSTLMNHKWKVFNKGCIVARVMKPISVDDLTTEDVGKFSEDLREKMLTELQDL 243

Query: 244 GYCPANNITSLPP 256
            Y  A   T +PP
Sbjct: 244 AYSQATVDTHIPP 256

>SAKL0H03762g Chr8 complement(349686..350702) [1017 bp, 338 aa] {ON}
           similar to uniprot|P33333 Saccharomyces cerevisiae
           YDL052C SLC1 fatty acyltransferase
          Length = 338

 Score =  311 bits (796), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 145/260 (55%), Positives = 197/260 (75%), Gaps = 2/260 (0%)

Query: 1   MGL--NVLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMG 58
           MGL   +++Y +  +A+ +L   A+YG+I SI+   IGK+HL+Q+ TAR +Y +M    G
Sbjct: 1   MGLISKLVFYTKSIVAVALLGSCALYGVIASIVLGCIGKRHLAQWTTARSFYNVMGPVFG 60

Query: 59  IDVKIIGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLS 118
           +++K+I  ENL KLP + +SNHQSELD+LM+G+TFP GCTVTAK +LK  P LGWFM+LS
Sbjct: 61  VEIKVINPENLEKLPAIFVSNHQSELDILMLGRTFPQGCTVTAKQSLKYVPFLGWFMALS 120

Query: 119 GTVFLDRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQ 178
           GT+FLDR++R KSV TLN +L  +   KRA+ +FPEGTRSY+T++ MLPFKKGAFHLAQQ
Sbjct: 121 GTLFLDRSNRKKSVATLNKALQELSTKKRAIWVFPEGTRSYTTKVCMLPFKKGAFHLAQQ 180

Query: 179 GELPIVPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEK 238
           G++PIVPV+V+NTS++ + K   FN G ++VKVL PIPT+ LKKE++  F+ KVR +ME+
Sbjct: 181 GKIPIVPVIVSNTSTIFNPKLGIFNRGTIVVKVLDPIPTEDLKKEEVGEFTNKVRDLMER 240

Query: 239 ELKELGYCPANNITSLPPVV 258
           EL+ L Y  A N T LP  V
Sbjct: 241 ELENLKYSKAINDTGLPEEV 260

>SAKL0E05742g Chr5 (473086..474024) [939 bp, 312 aa] {ON} similar to
           uniprot|P33333 Saccharomyces cerevisiae YDL052C SLC1
           fatty acyltransferase
          Length = 312

 Score =  302 bits (774), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 145/261 (55%), Positives = 195/261 (74%), Gaps = 2/261 (0%)

Query: 1   MGLN--VLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMG 58
           MGL+  ++YY R T+A+V+L + A+YG+  SI+    G +HL+Q+ TAR +Y ++   +G
Sbjct: 1   MGLSRSLIYYTRSTVAIVLLCLCALYGVFASIVLICFGNRHLAQWTTARSFYYVIGSALG 60

Query: 59  IDVKIIGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLS 118
           I VK+I  ENL KLP +L++NHQSELDVL++G+ FP GCTVTAK +LK  P LGWFM+LS
Sbjct: 61  IKVKVINGENLKKLPAILVANHQSELDVLILGRVFPRGCTVTAKNSLKYVPFLGWFMTLS 120

Query: 119 GTVFLDRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQ 178
           GT+FL R +   S+ TLN +L  ++  KRA+ +FPEGTR YST+L  +PFKKGAFHLAQQ
Sbjct: 121 GTLFLKRGNTKNSIATLNKALKELRSEKRALWVFPEGTRPYSTKLCTVPFKKGAFHLAQQ 180

Query: 179 GELPIVPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEK 238
           G++PIVPV+++NTS++LS K   FN G + VKVL PI T+ L KE +TAFSEKVR +M+K
Sbjct: 181 GKIPIVPVIISNTSTILSPKLGIFNRGTITVKVLDPISTEDLTKEGVTAFSEKVRDLMDK 240

