Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F002105.711ON65365332990.0
NCAS0G001805.711ON65462225090.0
CAGL0H06699g5.711ON65061522170.0
KLLA0A00418g5.711ON64261921950.0
KLTH0E00836g5.711ON64160021850.0
SAKL0E15114g5.711ON64961421760.0
TPHA0E001505.711ON64660921750.0
KAFR0D021705.711ON66062321710.0
Kwal_55.196495.711ON64160021560.0
TDEL0B020905.711ON64361021520.0
Kpol_1043.775.711ON65762221340.0
Ecym_40105.711ON64459721130.0
YIL155C (GUT2)5.711ON64960421040.0
TBLA0E017505.711ON66560220960.0
AFR295W5.711ON63159720910.0
Skud_9.135.711ON64960120910.0
ZYRO0B16522g5.711ON64365620890.0
Smik_9.145.711ON65260120660.0
Suva_9.325.711ON53854519830.0
KNAG0L021905.711ON64556118980.0
Skud_13.171na 1ON40463742.5
TBLA0A021506.247ON1323165742.6
KNAG0C037707.348ON223117697.2
YHR182W5.56ON785119699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F00210
         (653 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...  1275   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   971   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   858   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   850   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   846   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   842   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   842   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   840   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   835   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   833   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   826   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   818   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   815   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   811   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   810   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   810   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   809   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   800   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   768   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   735   0.0  
Skud_13.171 Chr13 (293952..295166) [1215 bp, 404 aa] {ON} YMR017...    33   2.5  
TBLA0A02150 Chr1 (521470..525441) [3972 bp, 1323 aa] {ON} Anc_6....    33   2.6  
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...    31   7.2  
YHR182W Chr8 (468219..470576) [2358 bp, 785 aa] {ON} Putative pr...    31   9.7  

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score = 1275 bits (3299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/653 (94%), Positives = 618/653 (94%)

Query: 1   MFARRPKXXXXXXXXXXXXXXXVVRRKYHSGTKFNNFQSDFNPYLISPVEDVEINLPSRS 60
           MFARRPK               VVRRKYHSGTKFNNFQSDFNPYLISPVEDVEINLPSRS
Sbjct: 1   MFARRPKTTIFLAATAITAGTLVVRRKYHSGTKFNNFQSDFNPYLISPVEDVEINLPSRS 60

Query: 61  QLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERDDFASGTSSKSTKMAHG 120
           QLWNQLTTKDHQF                    RGLNVALVERDDFASGTSSKSTKMAHG
Sbjct: 61  QLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERDDFASGTSSKSTKMAHG 120

Query: 121 GVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYFYAGC 180
           GVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYFYAGC
Sbjct: 121 GVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYFYAGC 180

Query: 181 KFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIAITAI 240
           KFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIAITAI
Sbjct: 181 KFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIAITAI 240

Query: 241 ENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTILQMD 300
           ENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTILQMD
Sbjct: 241 ENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTILQMD 300

Query: 301 KNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLLDART 360
           KNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLLDART
Sbjct: 301 KNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLLDART 360

Query: 361 TDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRREDVLS 420
           TDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRREDVLS
Sbjct: 361 TDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRREDVLS 420

Query: 421 AWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREMAEET 480
           AWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREMAEET
Sbjct: 421 AWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREMAEET 480

Query: 481 IDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENYGTRS 540
           IDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENYGTRS
Sbjct: 481 IDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENYGTRS 540

Query: 541 TIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEYARTPLDF 600
           TIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEYARTPLDF
Sbjct: 541 TIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEYARTPLDF 600

Query: 601 LMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653
           LMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV
Sbjct: 601 LMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/622 (75%), Positives = 527/622 (84%), Gaps = 2/622 (0%)

Query: 32  TKFNNFQSDFNPYLISPVEDVEINLPSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXX 91
           T F+NFQS   P L+SPV+ ++++LP+RS+L  QL  K  QF                  
Sbjct: 35  TSFHNFQSQHTPGLVSPVDTLQVSLPTRSKLLQQLKEKG-QFDVLIIGGGATGTGCAVDA 93

Query: 92  XXRGLNVALVERDDFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLL 151
             RGL VALVE++DFASGTSSKSTKMAHGGVRYLEKAF Q SKSQLDLVIEALNERAHLL
Sbjct: 94  ATRGLQVALVEQNDFASGTSSKSTKMAHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLL 153

Query: 152 NTAPHLCKILPILIPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLD 211
           NTAPHLCKILPILIPVY YWQ+PYFYAGCK YD FAG+QNLK+SYL+SR NAIE+APML+
Sbjct: 154 NTAPHLCKILPILIPVYTYWQVPYFYAGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLE 213

Query: 212 AANLKAALVYHDGSFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQD 271
           A NLKAALVYHDGSFNDSRLN+++AITAIE GATVLNYVEV+KLLKD  +  I GVTV+D
Sbjct: 214 ATNLKAALVYHDGSFNDSRLNATLAITAIERGATVLNYVEVQKLLKDSETGTINGVTVRD 273

Query: 272 KETGEISNVKSKVIVNATGPYSDTILQMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNP 331
            ETG+  +V SKV+VNATGP+SD ILQMDKN +GLPD  N++PKM +P DISSKIAV NP
Sbjct: 274 IETGDTMDVLSKVVVNATGPFSDKILQMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNP 333

Query: 332 KMVVPSSGVHIILPSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTP 391
            MVVPSSGVHIILPSYYCPKQMGLLD RT+DGRVMFFLPWQGKVIAGTTDIPM+QVP+TP
Sbjct: 334 NMVVPSSGVHIILPSYYCPKQMGLLDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETP 393

Query: 392 VAKETDIQDILKELQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVR 451
           VAKE DIQDILKELQHYIKFPV+REDVLSAWAGIRPLVRDPRL+  D  + LG+TQGLVR
Sbjct: 394 VAKEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVR 453

Query: 452 SHFLFTSDNGLITIAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWD 511
           SHF+FTSDNGL+TIAGGKWTTYREMAEETIDEVVK G F + AKPC T++LKL GAE WD
Sbjct: 454 SHFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKNGAFVD-AKPCITRELKLAGAEFWD 512

Query: 512 PNLVALLSQKFNLSSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNV 571
           PN+ ALLSQK+NL SMMA YLS+NYGTRS IIC+LF  +E+NKLPV LAG E + ILGN 
Sbjct: 513 PNISALLSQKYNLPSMMANYLSDNYGTRSPIICELFLNDEINKLPVLLAGEEKEQILGNT 572

Query: 572 DFNTFRYPITIAELKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFG 631
           DFNTFRYPITI ELKY+M+YEYART LDFLMRRTRFA+LDA +AL AV GTVK+MGDEF 
Sbjct: 573 DFNTFRYPITIGELKYSMRYEYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFN 632

Query: 632 WDSKRREQEIKNATLFIESFGV 653
           W S+RR++E +    FI+SFGV
Sbjct: 633 WSSERRQEEKEKTIQFIKSFGV 654

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/615 (66%), Positives = 501/615 (81%), Gaps = 15/615 (2%)

Query: 45  LISPVEDVEINLPSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERD 104
           LISPVE  ++ LP+R +L ++L+ + +QF                    RGLNVALVE++
Sbjct: 45  LISPVEKPDVKLPTRDELLDKLS-RTNQFDVLIIGGGATGTGCALDAATRGLNVALVEKN 103

