Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0F002005.712ON1105110552340.0
TDEL0B020805.712ON1025110225010.0
SAKL0E15136g5.712ON1037113022190.0
KNAG0L022005.712ON116183620200.0
Smik_9.135.712ON106083619820.0
Skud_9.125.712ON106483819650.0
NCAS0G001705.712ON103045318680.0
ZYRO0B16544g5.712ON104479517830.0
Kpol_2001.785.712ON40341714890.0
CAGL0H06721g5.712ON108146615280.0
Suva_9.305.712ON106249415090.0
YIL156W (UBP7)5.712ON107150115080.0
KLLA0A00396g5.712ON101245114880.0
KLTH0E00814g5.712ON97445514720.0
Kwal_55.196455.712ON97044514630.0
TPHA0D046605.712ON104547614301e-179
YKR098C (UBP11)5.712ON71745913271e-168
Smik_11.3625.712ON72146013151e-167
Ecym_40095.712ON151749913591e-164
Skud_11.3385.712ON71248312931e-164
AFR296C5.712ON116947013221e-162
Suva_11.3355.712ON72447412811e-162
KAFR0D021605.712ON84646011601e-142
KAFR0H001505.712ON65647410501e-128
CAGL0G02563gsingletonON6314499431e-113
TBLA0E017605.712ON12122509701e-112
Kpol_304.65.712ON5625317673e-89
Ecym_61848.188ON8514473132e-28
Kwal_14.20088.188ON4244562916e-27
SAKL0H18986g8.188ON8934522962e-26
TBLA0F036108.188ON11442622849e-25
KNAG0D019308.188ON9862502812e-24
YER144C (UBP5)8.188ON8052622792e-24
TDEL0B042208.188ON8252672749e-24
TPHA0C027708.188ON9702502759e-24
Kpol_1032.288.188ON8822572694e-23
NDAI0C059008.188ON8262472694e-23
AFR007W8.188ON8482702642e-22
KAFR0C025908.188ON9782502642e-22
Suva_5.2728.188ON7882782587e-22
Smik_5.3098.188ON8052632588e-22
Smik_4.3078.188ON9292412571e-21
KLLA0E10275g8.188ON7962612552e-21
CAGL0G05247g8.188ON9472772533e-21
YDR069C (DOA4)8.188ON9262412524e-21
Skud_4.3238.188ON9262412525e-21
NDAI0A036808.188ON11162612516e-21
Suva_2.2288.188ON9272412508e-21
Skud_5.2818.188ON8232652491e-20
KLTH0H07678g8.188ON8612542453e-20
ZYRO0G06798g8.188ON8772502444e-20
NCAS0B042808.188ON9222452419e-20
CAGL0I06765g8.188ON8872482382e-19
NCAS0A039108.188ON7952542193e-17
TDEL0C056401.137ON11782152052e-15
NCAS0I031401.137ON12012042016e-15
Kpol_2001.541.137ON12231921991e-14
KNAG0C021801.137ON12312091926e-14
NDAI0B004801.137ON12532041927e-14
ZYRO0C17908g1.137ON12042091928e-14
CAGL0L01639g1.137ON11472161901e-13
Skud_10.221.137ON12552081873e-13
KNAG0G015908.188ON6712521844e-13
AFR627C1.137ON12872081838e-13
Kwal_33.136281.137ON11601981811e-12
KAFR0F015601.137ON11712101811e-12
YJL197W (UBP12)1.137ON12542081783e-12
TBLA0J006001.137ON14622151783e-12
TPHA0A025401.137ON12862001783e-12
Smik_10.371.137ON12472091756e-12
Suva_6.2761.137ON12562091748e-12
KLTH0F03674g1.137ON11981931712e-11
Ecym_81401.137ON12642021669e-11
KLLA0C03476g1.137ON12522011571e-09
SAKL0C04246g1.137ON12972071499e-09
Suva_2.507.390ON7501391443e-08
Smik_2.497.390ON7451381415e-08
NCAS0C021108.540ON4943941406e-08
YBL067C (UBP13)7.390ON7471391407e-08
ZYRO0B03300g7.390ON8131291408e-08
TBLA0D010708.742ON4832701398e-08
KNAG0C035807.390ON7761371399e-08
Skud_2.387.390ON7481391381e-07
Kpol_513.255.18ON11902271363e-07
TBLA0H036008.540ON4823971343e-07
ZYRO0F01276g3.270ON7761961335e-07
NCAS0E026107.390ON7171221327e-07
YMR304W (UBP15)5.18ON12302301328e-07
KNAG0B023707.390ON7531241311e-06
Smik_13.5215.18ON12312301292e-06
Suva_13.4955.18ON12302301282e-06
Kpol_1024.448.540ON4963931263e-06
NCAS0I016203.270ON7952421273e-06
TPHA0P006807.390ON7271431255e-06
NCAS0D023905.18ON12111051255e-06
KAFR0A069102.307ON6783931237e-06
CAGL0M11198g8.742ON4611311228e-06
Skud_13.4785.18ON12312291238e-06
Smik_5.2447.390ON7491251239e-06
KNAG0A054502.307ON7642781229e-06
NCAS0A143707.390ON7291291221e-05
NDAI0A016707.390ON8461221221e-05
TPHA0L022905.18ON11932271221e-05
SAKL0H04994g8.742ON4541311201e-05
TBLA0C012001.369ON5031531202e-05
NDAI0E041807.390ON8271351212e-05
YER098W (UBP9)7.390ON7541251202e-05
KNAG0F012202.69ON7844591202e-05
KNAG0J008003.270ON7651121202e-05
TDEL0D035503.270ON7802321202e-05
CAGL0A04477g7.390ON7701251202e-05
TDEL0G004105.18ON11861051202e-05
Ecym_46857.390ON7781011192e-05
CAGL0I05522g7.390ON724991183e-05
CAGL0M13783g5.18ON11962391184e-05
TPHA0E008707.390ON715931174e-05
AGL357W5.18ON11662301174e-05
TPHA0O016402.69ON7464351156e-05
Ecym_56715.18ON11762291166e-05
KNAG0E012905.18ON11961061167e-05
KAFR0A042108.742ON4401311147e-05
NCAS0B061302.307ON7704101149e-05
NDAI0C059508.202ON10801611149e-05
Skud_5.2237.390ON7481281141e-04
SAKL0H00418g5.18ON11902271131e-04
KNAG0A019708.540ON4711491121e-04
ZYRO0A05962g8.742ON4651281121e-04
KLTH0D12760g8.742ON4531331111e-04
Suva_13.4078.742ON4712631112e-04
TBLA0C070205.18ON12471081122e-04
Kwal_26.91518.742ON4541331112e-04
NDAI0I025305.18ON11971081122e-04
KLLA0C06974g8.742ON4462391102e-04
Smik_5.3188.202ON9091671112e-04
TDEL0C015707.390ON7651281112e-04
Suva_4.2953.270ON7821931112e-04
SAKL0E13002g2.69ON7394171103e-04
KLTH0H13354g1.369ON4954261093e-04
Kpol_534.231.369ON4961131093e-04
Smik_13.4318.742ON4712641093e-04
CAGL0H10186g3.270ON7782281093e-04
KAFR0I026005.18ON12131061094e-04
Kpol_1018.937.390ON7551291084e-04
ZYRO0G01188g1.369ON5001261076e-04
CAGL0K10494g1.369ON4951551067e-04
KNAG0G029308.742ON4591021067e-04
Klac_YGOB_Anc_5.18b5.18ON1166991077e-04
KLLA0D08459g2.69ON7501101067e-04
NCAS0B005808.742ON4661301067e-04
Suva_5.2177.390ON7541231068e-04
NDAI0A074103.270ON8102341068e-04
KAFR0E009308.540ON4984341058e-04
KAFR0C004103.270ON7692311069e-04
TBLA0B019308.202ON10191621060.001
ABL145W2.69ON7491101050.001
CAGL0I06600g8.202ON8161531040.002
KLTH0B09944g5.18ON11891051030.002
Kpol_1045.417.390ON7121401030.002
TBLA0B060802.307ON8243061030.002
Kwal_33.144302.69ON511991020.002
Kwal_34.162681.369ON449551020.002
ZYRO0D07062g5.18ON11931051030.002
CAGL0J11352g2.69ON7711321020.002
AGR139C8.202ON789741020.003
TDEL0A016208.202ON7951521010.003
NCAS0D006001.369ON4931541000.003
YER151C (UBP3)8.202ON9121641010.003