Query: 239 ELKELGYCPANNITSLPPVVL 259
           E+K+LGY  A N T LP   L
Sbjct: 241 EIKKLGYSEACNDTGLPKETL 261

>TBLA0A08150 Chr1 complement(2013023..2013823) [801 bp, 266 aa] {ON}
           Anc_4.226 YDL052C
          Length = 266

 Score =  295 bits (755), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 193/257 (75%), Gaps = 2/257 (0%)

Query: 1   MGLNVLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGID 60
           MG N  YY R     ++L ++A+YG I SI+  +IGK+HLSQ+ TARFYY L+KY +GI+
Sbjct: 1   MG-NFKYYFRTVTLSLLLLVSALYGTIASIVLNVIGKKHLSQWATARFYYNLVKYVLGIE 59

Query: 61  VKIIGEENLSK-LPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSG 119
           +++I E+ L+K +P + +SNHQS LD+LM+G+ FP GCTVTAK +LK  P LGWFM+LSG
Sbjct: 60  IRVINEDILTKHVPCIFVSNHQSTLDILMLGRMFPKGCTVTAKKSLKYIPFLGWFMALSG 119

Query: 120 TVFLDRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQG 179
           T FL+R+ R KSV TLN  L ++K+ K+++ IFPEGTRSYS +L + PFKKGAFHLAQQG
Sbjct: 120 TYFLERSSREKSVATLNKGLEDVKRKKQSLWIFPEGTRSYSQDLIIAPFKKGAFHLAQQG 179

Query: 180 ELPIVPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKE 239
           +LPIVP+VV+NTS++++ KWK FN G ++VKVL P+ T  L  E ++ FS ++  +M  E
Sbjct: 180 KLPIVPIVVSNTSTVVASKWKVFNRGEIVVKVLPPMATDQLSSEGVSKFSTEIHDLMVNE 239

Query: 240 LKELGYCPANNITSLPP 256
           L+ +GY    N T+LPP
Sbjct: 240 LQTIGYSKVINDTNLPP 256

>KLLA0E01233g Chr5 complement(127544..128491) [948 bp, 315 aa] {ON}
           similar to uniprot|P33333 Saccharomyces cerevisiae
           YDL052C SLC1 fatty acyltransferase
          Length = 315

 Score =  295 bits (754), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 191/255 (74%)

Query: 5   VLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKII 64
           ++++ +  +A+ +LS  A+YG++ SI+ ++IGK+HL+Q+ TAR +Y +M + MGI + +I
Sbjct: 7   IVFWGKSVIAVTLLSSCALYGVLASIVFSLIGKKHLAQWSTARCFYGVMGFIMGIKINLI 66

Query: 65  GEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLD 124
             E L+ LP + ISNHQSELD+LM+G+TFPPGCTVTAK  +K  P+LGWFMSLSGT+FLD
Sbjct: 67  NGERLNDLPAIFISNHQSELDILMLGRTFPPGCTVTAKKQIKWVPLLGWFMSLSGTLFLD 126

Query: 125 RTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPIV 184
           R+ R K++  LN+SL N+KK+KRA+ IFPEGTRSYST+L +  FKKGAFHLAQQG++ I+
Sbjct: 127 RSSREKAIKVLNDSLANLKKDKRALWIFPEGTRSYSTKLELSAFKKGAFHLAQQGKIQII 186

Query: 185 PVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKELG 244
           PVVV+NTSS+   +   FN G + VKVL+PI T+ LKKED+     +V  +M  ELK +G
Sbjct: 187 PVVVSNTSSIYHPRSGVFNRGTITVKVLEPISTENLKKEDVGDLCNRVHKLMNDELKNIG 246

Query: 245 YCPANNITSLPPVVL 259
           Y  A   T LP  V+
Sbjct: 247 YSEAIVDTVLPADVI 261

>AFR592W Chr6 (1503183..1504142) [960 bp, 319 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL052C (SLC1)
          Length = 319

 Score =  290 bits (741), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 193/256 (75%), Gaps = 1/256 (0%)

Query: 5   VLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKII 64
           V++Y +  +A++++S  A+YG++ S++ +++GK+HL+Q+ TAR +Y  +   +GI++K+I
Sbjct: 47  VIFYAKSAVAVLLVSTCAVYGMVASVVLSVVGKRHLAQWTTARAFY-FLGGCLGINIKLI 105