Query: 105 DFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPIL 164
           DFASGTSSKSTKMAHGGVRYLEKAF + SK+QLDLVIEALNERAHLLNTAPHLCK+LPI+
Sbjct: 104 DFASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLCKLLPII 163

Query: 165 IPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDG 224
           IPVYNYWQ+PYFYAGCK YD FAG QNLK SYL+S+   +E+APMLD +NLKA LVYHDG
Sbjct: 164 IPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAGLVYHDG 223

Query: 225 SFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKV 284
           SFND+R+N+++A+TAIEN ATVLNY+EV++L+KD +  K+ G  V+D+ETG+  +V++KV
Sbjct: 224 SFNDTRMNATLAVTAIENSATVLNYMEVKQLVKDKDG-KVAGAVVEDRETGKTYSVRAKV 282

Query: 285 IVNATGPYSDTILQMDKNLSGLPD--LANIDPKMYDPN----DISSKIAVSNPKMVVPSS 338
           +VNATGPYSD +LQMD N  GLPD  +   +P + D N     I S++AV+ P MVVPS+
Sbjct: 283 VVNATGPYSDRLLQMDANPDGLPDEVVQKTEP-IIDGNATVKSIMSQVAVTKPNMVVPSA 341

Query: 339 GVHIILPSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDI 398
           GVHIILPS+YCPK+MGLLDA+T+DGRVMFFLPWQGKV+AGTTDIP+ QVP+ P A E DI
Sbjct: 342 GVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPTATEADI 401

Query: 399 QDILKELQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTS 458
           QDILKELQ YIKFPV+REDVLSAWAGIRPLV DPR      ++  G+TQGLVRSHF+FTS
Sbjct: 402 QDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPR----KKSKADGSTQGLVRSHFIFTS 457

Query: 459 DNGLITIAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALL 518
           D+GL+TIAGGKWTTYR MAEETIDEVVK G F   AKPC T+ LKL GAENWDPNL ALL
Sbjct: 458 DHGLVTIAGGKWTTYRAMAEETIDEVVKNGKFD--AKPCITRKLKLAGAENWDPNLPALL 515

Query: 519 SQKFNLSSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRY 578
           +QK++LS  M+ YL+ENYGTR+ +IC++F  +  N+LP+ LA  E  P+LG+VDF++FRY
Sbjct: 516 AQKYHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLGHVDFDSFRY 575

Query: 579 PITIAELKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRRE 638
           PITIAELKYA+KYEYART LDFLMRRTRFA+LDA QAL AV+GTV++MGD  GWD +RR+
Sbjct: 576 PITIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGDSLGWDEQRRQ 635

Query: 639 QEIKNATLFIESFGV 653
            EI+ +T FI++FGV
Sbjct: 636 DEIRYSTEFIKTFGV 650

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/619 (65%), Positives = 498/619 (80%), Gaps = 11/619 (1%)

Query: 35  NNFQSDFNPYLISPVEDVEINLPSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXR 94
           N  Q+D +   +S ++   ++LPSR+ L ++L+  D +F                    R
Sbjct: 35  NTLQNDVS---VSTIKKSNVDLPSRANLLSRLSKTD-KFDVLIIGGGATGTGCALDASTR 90

Query: 95  GLNVALVERDDFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTA 154
           GLNVALVE +DFASGTSSKSTKMAHGGVRYLEKAF + SK+QLDLVIEALNERAH+LNTA
Sbjct: 91  GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTA 150

Query: 155 PHLCKILPILIPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAAN 214
           PHLCKILPI+IPVYNYWQ+PYFY G K YD FAG QNLKSSYL+S   A E+APMLDA+ 
Sbjct: 151 PHLCKILPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASK 210

Query: 215 LKAALVYHDGSFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKET 274
           LKA LVYHDGSFNDSR+NSS+AITAIE GATVLNYV++++L+K+  + K+ G    D+ET
Sbjct: 211 LKAGLVYHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRET 270

Query: 275 GEISNVKSKVIVNATGPYSDTILQMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMV 334
           G+   +K+KV+VNATGPYSD +LQMD++ +GLPD  ++  K+ +   +S+KIAV NPKMV
Sbjct: 271 GDEYQIKAKVVVNATGPYSDRLLQMDQSPTGLPD-DSVLQKINENATVSTKIAVPNPKMV 329

Query: 335 VPSSGVHIILPSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAK 394
           VPS+GVHI+LPS+YCPK++GLLDA+T+DGRVMFFLPWQGKV+AGTTDIPM Q+P+ P A 
Sbjct: 330 VPSAGVHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTAT 389

Query: 395 ETDIQDILKELQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHF 454
           E DIQDILKELQHYI FPV+REDVLSAWAGIRPLV+DPR     A    G+TQ LVRSHF
Sbjct: 390 EADIQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPR----KADSGSGSTQQLVRSHF 445

Query: 455 LFTSDNGLITIAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNL 514
           LFTS + L+TI+GGKWTTYREMAEETIDEVVK G F   +KPC TK LKL+G ENW+PNL
Sbjct: 446 LFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQFN--SKPCVTKKLKLVGGENWNPNL 503

Query: 515 VALLSQKFNLSSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFN 574
            ALLSQK++LSS M+++L+ NYGTR+ +IC+LF  +  NKLPV LAG E+  + G+VD++
Sbjct: 504 SALLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDYD 563

Query: 575 TFRYPITIAELKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDS 634
           +FRYP TI ELKY++KYEYAR  LDFLMRRTR+A+LDA QAL AV+GTVKVMGDE GWDS
Sbjct: 564 SFRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDS 623

Query: 635 KRREQEIKNATLFIESFGV 653
           K+R+ EI+ AT +I++FGV
Sbjct: 624 KKRQDEIQQATEYIKTFGV 642

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/600 (66%), Positives = 483/600 (80%), Gaps = 9/600 (1%)

Query: 56  LPSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERDDFASGTSSKST 115
           +PSRS+L +++   D QF                    RGLNVALVE +DFASGTSSKST
Sbjct: 49  IPSRSELLDKMAKTD-QFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKST 107

Query: 116 KMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPY 175
           KMAHGGVRYLEKAF + SK+QLDLVIEALNER H+LNTAPHLCK+LPI+IPVYNYWQ+PY
Sbjct: 108 KMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPY 167

Query: 176 FYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSI 235
           FY GCK YD FAG QNLKSSY+++ + A E+APMLDA+ LKA LVYHDGSFNDSR+N+++
Sbjct: 168 FYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAAL 227

Query: 236 AITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDT 295
           A+TAIE GATVLNY+EV +LLK+  + ++ G   +D+ETG+   + +KV+VN+TGP+SD 
Sbjct: 228 AVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDR 287

Query: 296 ILQMDKNLSGLP--DLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQM 353
           ILQMD    GLP  DL     + +D   I S++AVSNP+MVVPS+GVHI+LP++YCPKQ+
Sbjct: 288 ILQMDNAKDGLPRNDLVQFANEGHD--SIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQI 345

Query: 354 GLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPV 413
           GLLDA+T+DGRVMFFLPWQGKV+AGTTDIPM QVP+ P A E DIQDILKELQHYIKFPV
Sbjct: 346 GLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPV 405

Query: 414 RREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTY 473
           +REDVLSAWAGIRPLVRDPR + +     + +TQGLVR+HFLFTSDNGL+TIAGGKWTTY
Sbjct: 406 KREDVLSAWAGIRPLVRDPRTLKEG--DDVSSTQGLVRNHFLFTSDNGLVTIAGGKWTTY 463