SAKL0F12430g7.390ON7541281010.003
YMR223W (UBP8)8.742ON4712611000.004
NCAS0A038408.202ON9171521010.004
ZYRO0C09812g2.69ON7021021000.004
Kwal_26.95985.18ON11911111010.004
SAKL0H18656g8.202ON7721601000.004
Suva_14.1562.69ON7881361000.004
TPHA0J026205.443ON1225401000.004
Skud_13.3928.742ON473263990.005
TBLA0D006207.390ON11711291000.005
KAFR0L017307.390ON701139990.005
NDAI0F034102.69ON870103990.006
Kpol_1064.488.742ON466266980.006
ZYRO0B11044g8.202ON826152990.006
TPHA0G005608.742ON463239980.007
KAFR0A075802.69ON802134980.008
TDEL0B030608.540ON734236970.008
KLTH0G10934g2.307ON758439970.009
Ecym_62488.742ON466105960.010
Ecym_55448.202ON83474970.010
Skud_5.2898.202ON910399970.010
TPHA0A025101.369ON50532960.011
TDEL0A011002.69ON661140960.012
KAFR0K018107.390ON71484960.012
Ecym_27171.369ON483102950.013
KAFR0C045201.369ON499153950.014
TBLA0B097602.69ON898254960.014
KNAG0C019401.369ON49938950.014
KAFR0B023708.202ON829152960.014
TPHA0E017105.443ON128331960.015
NDAI0E008108.742ON493113940.018
Suva_5.2808.202ON905164950.019
Kpol_219.1singletonON24980920.019
TBLA0E025703.270ON785145940.020
KLLA0E01013g8.202ON77488940.021
Skud_2.1773.270ON782193940.024
ZYRO0D03982g8.540ON821244930.027
TDEL0B036708.742ON463132920.030
KLLA0F18700g3.270ON770113930.031
TBLA0A064705.443ON132030930.035
SAKL0G02728g5.443ON123739920.037
CAGL0K10252g5.443ON126740920.038
AEL242W8.540ON613286910.041
Kwal_27.114442.307ON757319910.043
ZYRO0G01606g5.443ON130545910.047
KLTH0H07370g8.202ON781128910.049
Kwal_14.19578.202ON444136900.053
ZYRO0A02420g2.307ON745409900.060
Skud_16.2098.540ON503456900.060
Kwal_27.108427.390ON711169900.061
TPHA0D043508.202ON854140900.063
Kpol_251.73.270ON480194890.067
TDEL0D024001.369ON49429890.068
KLLA0E02377g5.443ON122031900.068
Kpol_1016.15.443ON125131900.068
Suva_6.831.369ON500108890.069
Kwal_56.230843.270ON762135900.070
KLLA0E20351g7.390ON69730890.072
YFR010W (UBP6)1.369ON49930890.072
AGR023C3.270ON780110900.072
Skud_6.941.369ON49930890.075
KLLA0A10791g1.369ON48430890.076
CAGL0H05335g8.540ON483163890.078
Ecym_45145.443ON124627890.096
AGR370W7.390ON74027880.097
NDAI0H035501.369ON502152870.11
Kwal_55.213935.443ON123330870.17
KLTH0F15862g5.443ON124160860.19
KLLA0E23387g8.540ON782288860.20
KNAG0B041905.443ON126230860.22
SAKL0D10120g1.369ON49259850.23
Suva_4.1252.307ON793305850.24
SAKL0D03322g3.270ON765238850.25
Smik_7.3141.369ON49930850.25
ACL164C5.443ON138931850.29
TDEL0D025805.443ON127226840.32
Smik_2.1893.270ON782202840.33
YPL072W (UBP16)8.540ON49979830.34
KAFR0D050705.443ON122732840.37
Skud_15.2865.443ON127826830.41
KLLA0E08801g2.307ON77124830.42
NDAI0C015505.443ON129531830.42
Suva_8.1765.443ON127026830.43
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0F00200
         (1105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712    2020   0.0  
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   967   0.0  
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   859   0.0  
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   782   0.0  
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   768   0.0  
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   761   0.0  
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     724   0.0  
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   691   0.0  
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   578   0.0  
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   593   0.0  
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   585   0.0  
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   585   0.0  
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   577   0.0  
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   571   0.0  
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   568   0.0  
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   555   e-179
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   515   e-168
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   511   e-167
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   528   e-164
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   502   e-164
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   513   e-162
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   498   e-162
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   451   e-142
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   409   e-128
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   367   e-113
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   378   e-112
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   300   3e-89
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   125   2e-28
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...   116   6e-27
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...   118   2e-26
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....   114   9e-25
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   112   2e-24
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   112   2e-24
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   110   9e-24
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...   110   9e-24
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...   108   4e-23
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...   108   4e-23
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   106   2e-22
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   106   2e-22
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...   103   7e-22
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...   103   8e-22
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...   103   1e-21
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...   102   2e-21