Query: 65  GEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLD 124
             E L +LP V++SNHQSELD+L++G+ FPPGCTVTAK +L+  PILGWFM+LSGTVFLD
Sbjct: 106 NAERLGQLPAVIVSNHQSELDILLLGRAFPPGCTVTAKESLRWVPILGWFMALSGTVFLD 165

Query: 125 RTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPIV 184
           R++R+KS+ +LN SL  +K+N++A  IFPEGTRSY+TE+ +LPFKKGAFHLAQQ ++P++
Sbjct: 166 RSNRSKSLKSLNASLERLKRNRQAAWIFPEGTRSYTTEMQLLPFKKGAFHLAQQAQIPVI 225

Query: 185 PVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKELG 244
           PVV+ NTS++ + +   FN G +  KVL+PI T  + K+D+      V++ M+ E + LG
Sbjct: 226 PVVMCNTSTVFNPRLGIFNRGTITAKVLEPIDTANMTKDDVDKLVSDVQAKMQAEFEALG 285

Query: 245 YCPANNITSLPPVVLE 260
           Y PA   TSLP   L 
Sbjct: 286 YAPAIVDTSLPEEALR 301

>Ecym_2773 Chr2 (1503107..1503964) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AFR592W
          Length = 285

 Score =  281 bits (718), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 133/250 (53%), Positives = 188/250 (75%), Gaps = 1/250 (0%)

Query: 7   YYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKIIGE 66
           +Y +  LA+V+LS  ++YG++ ++L +++GK+ L+Q+ TAR +  ++   +G++VK+I  
Sbjct: 9   FYAKSVLAVVLLSSCSLYGVVAAVLLSLVGKRRLAQWTTARAFNYIVGPAIGVNVKVINA 68

Query: 67  ENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDRT 126
           + + K+P V +SNHQSELD+L++GK F PGCTVTAK +LK  P+LGWFM LSGTVFL+R+
Sbjct: 69  DKI-KVPAVFVSNHQSELDILVLGKIFVPGCTVTAKESLKWVPLLGWFMYLSGTVFLNRS 127

Query: 127 DRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPIVPV 186
           +R KSV TL ++L ++K++KRA+ I+PEGTRSYST+L MLPFKKGAFHLAQQ ++PI+PV
Sbjct: 128 NREKSVGTLKSALESLKRDKRALWIYPEGTRSYSTKLKMLPFKKGAFHLAQQAQIPIIPV 187

Query: 187 VVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKELGYC 246
           VV+NTS+L   K   FNSG M  KVL PI T+ LKKEDI    E V  +M+ E + +GY 
Sbjct: 188 VVSNTSTLFCPKLGIFNSGVMTCKVLDPISTQDLKKEDIGELVEDVYQLMQTEYENMGYS 247

Query: 247 PANNITSLPP 256
            A   + LPP
Sbjct: 248 EAVPGSELPP 257

>Kpol_472.1 s472 complement(175..1035) [861 bp, 286 aa] {ON}
           complement(175..1035) [861 nt, 287 aa]
          Length = 286

 Score =  266 bits (680), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 183/257 (71%), Gaps = 1/257 (0%)

Query: 1   MGLNVLYYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGID 60
           +G +++Y ++  + +  L   AI G+I SIL ++IG +H+SQ++T + YYT++   +G++
Sbjct: 3   VGSSIVYNVKTGICIFALGFCAILGMISSILLSLIGYRHISQFVTTKTYYTIVSALLGVE 62

Query: 61  VKIIGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGT 120
           VK+I E+NL   P + + NHQS LD +++GK FPPGCT+TAK +LK  PILGWF+SLSGT
Sbjct: 63  VKVINEKNLDNQPCIYVCNHQSSLDAIILGKLFPPGCTITAKKSLKYVPILGWFLSLSGT 122

Query: 121 VFLDRTDRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGE 180
           + +DR +  + + TLN SL  + K+KR++ IF EGTRSYS  L MLPFKKGAFHLA QG+
Sbjct: 123 LLIDRKNTAEGIATLNKSLEELVKHKRSLWIFAEGTRSYSESLDMLPFKKGAFHLALQGK 182