Query: 474 REMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLS 533
           REMAEETIDEVVK GHF   AKPC TK +KL GAE WDPN VA+L+Q+++LSS MA++L+
Sbjct: 464 REMAEETIDEVVKQGHFQ--AKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLA 521

Query: 534 ENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEY 593
            NYGTRS IIC++F R+E N+LPV   G E+  +  NV+F++FRYP TIAELKY++KYEY
Sbjct: 522 NNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYEY 581

Query: 594 ARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653
            RT LDFLMRRTRF +LDA QAL AVKGTV +MGDE GWD  +R  EI+ A+ FI++FGV
Sbjct: 582 TRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/614 (64%), Positives = 492/614 (80%), Gaps = 12/614 (1%)

Query: 45  LISPVEDVEINLPSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERD 104
           + +PV+  +INLP+R  L ++L+ K +QF                    RGLNVALVE +
Sbjct: 43  VTNPVQKSKINLPTRQDLLSKLS-KTNQFDVLIIGGGATGTGSALDAATRGLNVALVEMN 101

Query: 105 DFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPIL 164
           DFASGTSSKSTKMAHGGVRYLEKAF + SK+QLDLV+EALNERAH+L TAPHLCKILPI+
Sbjct: 102 DFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIM 161

Query: 165 IPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDG 224
           IPVYNYWQ PYFY GCK YD FAG QNLKSSY+++   A E+APMLDA+ LKA LVYHDG
Sbjct: 162 IPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDG 221

Query: 225 SFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKV 284
           SFNDSR+N+++A+TA+E GATVLNY+EV++L+K+  + K+ G   QD+ETGE   +K+KV
Sbjct: 222 SFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKV 281

Query: 285 IVNATGPYSDTILQMDKNLSGLPDLANIDPKMYDPN---DISSKIAVSNPKMVVPSSGVH 341
           +VNATGP+SD ILQMD++  GLPD    D  +   N    ISSK+AV+NP+MVVPS+GVH
Sbjct: 282 VVNATGPFSDRILQMDEDSKGLPD----DRLLQSSNINATISSKVAVANPQMVVPSAGVH 337

Query: 342 IILPSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDI 401
           I+LPS+YCPK++GLLDA+T+DGRVMFFLPWQGKV+AGTTDIPM Q+P+ P A E DIQDI
Sbjct: 338 IVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDI 397

Query: 402 LKELQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLG--TTQGLVRSHFLFTSD 459
           LKELQHYIKFPV+REDVLSAWAGIRPLV+DPR  + +   ++   +TQ LVRSHFLFTSD
Sbjct: 398 LKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSD 457

Query: 460 NGLITIAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLS 519
           N L+TIAGGKWTTYREM+EETI+EVVK G F   AKPC T+ LKL GAEN+DPNL A+L+
Sbjct: 458 NDLVTIAGGKWTTYREMSEETINEVVKVGKFN--AKPCITRKLKLAGAENYDPNLPAMLA 515

Query: 520 QKFNLSSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYP 579
           Q+++LSS MA+YL+ NYGTR+ +IC+LF+ ++ NKLP+   G E+  + GNVDF++FRYP
Sbjct: 516 QEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYP 575

Query: 580 ITIAELKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQ 639
            TI ELKY++  EY RT LDFLMRRTR+A+LDA QAL AV GTVKVMGDE  WDS RR++
Sbjct: 576 FTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQE 635

Query: 640 EIKNATLFIESFGV 653
           E + AT FI++FGV
Sbjct: 636 EREKATEFIKTFGV 649

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/609 (66%), Positives = 483/609 (79%), Gaps = 12/609 (1%)

Query: 45  LISPVEDVEINLPSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERD 104
           L +PV+   +N+P+RS+L N L T D QF                    RGLNVALVE+D
Sbjct: 50  LANPVDSPNVNIPTRSELVNNLKTTD-QFDVLIIGGGATGSGSALDAATRGLNVALVEKD 108

Query: 105 DFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPIL 164
           DFASGTSSKSTKMAHGGVRYLEKA  Q SK+QLDLVIEALNERAHLL TAPHLCKILPI+
Sbjct: 109 DFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIM 168

Query: 165 IPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDG 224
           IPVY YWQ+PYFYAG K YD FAG QNLKSSYL+S+ NA EIAPMLD + LKA LVYHDG
Sbjct: 169 IPVYKYWQVPYFYAGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAGLVYHDG 228

Query: 225 SFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKV 284
           +FNDSR+NS++AITAIENGATVLNY+EV++LLKDP+S+++ G  V+D ETGE   + +KV
Sbjct: 229 TFNDSRMNSTLAITAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKIQINAKV 288

Query: 285 IVNATGPYSDTILQMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIIL 344
           IVNATGPYSD ILQMD N +G PD    +        I++K+AV NP MVVPS+GVHIIL
Sbjct: 289 IVNATGPYSDKILQMDNNKNGKPD----EFTQSAETSIATKVAVQNPHMVVPSAGVHIIL 344

Query: 345 PSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKE 404
           PS+YCP++MGLLDA T+DGRVMFFLPWQGKV+AGTTDIPM  VP+ P A E DIQDILKE
Sbjct: 345 PSFYCPREMGLLDANTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKE 404

Query: 405 LQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLIT 464
           LQHYIKFPV+REDVLSAWAGIRPLV+DPR      T K G TQ LVRSHF+FTSD+GL+T
Sbjct: 405 LQHYIKFPVKREDVLSAWAGIRPLVQDPR-----KTPKEGATQELVRSHFIFTSDHGLVT 459

Query: 465 IAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNL 524
           IAGGKWTTYREMAEETID VVK G F    KPC T+ LKL G EN+DPNL ALL+QK++L
Sbjct: 460 IAGGKWTTYREMAEETIDTVVKNGKFN--VKPCSTRKLKLAGGENYDPNLAALLAQKYHL 517

Query: 525 SSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAE 584
            S ++++L+ NYGTRS +IC +F  ++ N+LP+ LAG E+  + G VDF++FRYP +IAE
Sbjct: 518 PSKLSEHLANNYGTRSPLICDMFVADDHNRLPIYLAGKEENKVYGTVDFDSFRYPYSIAE 577

Query: 585 LKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNA 644
           +KY + +EYART LDFLMRR+RFA+LDA QAL +V+GTVK+MGDE  WD +RR+QE   +
Sbjct: 578 VKYCVHHEYARTTLDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWDEERRKQETDYS 637

Query: 645 TLFIESFGV 653
             +I++FGV
Sbjct: 638 IEYIKTFGV 646

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/623 (64%), Positives = 500/623 (80%), Gaps = 22/623 (3%)

Query: 45  LISPVEDVEINLPSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERD 104
           LISP++   +NLP+R+ L ++L  K +QF                    RGLNVALVE+ 
Sbjct: 46  LISPLDKRSVNLPTRNDLISKLN-KTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKY 104

Query: 105 DFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPIL 164
           DFASGTSSKSTKMAHGGVRYLEKAF + SK+QLDLVIEALNERAHLLNTAPHLCKILPI+
Sbjct: 105 DFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIM 164

Query: 165 IPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDG 224
           IPVYNYWQ+PYFYAGCK YD FAG QNLKSSYL+S+++A ++APMLD   LKA LVYHDG
Sbjct: 165 IPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDG 224

Query: 225 SFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKV 284
           +FNDSR+NS++A+TAIENG+TVLNY+EV++LLK+  S KI G  V+D ETG+  N+K+KV
Sbjct: 225 TFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKV 284

Query: 285 IVNATGPYSDTILQMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIIL 344
           ++NATGPYSD ILQMD+N +GLPD  N++ K    NDI++K++VSNPKMVVPS+GVHIIL
Sbjct: 285 VINATGPYSDAILQMDQNPTGLPDPLNVNLKTN--NDIATKVSVSNPKMVVPSAGVHIIL 342

Query: 345 PSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKE 404
           PS+YCPK +GLLDA+T+DGRVMFFLPWQGKV+AGTTD+PM Q+P+ P A E DIQDILKE
Sbjct: 343 PSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKE 402

Query: 405 LQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLIT 464
           LQHYI+FPV+REDVLSAWAGIRPLV+DPR +  +     G+TQGLVRSHF+FTSD+GL+T
Sbjct: 403 LQHYIRFPVKREDVLSAWAGIRPLVKDPRTLDKNGD---GSTQGLVRSHFIFTSDHGLVT 459

Query: 465 IAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNL 524
           IAGGKWTTYR MAEET+DE +K G FAN  KPC T+D+KL G ENW+PNL ALL+Q+++L
Sbjct: 460 IAGGKWTTYRAMAEETVDEAIKVGKFAN-VKPCITRDIKLAGGENWNPNLQALLAQRYHL 518

Query: 525 SSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAG--------IEDKPIL------GN 570
           SS ++++L++NYGTR+ IIC+++ ++  NKLP+ LA         IE+   L      G+
Sbjct: 519 SSKLSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGD 578

Query: 571 VDFNTFRYPITIAELKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEF 630
           V F  FRYP T+ E+KY++ YEYA T LDFLMRR+RFA+LDA +A+ AV+GTVK+MGDE 
Sbjct: 579 V-FECFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDEL 637

Query: 631 GWDSKRREQEIKNATLFIESFGV 653
            WD  RR +EI+N   +I++FGV
Sbjct: 638 NWDESRRHKEIENTIKYIKTFGV 660

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  835 bits (2156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/600 (66%), Positives = 479/600 (79%), Gaps = 9/600 (1%)

Query: 56  LPSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERDDFASGTSSKST 115
           LP+RS+L  ++  K  QF                    RGLNVALVE +DFASGTSSKST
Sbjct: 49  LPTRSELLEKMA-KTEQFDVLIIGGGATGTGCAVDAATRGLNVALVEMNDFASGTSSKST 107

Query: 116 KMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPY 175
           KMAHGGVRYLEKAF + SK+QLDLVIEALNER H+LNTAPHLCK+LPI+IPVYNYWQ+PY
Sbjct: 108 KMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPY 167

Query: 176 FYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSI 235
           FY GCK YD FAG QNLKSSY++S K A E+APMLDA+ LKA LVYHDGSFNDSR+N+++
Sbjct: 168 FYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAAL 227

Query: 236 AITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDT 295
           A+TAIE GATVLNY+EV +L+K+  S +I G  V+D+ETGE   +K+KV+VN+TGP+SD 
Sbjct: 228 AVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDR 287

Query: 296 ILQMDKNLSGLP--DLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQM 353
           +LQMD    G P  DL     + +D   I S+IAVSNP+MVVPS+GVHI+LP++YCPK++
Sbjct: 288 LLQMDAAKDGKPRNDLVQFANEGHD--SIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEI 345

Query: 354 GLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPV 413
           GLLDA+T+DGRVMFFLPWQGKV+AGTTDIPM QVP+ P A E DIQDILKELQHYIKFPV
Sbjct: 346 GLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPV 405

Query: 414 RREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTY 473
           +R DVLSAWAGIRPL+RDPR I +     + +TQGLVR+HFL+TSDNGL+TIAGGKWTTY
Sbjct: 406 KRGDVLSAWAGIRPLIRDPRTIKEG--DDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTY 463

Query: 474 REMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLS 533
           REMAEETIDEVVK G F   AKPC TK +KL GAE WDPN VA+L+Q+++LSS MA++L+
Sbjct: 464 REMAEETIDEVVKQGKFQ--AKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLA 521

Query: 534 ENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEY 593
            NYGTRS IIC++F+R+E N+LPV   G E+  +  NV+F++FRYP TI ELKY+M+YEY
Sbjct: 522 NNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEY 581

Query: 594 ARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653
            RT LDFLMRRTRF +LDA QAL AV GTV VMGDE GW   RR+ E + A+ FI++FG+
Sbjct: 582 TRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/610 (65%), Positives = 477/610 (78%), Gaps = 12/610 (1%)

Query: 45  LISPVEDVEINLPSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERD 104
           L S V+   + LPSR  L ++L+  D QF                    RGLNVALVE  
Sbjct: 45  LQSAVDTPNVKLPSREDLLSKLSKTD-QFDVLVIGGGATGTGCAVDAATRGLNVALVEMH 103

Query: 105 DFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPIL 164
           DFASGTSSKSTKMAHGGVRYLEKA  Q SK+QLDLVIEALNER H+LNTAPHLCKILPI+
Sbjct: 104 DFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCKILPIM 163

Query: 165 IPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDG 224
           IPVY YWQ+PYFY GCK YD FAG QNLK+SYL++++ A +IAPMLD   LKA LVYHDG
Sbjct: 164 IPVYTYWQIPYFYVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGLVYHDG 223

Query: 225 SFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKV 284
           SFNDSR+N+++A+TAIENGATVLNY+EV++L+KD  + K+ G  V ++ETGE   VK+KV
Sbjct: 224 SFNDSRMNTALAVTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFTVKAKV 283

Query: 285 IVNATGPYSDTILQMDKNLSGLPDLANIDPKMYDPN-DISSKIAVSNPKMVVPSSGVHII 343
            VNATGPYSD +LQMD+N  G P     DP    PN  IS+K+AV NPKMVVPS+GVHII
Sbjct: 284 TVNATGPYSDKLLQMDENKDGKP-----DPTKPLPNATISTKVAVENPKMVVPSAGVHII 338

Query: 344 LPSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILK 403
           LPS+YCP++MGLLD +T+DGRVMFFLPWQGKV+AGTTDIPM QVP TP A E+DIQDIL+
Sbjct: 339 LPSFYCPREMGLLDVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESDIQDILQ 398

Query: 404 ELQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLI 463
           ELQHYIKFPV+REDVLSAWAGIRPLV DPR    +     G+TQGLVRSH  FT+DNG++
Sbjct: 399 ELQHYIKFPVKREDVLSAWAGIRPLVIDPRKSQGNTG---GSTQGLVRSHLCFTTDNGMV 455

Query: 464 TIAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFN 523
           TIAGGKWTTYREMAEETI+EVVK G F    KPC T+ LKL GAENW+PNL ALL+QK++
Sbjct: 456 TIAGGKWTTYREMAEETINEVVKVGKFN--VKPCITRKLKLSGAENWNPNLAALLAQKYH 513

Query: 524 LSSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIA 583
           LS  M+ +LSENYGTR+ +IC++F+ +E N+LPV   G E+  + GNV+F++FRYP TI 
Sbjct: 514 LSGAMSNHLSENYGTRAPLICEMFQEDERNQLPVTFGGRENVTVYGNVNFDSFRYPFTIG 573

Query: 584 ELKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKN 643
           EL Y++ YEY RT LDFLMRRTRFA+LDA QAL AV+GTV VMGD+  WDS RR+ EI+ 
Sbjct: 574 ELNYSVDYEYTRTALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTRRKHEIEK 633