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...   102   3e-21
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...   101   4e-21
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   101   5e-21
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}             101   6e-21
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...   100   8e-21
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...   100   1e-20
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    99   3e-20
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    99   4e-20
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     97   9e-20
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    96   2e-19
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     89   3e-17
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    84   2e-15
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    82   6e-15
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    81   1e-14
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    79   6e-14
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    79   7e-14
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    79   8e-14
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    78   1e-13
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    77   3e-13
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    75   4e-13
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    75   8e-13
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    74   1e-12
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    74   1e-12
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    73   3e-12
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    73   3e-12
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    73   3e-12
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    72   6e-12
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    72   8e-12
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    70   2e-11
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    69   9e-11
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    65   1e-09
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    62   9e-09
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    60   3e-08
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    59   5e-08
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    59   6e-08
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    59   7e-08
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    59   8e-08
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    58   8e-08
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    58   9e-08
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    58   1e-07
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    57   3e-07
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    56   3e-07
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    56   5e-07
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    55   7e-07
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    55   8e-07
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    55   1e-06
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    54   2e-06
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    54   2e-06
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    53   3e-06
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    54   3e-06
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    53   5e-06
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    53   5e-06
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    52   7e-06
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    52   8e-06
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    52   8e-06
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    52   9e-06
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    52   9e-06
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    52   1e-05
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    52   1e-05
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    52   1e-05
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    51   1e-05
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    51   2e-05
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    51   2e-05
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    51   2e-05
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    51   2e-05
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    51   2e-05
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    51   2e-05
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    51   2e-05
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    51   2e-05
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    50   2e-05
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    50   3e-05
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    50   4e-05
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    50   4e-05
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    50   4e-05
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    49   6e-05
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    49   6e-05
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    49   7e-05
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    49   7e-05
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    49   9e-05
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    49   9e-05
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    49   1e-04
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    48   1e-04