Query: 181 LPIVPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKEL 240
           +PIVP+VV+NTS+L + ++  FN G ++VKVL PIPT  L K+ +  FSE V + M  EL
Sbjct: 183 IPIVPIVVSNTSNLQNGRYHIFNRGTVVVKVLDPIPTTKLTKDKVGEFSEMVHNKMLNEL 242

Query: 241 -KELGYCPANNITSLPP 256
            K +GY      ++LPP
Sbjct: 243 RKNVGYSQLEEGSTLPP 259

>TPHA0B02370 Chr2 complement(544512..545495) [984 bp, 327 aa] {ON}
           Anc_4.226 YDL052C
          Length = 327

 Score =  267 bits (683), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 178/240 (74%)

Query: 7   YYLRCTLALVILSIAAIYGIIVSILCTIIGKQHLSQYLTARFYYTLMKYGMGIDVKIIGE 66
           +Y +  L+ +++S +++ G+  SI+ +I+GK++++Q+ TARF+Y + +  +GIDVK+   
Sbjct: 9   FYYKSFLSFIVVSCSSVVGVFASIILSIVGKKYIAQWATARFFYYMYRTLLGIDVKVTSP 68

Query: 67  ENLSKLPYVLISNHQSELDVLMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDRT 126
           +NL  LP + +SNHQS LD+++IGK FP  CTVTAK +LK  P LGW+MSLSGT+FLDR 
Sbjct: 69  QNLENLPCIFVSNHQSALDIMVIGKCFPRNCTVTAKKSLKYVPFLGWYMSLSGTLFLDRK 128

Query: 127 DRTKSVTTLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPIVPV 186
           +   S+  + NSL N+   KRA+ +FPEGTR  S +L MLPFKKGAFH+AQQG++PIVPV
Sbjct: 129 NGASSIVAMKNSLFNVLVQKRALWVFPEGTRCSSEQLEMLPFKKGAFHMAQQGKIPIVPV 188

Query: 187 VVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKELGYC 246
           VV+NTS+L + K   FN G ++VKVL PI T+ LK E++  F+ KV+  M KELKELG+C
Sbjct: 189 VVSNTSNLFNKKHSIFNRGNIVVKVLDPISTQDLKSEEVADFANKVQEKMLKELKELGFC 248

>TPHA0M00870 Chr13 complement(171415..172566) [1152 bp, 383 aa] {ON}
           Anc_3.244 YBR042C
          Length = 383

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 51/111 (45%), Gaps = 21/111 (18%)

Query: 66  EENLSKLPYVLISNHQSELDVLMIGK-----TFPPGCTVTAKGALKRAPILGWFMSLSGT 120
           E NL++   + I+NHQ   D + + K      F     + AK ALK+ PI G+ M+    
Sbjct: 97  ESNLNQRS-IFIANHQLYTDWIYLWKIAYTSNFGGDVYIFAKKALKKIPIFGYAMTNYNF 155

Query: 121 VFLDRT---DRT----KSVTTLNNSLTNIKKNKRA--------VCIFPEGT 156
           +FLDR    D+     K ++ LN S  + K    A          IFPEGT
Sbjct: 156 IFLDRNWVKDKNIIIRKLISILNYSTISNKNENDASSRNLPYCFIIFPEGT 206

>KNAG0A07870 Chr1 (1253496..1254542) [1047 bp, 348 aa] {ON}
           Anc_3.478 YPR140W
          Length = 348

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 81/199 (40%), Gaps = 39/199 (19%)

Query: 74  YVLISNHQSELDVLMIGKTFP----------PGCTVTAKGALKRAPILGWFMSLSGTVFL 123
           +V I NH S +D   +    P            C + AK       I G F SL   +  
Sbjct: 71  FVTIMNHSSVVDDPFVWACLPLKMYANLQNIRWC-LGAKNICFSNCIYGNFFSLGQVLPT 129