Query: 644 ATLFIESFGV 653
           +  FI +FGV
Sbjct: 634 SKEFIRTFGV 643

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/622 (66%), Positives = 487/622 (78%), Gaps = 19/622 (3%)

Query: 42  NPYLISPVEDVEINLPSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALV 101
           +P   SPV+  ++ LPSR+ L ++L  K +QF                    RGLNVALV
Sbjct: 45  DPSKPSPVDTTDVRLPSRTDLLSKLK-KTYQFDVLIIGGGATGTGCAIDAATRGLNVALV 103

Query: 102 ERDDFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKIL 161
           E++D+ASGTSSKSTKMAHGGVRYLEKA  Q SK+QLDLVIEALNERAHLL TAPHLCKIL
Sbjct: 104 EKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKIL 163

Query: 162 PILIPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVY 221
           PI+IPVY YWQ+PYFY G K YD FAG QNLKSSYL+S+ +A EIAPMLD++ LKA LVY
Sbjct: 164 PIMIPVYQYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLKAGLVY 223

Query: 222 HDGSFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVK 281
           HDGSFNDSR+N+++AI+AIE GATVLNY+EV++L+KD  + K+ G  V+D ETGE   +K
Sbjct: 224 HDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIK 283

Query: 282 SKVIVNATGPYSDTILQMDKNLSGLPDL-------ANIDPKM--YDPNDISSKIAVSNPK 332
           +KVIVNATGPYSDTILQMD N +GLPD+        N+   +    P  IS ++AV NP 
Sbjct: 284 AKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPN 343

Query: 333 MVVPSSGVHIILPSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPV 392
           MVVPS+GVHIILPSYYCP +MGLLDA T DGRVMFFLPWQGKV+AGTTDIPM  VP+ P 
Sbjct: 344 MVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPT 403

Query: 393 AKETDIQDILKELQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRS 452
           A E DIQDILKELQHYIKFPV+REDVLSAWAGIRPLV+DPR+      QK G TQ +VRS
Sbjct: 404 ATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRV------QKGGATQEVVRS 457

Query: 453 HFLFTSDNGLITIAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDP 512
           HF+FTSDNGL+TIAGGKWTTYREMAEETIDEVVK G F   AKPC T+ LKL GAENWD 
Sbjct: 458 HFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFN--AKPCITRKLKLAGAENWDA 515

Query: 513 NLVALLSQKFNLSSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPIL-GNV 571
           NL ALLSQK+N+S+ MA++L+ NYGTRS IIC++ +  + NKLPV LAG E++ I   +V
Sbjct: 516 NLAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHV 575

Query: 572 DFNTFRYPITIAELKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFG 631
            +++FRYP TIAELKY+M YEY RT LDFLMRRTR+A+LDA +AL AV GTVK+MGD   
Sbjct: 576 GYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLN 635

Query: 632 WDSKRREQEIKNATLFIESFGV 653
           WD+ RRE+E   AT +I++FGV
Sbjct: 636 WDNDRREREKVYATDYIKTFGV 657

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/597 (65%), Positives = 478/597 (80%), Gaps = 13/597 (2%)

Query: 57  PSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERDDFASGTSSKSTK 116
           PSR+QL  +L   D QF                    RGLNVAL+E +D+ASGTSSKSTK
Sbjct: 61  PSRAQLLEKLQKTD-QFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTK 119

Query: 117 MAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYF 176
           MAHGGVRYLEKAF + SK+QLDLVIEALNERAH+L+TAPHLCKILPI+IPVY +WQ+PYF
Sbjct: 120 MAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYF 179

Query: 177 YAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIA 236
           Y G K YDFFAG QNLKSSYL+S   A ++APMLDA+ LKA LVYHDGSFNDSR+NS++A
Sbjct: 180 YVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLA 239

Query: 237 ITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTI 296
           +TAIENGAT+LNY+EV++LLK+P + K+ G    D+ETG+  +VK+KV+V+ATGP+SD I
Sbjct: 240 VTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRI 299

Query: 297 LQMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLL 356
           LQM+ +  GLPD  ++  K  +   I++K+AV++PKMVVPSSGVHIILPS+YCPK MGLL
Sbjct: 300 LQMENHPKGLPDDLSLS-KANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLL 358

Query: 357 DARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRRE 416
           DA T+DGRVMFFLPWQGKV+AGTTDIPM QVP+ P A E DIQDILKELQHYIKFPV+RE
Sbjct: 359 DAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRE 418

Query: 417 DVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREM 476
           DV SAWAGIRPLV+DPR    D       TQ LVRSHFLFTSD+GL+TI+GGKWTTYREM
Sbjct: 419 DVQSAWAGIRPLVKDPRKDNSD-------TQDLVRSHFLFTSDSGLVTISGGKWTTYREM 471

Query: 477 AEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENY 536
           A+ETIDEVVK G+F N AKPC T+ +KL+G+ENWDPNL A+LSQ++NL  ++++YLSENY
Sbjct: 472 AQETIDEVVKVGNFVN-AKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENY 530

Query: 537 GTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEYART 596
           GT++  IC++F+ ++ N+LPV LA    +    NVD++ FRYP T+ ELKY ++ EYAR 
Sbjct: 531 GTKAAAICEIFQSDKRNQLPVSLAA---EKAAANVDYDAFRYPFTVGELKYNIRNEYARK 587

Query: 597 PLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653
           PLDFLMRRTR+A+LDA QA+ AV GTVK+MGDE GWDS +RE E K A  FI++FGV
Sbjct: 588 PLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/604 (65%), Positives = 470/604 (77%), Gaps = 16/604 (2%)

Query: 58  SRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERDDFASGTSSKSTKM 117
           SR  L ++L  K HQF                    RGLNVALVE+ DFASGTSSKSTKM
Sbjct: 54  SRRDLLDRLA-KTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKM 112

Query: 118 AHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYFY 177
            HGGVRYLEKAF +FSK+QLDLVIEALNER HL+NTAPHLC +LPILIP+Y+ WQ+PY Y
Sbjct: 113 IHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIY 172

Query: 178 AGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIAI 237
            GCKFYDFFAG QNLK SYL+S+   +E APML   NLKA+LVYHDGSFNDSRLN+++AI
Sbjct: 173 MGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAI 232

Query: 238 TAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTIL 297
           TA+ENGATVLNYVEV+KL+KDP S K+IG   +D ET E+  + +K +VNATGPYSD IL
Sbjct: 233 TAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAIL 292

Query: 298 QMDKNLSGLPDLANIDPKMYDPNDISS---KIAVSNPKMVVPSSGVHIILPSYYCPKQMG 354
           QMD+N SGLP     D  + D + I S   +IAV +PKMV+PS GVHI+LPS+YCPK MG
Sbjct: 293 QMDRNPSGLP-----DSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMG 347

Query: 355 LLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVR 414
           LLD RT+DGRVMFFLPWQGKV+AGTTDIP+ QVP+ P+  E DIQDILKELQHYI+FPV+
Sbjct: 348 LLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVK 407

Query: 415 REDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYR 474
           REDVLSAWAG+RPLVRDPR I  D  +K   TQG+VRSHFLFTSDNGLITIAGGKWTTYR
Sbjct: 408 REDVLSAWAGVRPLVRDPRTIPADG-KKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYR 466

Query: 475 EMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSE 534
           +MAEET+D+VV+ G F N  KPC T+D+KL GAE W  N VALL+Q ++LSS M+ YL +
Sbjct: 467 QMAEETVDKVVEVGGFHNL-KPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQ 525