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    48   1e-04
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    48   1e-04
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    47   1e-04
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    47   2e-04
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    48   2e-04
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    47   2e-04
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    48   2e-04
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    47   2e-04
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    47   2e-04
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    47   2e-04
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    47   2e-04
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    47   3e-04
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    47   3e-04
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    47   3e-04
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    47   3e-04
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    47   3e-04
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    47   4e-04
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    46   4e-04
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    46   6e-04
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    45   7e-04
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    45   7e-04
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    46   7e-04
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    45   7e-04
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       45   7e-04
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    45   8e-04
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    45   8e-04
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    45   8e-04
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    45   9e-04
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    45   0.001
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    45   0.001
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    45   0.002
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    44   0.002
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    44   0.002
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    44   0.002
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    44   0.002
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    44   0.002
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    44   0.002
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    44   0.002
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    44   0.003
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    44   0.003
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    43   0.003
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    44   0.003
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    44   0.003
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    43   0.004
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    44   0.004
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    43   0.004
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    44   0.004
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    43   0.004
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    43   0.004
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    43   0.004
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    43   0.005
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    43   0.005
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    43   0.005
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    43   0.006
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    42   0.006
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    43   0.006
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    42   0.007
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    42   0.008
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    42   0.008
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    42   0.009
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    42   0.010
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    42   0.010
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    42   0.010
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    42   0.011
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    42   0.012
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    42   0.012
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    41   0.013
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    41   0.014
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    42   0.014
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    41   0.014
KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {O...    42   0.014
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    42   0.015
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    41   0.018
Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON...    41   0.019
Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt,...    40   0.019
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    41   0.020
KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some s...    41   0.021
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    41   0.024
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    40   0.027
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    40   0.030
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    40   0.031
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    40   0.035
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    40   0.037