Query: 124 DRTDRTKSVTTLNNSL----TNIKKNKRAVCIFPEG-----TRSYSTELHMLPFKKGAFH 174
           +R  +      ++ S+    +  K++   V IFPEG      + Y+  +    F+ G   
Sbjct: 130 ERFGKGPFQDAIDGSIAILNSQWKRHSSWVHIFPEGYVLQLQQPYNNSMRY--FRWGVSR 187

Query: 175 LAQQGELP--IVPVVV---------ANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKE 223
           +  + + P  ++P+           +N  ++  + WKT  S   I  V +P+P      E
Sbjct: 188 MILETDRPPVVLPIFTTGFEKMFTESNDVNIFKNTWKTMGSTAKI-SVGQPVPD-----E 241

Query: 224 DITAFSEKVRSIMEKELKE 242
            I  + E+ +++M+K LKE
Sbjct: 242 IIVRYREQWKTLMDKHLKE 260

>Skud_4.270 Chr4 complement(473227..474453) [1227 bp, 408 aa] {ON}
           YDR018C (REAL)
          Length = 408

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 75  VLISNHQSELDVLMIG-----KTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDRTDRT 129
           V+++NHQ   D + +              +  K ALK  P+LG+ M     +FL R  R 
Sbjct: 119 VIMANHQMYADWIYLWWLSSISNLGGNVFIILKKALKYVPLLGFGMQNFKFIFLSRNWR- 177

Query: 130 KSVTTLNNSLTNIKKNKR 147
           K  TTL N+L ++  N R
Sbjct: 178 KDETTLTNNLVSMDLNAR 195

>KLTH0C08096g Chr3 (690559..691761) [1203 bp, 400 aa] {ON} similar
           to uniprot|P38226 Saccharomyces cerevisiae YBR042C
           Hypothetical ORF
          Length = 400

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 6/80 (7%)

Query: 75  VLISNHQSELDVLMIGKTFPPG-----CTVTAKGALKRAPILGWFMSLSGTVFLDRTDRT 129
           VLISNHQ   D + +      G       +  K +L + PI+G+ M     +F++R   +
Sbjct: 107 VLISNHQIYTDWVFLWWLAYTGDLAGNVYIMLKNSLAKIPIMGYGMRNYNFIFMNRK-WS 165

Query: 130 KSVTTLNNSLTNIKKNKRAV 149
           K    L N L N+  N R V
Sbjct: 166 KDRINLANHLGNLDHNARGV 185

>Ecym_7454 Chr7 (931514..932998) [1485 bp, 494 aa] {ON} similar to
           Ashbya gossypii ADL305C
          Length = 494

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 136 NNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGAFHLAQQGELPIVPVVVANTSSLL 195
           N+SL+ I K KR + IFP  TRSY+ +L       G      +    + P ++A TS  L
Sbjct: 27  NSSLSYIGKMKRVIDIFPRFTRSYAVKLAKTISVNGKTFETSESHTNVTPSIIALTSRSL 86

>Kwal_56.22943 s56 complement(340249..341478) [1230 bp, 409 aa] {ON}
           YBR042C - Hypothetical ORF [contig 184] FULL
          Length = 409

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 75  VLISNHQSELDVLMIG-----KTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDRTDRT 129
           VLISNHQ   D + +              +  K AL+  PI+G+ M     +F++R   +
Sbjct: 114 VLISNHQIYTDWVFLWWLAYTGNLAGNVFIMLKKALESIPIMGYGMRNYKFIFMNRK-WS 172

Query: 130 KSVTTLNNSLTNIKKNKRAVCI 151
           K    L N L+++  N R V +
Sbjct: 173 KDKINLGNRLSDMDHNARGVGV 194

>Smik_4.252 Chr4 complement(463285..464523) [1239 bp, 412 aa] {ON}
           YDR018C (REAL)
          Length = 412

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 6/92 (6%)

Query: 75  VLISNHQSELDVLMIG-----KTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDRTDRT 129
           ++I+NHQ   D + +              +  K  LK  P+LG+ M     +FL R +  
Sbjct: 123 IIIANHQMYADWIYLWWLSLVSNLGGNVFIILKKTLKYVPLLGFGMQNFKFIFLSR-NWQ 181