Query: 535 NYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGN-----VDFNTFRYPITIAELKYAM 589
           NYGTRS+IIC+ F+    NKLP+ LA  E+  I  +     V+F+TFRYP TI ELKY+M
Sbjct: 526 NYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSM 585

Query: 590 KYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIE 649
           +YEY RTPLDFL+RRTRFA+LDA +AL AV  TVKVMGDEF W  K+R+ E++    FI+
Sbjct: 586 QYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIK 645

Query: 650 SFGV 653
           +FGV
Sbjct: 646 TFGV 649

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/602 (65%), Positives = 470/602 (78%), Gaps = 9/602 (1%)

Query: 57  PSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERDDFASGTSSKSTK 116
           PSRS+L + L  K  +F                    RGLNVAL+E +DFAS TSSKSTK
Sbjct: 68  PSRSELLSNLE-KTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKSTK 126

Query: 117 MAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYF 176
           MAHGGVRYLEKA  Q SK+QLDLVIEALNER H+L TAPHLCKILPI+IPVYNYW++PYF
Sbjct: 127 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYF 186

Query: 177 YAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIA 236
           YAGCK YDFFAG QNLKS+YL+S+ +A +IAPMLD   LKAALVYHDGSFND+R+N S+A
Sbjct: 187 YAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLA 246

Query: 237 ITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTI 296
           +TAIENGATVLNY+EV KL+KDP + KI G TV+D+ET +  +V +KV+VN+TGP+SD I
Sbjct: 247 VTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNI 306

Query: 297 LQMDKNLSGLPDL---ANIDPKMYDP--NDISSKIAVSNPKMVVPSSGVHIILPSYYCPK 351
           LQMD+N SG PD+   ANID        +D  S+IAV NPKMVVPS+GVHIILPSYYCPK
Sbjct: 307 LQMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYCPK 366

Query: 352 QMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKF 411
            MG+LD +T DGRVMFFLPWQ KV+AGTTDIPM +VP+ PVA E DI+DIL ELQHY KF
Sbjct: 367 DMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKF 426

Query: 412 PVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWT 471
           PV+REDVLSAWAGIRPLVRDPR +  ++     +TQGLVRSHF+FTS+N L+TIAGGKWT
Sbjct: 427 PVKREDVLSAWAGIRPLVRDPRKLSPNSKGD-DSTQGLVRSHFIFTSENNLVTIAGGKWT 485

Query: 472 TYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKY 531
           TYR MAEETIDE +K G   N  KP  TKDL L G ENW PN  ALLSQK+++ S ++KY
Sbjct: 486 TYRRMAEETIDEAIKVGQLPN--KPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKY 543

Query: 532 LSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKY 591
           LSENYGTR+ IIC+L ++++ N+LPV LAG E   ILGNVDF   RYP T+AE+KY +  
Sbjct: 544 LSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDN 603

Query: 592 EYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESF 651
           EY+RT LDFL+RRTRF +LDA +A+ AV+GTV +MGDE  WDS++R  EIK +  +I++ 
Sbjct: 604 EYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTL 663

Query: 652 GV 653
           GV
Sbjct: 664 GV 665

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/597 (65%), Positives = 469/597 (78%), Gaps = 14/597 (2%)

Query: 57  PSRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERDDFASGTSSKSTK 116
           PSRS+L  +L  K +QF                    RGLNVAL+E +DFASGTSSKSTK
Sbjct: 49  PSRSELLEKLQ-KTNQFDVLVIGGGASGAGSALDASTRGLNVALLEMNDFASGTSSKSTK 107

Query: 117 MAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYF 176
           MAHGGVRYLEKA  + SK+QLDLVIEALNERAHLL TAPHLCK+LPI+IPVY +WQ+PYF
Sbjct: 108 MAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYF 167

Query: 177 YAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIA 236
           Y G K YDFFAG QNLKSSYL+S   A E+APMLDA+ LKA LVYHDGSFNDSR+N++IA
Sbjct: 168 YVGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIA 227

Query: 237 ITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTI 296
           +TAIENGATVLNY+EV++L+K+P   K+ G    D+ETG+   V++KV+VNATGP+SD +
Sbjct: 228 VTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRL 287

Query: 297 LQMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLL 356
           LQMD +  GLPD   +D    D + I++++AV+NPKMVVPSSGVHIILPSYYCPK MGLL
Sbjct: 288 LQMDNHPEGLPDDKILDAINKD-STIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLL 346

Query: 357 DARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRRE 416
           DA T+DGRVMFFLPWQGKV+AGTTDIPM QVP  P A E DIQDILKELQHYIKFPV+RE
Sbjct: 347 DAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKRE 406

Query: 417 DVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREM 476
           DV SAWAGIRPLV+DPR       + L  TQGLVRSH +FTS NG++TI+GGKWTTYREM
Sbjct: 407 DVQSAWAGIRPLVKDPR-------KNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREM 459

Query: 477 AEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENY 536
           AEET++EVVK G F N AKPC T+ LKL GAE+WD NL ALLS ++N+  ++A++LS+NY
Sbjct: 460 AEETVNEVVKVGKFVN-AKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNY 518

Query: 537 GTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEYART 596
           GT++  +C+LFE +  N LPV LA   DKP   ++D+N FRYP TI ELK+ M +EYART
Sbjct: 519 GTKAAQVCELFEDDRANMLPVSLAA--DKPT--SIDYNAFRYPYTIGELKFTMTHEYART 574

Query: 597 PLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653
           PLDFLMRRTR+A+LDA QAL AV GTVKVMGD  GWDS +R  E K A  +I++FGV
Sbjct: 575 PLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/601 (64%), Positives = 467/601 (77%), Gaps = 10/601 (1%)

Query: 58  SRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERDDFASGTSSKSTKM 117
           SR  L ++L  K HQF                    RGLNVALVE+ DFASGTSSKSTKM
Sbjct: 54  SRRDLLDRLA-KTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKM 112

Query: 118 AHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYFY 177
            HGGVRYLEKAF +FSK+QLDLVIEALNER HL+NTAPHLC +LPILIP+YN WQ+PY Y
Sbjct: 113 IHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIY 172

Query: 178 AGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIAI 237
            GCKFYDFFAG QNLK SYL+S+   +E APML   NLKA+LVYHDGSFNDSRLN+++AI
Sbjct: 173 MGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAI 232

Query: 238 TAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTIL 297
           TA+ENGATVLNYVEV++L+KDP S K++G   +D ET E+  + +K +VNATGPYSD IL
Sbjct: 233 TAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAIL 292

Query: 298 QMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLLD 357
           QMD+N SG P+    D  +       ++IAV++PKMV+PS GVHI+LPS+YCPK MGLLD
Sbjct: 293 QMDRNPSGQPNSPLNDNSLI--KSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLD 350

Query: 358 ARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRRED 417
            RT+DGRVMFFLPWQGKV+AGTTDIP+ QVP+ P+  E DIQDILKELQHYI+FPV+RED
Sbjct: 351 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 410

Query: 418 VLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREMA 477
           VLSAWAG+RPLVRDPR I  D  +K   TQG+VRSHFLFTSDNGLITIAGGKWTTYR+MA
Sbjct: 411 VLSAWAGVRPLVRDPRTIPADG-KKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 469

Query: 478 EETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENYG 537
           EET+D+VV+ G F N  KPC T+D+KL GAE W  N VALL+Q ++LSS M+ YL +NYG
Sbjct: 470 EETVDKVVEVGRFHNL-KPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYG 528