Query: 130 KSVTTLNNSLTNIKKNKRAVCIFPEGTRSYST 161
           K   TL NSL ++  N R +    +    YS 
Sbjct: 182 KDEETLTNSLVSMDMNARCMGPLTDYKNCYSN 213

>Smik_2.160 Chr2 complement(301290..302486) [1197 bp, 398 aa] {ON}
           YBR042C (REAL)
          Length = 398

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 34/80 (42%), Gaps = 6/80 (7%)

Query: 75  VLISNHQSELDVLMIG-----KTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDRTDRT 129
           V I NHQ   D + +        F     +  K +L   PILG+ M     +F+ R    
Sbjct: 107 VAICNHQIYTDWIFLWWLAYTSDFGANVFIILKKSLASIPILGFGMRNYNFIFMSRK-WA 165

Query: 130 KSVTTLNNSLTNIKKNKRAV 149
           +   TL+NSL  +  N R +
Sbjct: 166 QDKITLSNSLAGLDSNARGI 185

>NDAI0C02860 Chr3 complement(659616..660578) [963 bp, 320 aa] {ON}
           Anc_5.141 YGR144W
          Length = 320

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 40  LSQYLTARFYYTLMKYGMGIDVKIIGEENLSKLPYVLISNHQSELDVLMIGKTFPPGCTV 99
           +S+ +T+R+Y  + KY +  DV I+G  +       +I+ ++ +L + +I +   PG   
Sbjct: 43  VSRAMTSRYYQDMDKYAIS-DVVIVGAGSSGLSAAYVIAKNRPDLKIAIIEQNLAPGGGC 101

Query: 100 TAKGALKRAPIL 111
              G L  A +L
Sbjct: 102 WVSGQLLSAMVL 113

>TPHA0A04110 Chr1 (921380..922609) [1230 bp, 409 aa] {ON} Anc_3.244
           YBR042C
          Length = 409

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 75  VLISNHQSELD-VLMIGKTFPPGCT----VTAKGALKRAPILGWFMSLSGTVFLDRTDRT 129
           V+ISNHQ   D V +   T+    +    +  K +L+  P+LG+ M+    +FL+R  +T
Sbjct: 107 VIISNHQIYTDWVFLWWLTYTSNLSGNIYIILKNSLQSIPLLGYGMTNYKFIFLERDWKT 166

Query: 130 KSVTTLN 136
             +T  N
Sbjct: 167 DKLTLHN 173

>NCAS0I01760 Chr9 (325595..326779) [1185 bp, 394 aa] {ON} Anc_3.244
           YBR042C
          Length = 394

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 6/80 (7%)

Query: 75  VLISNHQSELDVLMIG-----KTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDRTDRT 129
           + I NHQ   D +++       T      +  K +L++ P+LG+ M     +F+DR    
Sbjct: 116 ITICNHQIYTDWILLWWLAYTSTLAGKVYIMLKKSLEKIPVLGYGMKNFNFIFMDRK-WA 174

Query: 130 KSVTTLNNSLTNIKKNKRAV 149
               TL+  LT I    R +
Sbjct: 175 SDKGTLDKQLTEIDARARGI 194

>TDEL0D03810 Chr4 (697491..698690) [1200 bp, 399 aa] {ON} Anc_3.244
           YBR042C
          Length = 399

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 6/80 (7%)

Query: 75  VLISNHQSELDV-----LMIGKTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDRTDRT 129
           ++I+NHQ   D      L+          +  K +L+  PILG+ M     +F+ R    
Sbjct: 105 IIIANHQIYTDWVFLWWLLSTSNLASNIFIILKKSLESIPILGYGMRNFRFIFISRR-WV 163

Query: 130 KSVTTLNNSLTNIKKNKRAV 149
           +   TL NSL  I  N R V
Sbjct: 164 QDKITLQNSLGTIDANSRGV 183

>NCAS0A10400 Chr1 complement(2069371..2070525) [1155 bp, 384 aa]
           {ON} Anc_3.244 YBR042C
          Length = 384

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 82/193 (42%), Gaps = 39/193 (20%)

Query: 75  VLISNHQSELDVLMIG-----KTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDR---T 126
           ++ SNHQ  +D ++I              +  K +L++ P+LG+ M     +F++R    
Sbjct: 110 IIFSNHQLYIDWVIIWWLAHLANLSGNFFILLKKSLEKIPLLGYGMKNYKFIFMNRKWAQ 169

Query: 127 DRT---KSVTTLNNSLTNIKKNKR-------AVCIFPEGTRSYSTELHMLPFKKGAFHLA 176
           D++   +S+  +N +     KNK         + +FPEGT   +  +     +K   +  
Sbjct: 170 DKSLLEQSLGAINTNAIENGKNKDLTNAWGYNILLFPEGTNLCTNGI-----RKNNAYCK 224

Query: 177 QQGELPIVPVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIM 236
           + G  P+  V++ +T+ L             +++ L+P  T   K  D+T     V+   
Sbjct: 225 KMGLKPMKNVLMPHTTGLR-----------FMIQNLQPSLT---KIYDVTIGYSGVKG-- 268

Query: 237 EKELKELGYCPAN 249
           E E  E+ Y   N
Sbjct: 269 EHEFAEIKYSLKN 281

>NDAI0A05890 Chr1 (1336132..1337442) [1311 bp, 436 aa] {ON}
           Anc_3.244 YBR042C
          Length = 436

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 40/89 (44%), Gaps = 6/89 (6%)

Query: 75  VLISNHQSELDVLMIG-----KTFPPGCTVTAKGALKRAPILGWFMSLSGTVFLDRTDRT 129
           ++ISNHQ  +D ++I              +  K +L+  PILG+ M+    +F++R  + 
Sbjct: 148 IIISNHQLYIDWIIIWWMAHISNLSTNFFIILKKSLQNLPILGYGMNNFRFIFMNRKWKL 207

Query: 130 KSVTTLNNSLTNIKKNKRAVCIFPEGTRS 158
              + L   L  I  N   +   P G ++
Sbjct: 208 DQ-SYLKEQLYQINHNAMMMTPIPNGKKN 235

>KAFR0J00890 Chr10 complement(157808..160168) [2361 bp, 786 aa] {ON}
           Anc_2.230 YNL068C
          Length = 786

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 4/76 (5%)

Query: 185 PVVVANTSSLLSHKWKTFNSGCMIVKVLKPIPTKGLKKEDITAFSEKVRSIMEKELKELG 244
           P    NT+  L +K   FNSG      +K  P++G    D   +        EK   E G
Sbjct: 443 PQHDVNTNQQLDYKPNNFNSGLPNRMQVKDQPSQGTVVFDSKPYQTTHNEYQEK--TEFG 500

Query: 245 YCPANNIT--SLPPVV 258
           Y  AN+I   S PP++
Sbjct: 501 YQQANSIPIISQPPIM 516

>TBLA0D05090 Chr4 complement(1260428..1263628) [3201 bp, 1066 aa]
           {ON} Anc_7.433 YPR026W
          Length = 1066

 Score = 30.0 bits (66), Expect = 8.5,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 114 FMSLSGTVFLDRTDRTKSVT-TLNNSLTNIKKNKRAVCIFPEGTRSYSTELHMLPFKKGA 172
           +M +S  +++ + D   ++  T  NS T +K+   A+ ++P G  +  + L+     K  
Sbjct: 601 WMEISKNLYIPKADTNITLEYTGMNSTTKVKQADVALMVYPLGFITDESNLN--DAVKDL 658

Query: 173 F----HLAQQGELPIVPVVVANTSSLLSH 197
           F    H +  G     PV VA  SSLL+H
Sbjct: 659 FYYSEHQSAAGPAMTFPVFVAAASSLLNH 687

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,701,151
Number of extensions: 1090936
Number of successful extensions: 3454
Number of sequences better than 10.0: 49
Number of HSP's gapped: 3549
Number of HSP's successfully gapped: 49
Length of query: 266
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 158
Effective length of database: 41,097,471
Effective search space: 6493400418
Effective search space used: 6493400418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)