Query: 538 TRSTIICQLFEREEMNKLPVQLAGIEDKPILGN-----VDFNTFRYPITIAELKYAMKYE 592
           TRS+IIC+ F+    NKLP+ LA  E+  I  +     V+F+TFRYP TI ELKY+M+YE
Sbjct: 529 TRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYE 588

Query: 593 YARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFG 652
           Y RTPLDFL+RRTRFA+LDA +AL +   TVKVMGDEF W  K+R+ E++    FI++FG
Sbjct: 589 YCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKTFG 648

Query: 653 V 653
           V
Sbjct: 649 V 649

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/656 (60%), Positives = 491/656 (74%), Gaps = 16/656 (2%)

Query: 1   MFARRPKXXXXXXXXXXXXXXXVVRRKYHSGTKFNNFQSDFNPYLISPVE-DVEINLPSR 59
           MFAR  K               +   +Y    + ++  S+  P ++SP++    +NLPSR
Sbjct: 1   MFARGGKLFPKALALTGTVGGALAVHQYMDSRRQSSALSNEVP-VVSPIDPRPSVNLPSR 59

Query: 60  SQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERDDFASGTSSKSTKMAH 119
             L + L   D +F                    RGLNVA VE +DFASGTSSKSTKMAH
Sbjct: 60  EDLLSNLQKTD-KFDVLIIGGGASGAGSALDAATRGLNVACVEANDFASGTSSKSTKMAH 118

Query: 120 GGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYFYAG 179
           GGVRYLEKA  + S++QLDLVIEALNER H+L TAPHLCKILPI+IPVY+YWQ+PYF+AG
Sbjct: 119 GGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFFAG 178

Query: 180 CKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIAITA 239
           CK YD+FAG QNL+SSYL+S+  A E+APMLD + LKA LVYHDGSFNDSR+NS++AI+A
Sbjct: 179 CKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAISA 238

Query: 240 IENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTILQM 299
           IE+GATVLNYV+V +LLKD ++NK+ G  V+D+ETG+   VK+KV VNATGPYSD ILQM
Sbjct: 239 IEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQM 298

Query: 300 DKNLSGLPDLANIDPKMYDPNDIS--SKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLLD 357
           DKN +GLP     DP+   P ++S  +++AV+ P MVVPS+GVHIILPSYYCPK +GLLD
Sbjct: 299 DKNKNGLP-----DPQPPQPANVSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLD 353

Query: 358 ARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRRED 417
            +T DGRVMFFLPWQGKV+AGTTDIPM  VP  P A E DIQDIL+ELQHYIKFPVRRED
Sbjct: 354 VKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRRED 413

Query: 418 VLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREMA 477
           VLSAWAGIRPLV DPR   D      G+T+GLVR+H +FTS+ GLIT+AGGKWTTYREMA
Sbjct: 414 VLSAWAGIRPLVMDPRKRKDTG----GSTEGLVRNHLIFTSETGLITLAGGKWTTYREMA 469

Query: 478 EETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENYG 537
           E+TIDEVVK G F+   KPC T+ +KL G ENW PNL ALL+Q + LS  M+++LS NYG
Sbjct: 470 EQTIDEVVKEGGFS--VKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYG 527

Query: 538 TRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEYARTP 597
           TR+ IIC+LF+ +E N+LPV   G E+  +L +V+F++FRYP TI E  Y++++EY+R  
Sbjct: 528 TRAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKA 587

Query: 598 LDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653
            DFLMRRTR+A+LDA  AL AV+GTVKVMGDE  WDS RR++EI+  T FI++FGV
Sbjct: 588 TDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/601 (65%), Positives = 463/601 (77%), Gaps = 10/601 (1%)

Query: 58  SRSQLWNQLTTKDHQFXXXXXXXXXXXXXXXXXXXXRGLNVALVERDDFASGTSSKSTKM 117
           SR  L  +L  K HQF                    RGLNVALVE+ DFASGTSSKSTKM
Sbjct: 57  SRRDLLERLG-KTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKM 115

Query: 118 AHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYFY 177
            HGGVRYLEKAF +FSK+QLDLVIEALNER HL+NTAPHLC +LPILIP+Y+  Q+PY Y
Sbjct: 116 IHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIY 175

Query: 178 AGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIAI 237
            GCKFYDFFAG QNLK SYL+S+   +E APML   NLKA+LVYHDGSFNDSRLN+++AI
Sbjct: 176 MGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAI 235

Query: 238 TAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTIL 297
           TA+ENGATVLNYVEV+KL+KDP S K+IG   +D ET E+  +K+K +VNATGPYSD IL
Sbjct: 236 TAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAIL 295

Query: 298 QMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLLD 357
           QMD+N SG PD    D          ++IAV +PKMV+PS GVHI+LPS+YCPK MGLLD
Sbjct: 296 QMDRNPSGQPDSPLNDNS--KAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLD 353

Query: 358 ARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRRED 417
            RT+DGRVMFFLPWQGKV+AGTTDIP+ QVP+ P+  E DIQDILKELQHYI+FPV+RED
Sbjct: 354 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 413

Query: 418 VLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREMA 477
           VLSAWAG+RPLVRDPR I  D  +K   TQG+VRSHFLFTSDN LITIAGGKWTTYR+MA
Sbjct: 414 VLSAWAGVRPLVRDPRTIPADG-KKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMA 472

Query: 478 EETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENYG 537
           EETID+VV+ G F N   PC T+D+KL GAE W  N VALL+Q ++LSS M+ YL +NYG
Sbjct: 473 EETIDKVVEVGGFHNLT-PCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYG 531

Query: 538 TRSTIICQLFEREEMNKLPVQLAGIEDKPILGN-----VDFNTFRYPITIAELKYAMKYE 592
           TRS+IIC+ F+    NKLP+ LA  E+  I  +     V+F+TFRYP TI ELKY+M+YE
Sbjct: 532 TRSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYE 591

Query: 593 YARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFG 652
           Y RTPLDFL+RRTRFA+LDA +AL +V  TVKVMGDEF W  K+R+ E++    FI++FG
Sbjct: 592 YCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFG 651

Query: 653 V 653
           V
Sbjct: 652 V 652

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/545 (66%), Positives = 438/545 (80%), Gaps = 15/545 (2%)

Query: 117 MAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYF 176
           M HGGVRYLEKAF +FSK+QLDLVIEALNER HL+NTAPHLC +LPILIP+YN WQ+PY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 177 YAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIA 236
           YAGCKFYDFFAG QNLKSSYL+S+   +E APML   NLKA+LVYHDGSFNDSRLN+++A
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 237 ITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTI 296
           ITA+ENGATVLNYVEV+KL+KDP S K++G   +D ET E+  + +K +VNATGPYSD I
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 297 LQMDKNLSGLPDLANIDPKMYDPNDISS---KIAVSNPKMVVPSSGVHIILPSYYCPKQM 353
           LQMD+N SG P     +  + D + I S   ++AV +P+MV+PS GVHI+LPS+YCPK +
Sbjct: 181 LQMDRNASGQP-----NSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDI 235

Query: 354 GLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPV 413
           GLLD RT+DGRVMFFLPWQGKV+AGTTDIP+ QVP+ P+  E DIQDILKELQHYI+FPV
Sbjct: 236 GLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPV 295

Query: 414 RREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTY 473
           +REDVLSAWAG+RPLVRDPR I     +K   TQG+VRSHFLFTSDNGLITIAGGKWTTY
Sbjct: 296 KREDVLSAWAGVRPLVRDPRSI-PAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTY 354

Query: 474 REMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLS 533
           R+MAEETID+VV+ G F N  KPC T+D+KL GAE W  N VALL+Q ++LSS M+ YL 
Sbjct: 355 RQMAEETIDKVVEVGGFHNL-KPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV 413

Query: 534 ENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGN-----VDFNTFRYPITIAELKYA 588
           ENYGTRS+IIC+ F+    NKLP+ LA  E+  I  N     V+F+TFRYP TI ELKY+
Sbjct: 414 ENYGTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYS 473

Query: 589 MKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFI 648
           M+YEY RTPLDFL+RRTRFA+LDA +AL +V  TVKVMGDEF W  K+R+ E++    FI
Sbjct: 474 MQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFI 533

Query: 649 ESFGV 653
           ++FGV
Sbjct: 534 KTFGV 538

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/561 (63%), Positives = 431/561 (76%), Gaps = 10/561 (1%)

Query: 94  RGLNVALVERDDFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNT 153
           RGL VALVE+ DFA+GTSSKSTK+AHGGVRYLEKA  + SK QLDLV+EALNERAHLL  
Sbjct: 94  RGLKVALVEKADFAAGTSSKSTKLAHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYA 153

Query: 154 APHLCKILPILIPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAA 213
           APHL KILPI+IPVY YW++PYFYAGCK YDFFAG QNLKSSYL+SR+N   IAPMLD  
Sbjct: 154 APHLTKILPIIIPVYEYWKVPYFYAGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQK 213

Query: 214 NLKAALVYHDGSFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKE 273
            LK  LVYHDG FNDSRL +++AI+A+E GATV NYV V +L+KD  +  I G  V+D+E
Sbjct: 214 KLKMGLVYHDGIFNDSRLCATLAISAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQE 273

Query: 274 TGEISNVKSKVIVNATGPYSDTILQMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKM 333
           TG    V +K++VNATGPYSD ILQMD N  GLP+    +P+   P +  + IAV NPKM
Sbjct: 274 TGGTFTVNAKIVVNATGPYSDKILQMDANPQGLPEK---EPEKATPEN--ALIAVRNPKM 328

Query: 334 VVPSSGVHIILPSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVA 393
           VVPS GVHI LPS+YCP +MGLLDA T+DGRVMFFLPWQGKVIAGTTDIP+ QVP  P  
Sbjct: 329 VVPSRGVHITLPSFYCPSEMGLLDASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSP 388

Query: 394 KETDIQDILKELQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSH 453
            E DIQDIL+ELQHYI+FPVRREDVLSAWAGIRPLVRDPR+    A    G T+GLVRSH
Sbjct: 389 TEADIQDILQELQHYIQFPVRREDVLSAWAGIRPLVRDPRVAEGSAGS--GQTEGLVRSH 446

Query: 454 FLFTSDNGLITIAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPN 513
           F+FTS   L+TIAGGKWTTYREMAEET+DEV+K G F    KPC T+  KLIGA++W+ N
Sbjct: 447 FIFTSPTQLVTIAGGKWTTYREMAEETVDEVIKVGKFQGL-KPCTTRKTKLIGAQHWNLN 505

Query: 514 LVALLSQKFN-LSSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVD 572
             A L Q++  L   +A++L+ NYG R+ IIC++FE ++ +KLPV L G  D  +  N+D
Sbjct: 506 FQAYLQQRYAPLEDSLAEHLANNYGDRAPIICEMFEADKSSKLPVGLYGDGDDKV-KNMD 564

Query: 573 FNTFRYPITIAELKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGW 632
            N F YP TIAELKY +++EY RT LDFL+RR+RFA+LDA +AL AV  TV ++GDE GW
Sbjct: 565 ANAFDYPFTIAELKYCIRFEYVRTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGW 624

Query: 633 DSKRREQEIKNATLFIESFGV 653
           D+++R  E      +I++FGV
Sbjct: 625 DAEKRAAESAKTKAYIKTFGV 645

>Skud_13.171 Chr13 (293952..295166) [1215 bp, 404 aa] {ON} YMR017W
           (REAL)
          Length = 404

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 8/63 (12%)

Query: 585 LKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNA 644
           LKYA KY++     D  M    +  L+  Q   AV G +K+M   FG     RE E  N+
Sbjct: 322 LKYAQKYQFEPDEEDNKMEMDLYGNLEQIQ---AVSGNLKIMAQAFG-----REFEAHNS 373

Query: 645 TLF 647
            +F
Sbjct: 374 RMF 376

>TBLA0A02150 Chr1 (521470..525441) [3972 bp, 1323 aa] {ON} Anc_6.247
           YMR176W
          Length = 1323

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 68/165 (41%), Gaps = 35/165 (21%)

Query: 485 VKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENYGTRSTIIC 544
           VKYG F N     K KD + +     + N +       N    + +Y S+   T    + 
Sbjct: 752 VKYGTFQNVVNKGKYKDNQFVMKLTRESNRL------LNKCQAIIEYYSQFQTTNDITVI 805

Query: 545 QLFEREEMNKL--PVQLAGIED-KPILGNVDFNTFRYPITIAELKYAMKYEYARTPLDFL 601
           ++FE   MN++  P +   I+D   +L  +D    ++PI + +LKY  +       LD +
Sbjct: 806 KVFENLNMNEIIRPNRKYRIDDIHELLSQLD----QFPIDLKDLKYVQE-------LDII 854

Query: 602 MRRTRFAYLDAYQALLAVKGTVKVMGDEFG-WDSKRREQEIKNAT 645
           +R+              +    + + +EF  W SK    E+ N +
Sbjct: 855 IRK--------------ISDFDRKLEEEFQIWQSKNETTELLNLS 885

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 7/117 (5%)

Query: 158 CKILPILIPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKA 217
           C++L   +P Y Y+ +  F A  K YD +  D+  KS  +   K   E+ P+L +     
Sbjct: 25  CELLLRNLPDYTYYNISDFAAKNKCYDGY--DEARKSHIVDEDKLLDELEPLLHSGG--N 80

Query: 218 ALVYHDGSFNDSRLNSSIAITAIENGATV--LNYVEVRKLLKDPNSN-KIIGVTVQD 271
            + +H       RL   +A+   ++      LN  E      D N + +I+GV +QD
Sbjct: 81  IIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKIDENMDAEIMGVVLQD 137

>YHR182W Chr8 (468219..470576) [2358 bp, 785 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cell periphery and
           cytoplasm
          Length = 785

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 52/119 (43%), Gaps = 10/119 (8%)

Query: 172 QLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRL 231
           QLP   A      FF  D  +       R N +E +  +DA   K   +  +  F  S +
Sbjct: 452 QLPQETANADVRGFFLRDNGIP----FRRWNILEASDPVDAC--KEISIKSEKFFCGSEI 505

Query: 232 NSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATG 290
           N+ +A         ++    +R++ K+PN+NK+I    +D +   +SN+K  ++    G
Sbjct: 506 NNELAALDTLGAIKII----LRQIEKEPNANKVIQSWHRDIDFVRVSNLKRDLLGEFKG 560

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,047,774
Number of extensions: 2863986
Number of successful extensions: 8716
Number of sequences better than 10.0: 35
Number of HSP's gapped: 8894
Number of HSP's successfully gapped: 35
Length of query: 653
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 537
Effective length of database: 40,180,143
Effective search space: 21576736791
Effective search space used: 21576736791
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)