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    40   0.038
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    40   0.041
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    40   0.043
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    40   0.047
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    40   0.049
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    39   0.053
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    39   0.060
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    39   0.060
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    39   0.061
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    39   0.063
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    39   0.067
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    39   0.068
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    39   0.068
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    39   0.068
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    39   0.069
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    39   0.070
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    39   0.072
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    39   0.072
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    39   0.072
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    39   0.075
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    39   0.076
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    39   0.078
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    39   0.096
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    39   0.097
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    38   0.11 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    38   0.17 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    38   0.19 
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    38   0.20 
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    38   0.22 
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    37   0.23 
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    37   0.24 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    37   0.25 
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    37   0.25 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    37   0.29 
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    37   0.32 
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    37   0.33 
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    37   0.34 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    37   0.37 
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    37   0.41 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    37   0.42 
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    37   0.42 
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    37   0.43 
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    37   0.43 
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    37   0.48 
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    37   0.49 
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    36   0.56 
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    36   0.58 
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    36   0.76 
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    35   0.84 
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     36   0.84 
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    35   0.88 
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    35   0.93 
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    35   0.94 
TPHA0M01090 Chr13 complement(217833..220175) [2343 bp, 780 aa] {...    35   1.00 
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    35   1.1  
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    35   1.2  
ZYRO0G13662g Chr7 (1091869..1092768) [900 bp, 299 aa] {ON} simil...    35   1.2  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    35   1.4  
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    35   1.6  
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    35   1.8  
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    35   1.9  
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    33   3.4  
Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {O...    33   4.1  
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    33   4.8  
TPHA0G00650 Chr7 complement(122829..124109) [1281 bp, 426 aa] {O...    33   5.4  
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    33   6.1  
TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {...    33   6.3  
SAKL0E02310g Chr5 (178743..183104) [4362 bp, 1453 aa] {ON} simil...    33   7.2  
SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly...    33   7.3  
KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highl...    33   7.4  
NDAI0E00900 Chr5 complement(180968..182254) [1287 bp, 428 aa] {O...    32   8.5  
TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {...    32   9.9  

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 2020 bits (5234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1008/1105 (91%), Positives = 1008/1105 (91%)

Query: 1    MSVHGPSPFTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXX 60
            MSVHGPSPFTPEYSNELLQKVQSIYHDDIKHYYPQ                         
Sbjct: 1    MSVHGPSPFTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNK 60

Query: 61   XXXXXXDVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVK 120
                  DVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVK
Sbjct: 61   NNTNNKDVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVK 120

Query: 121  DEIENVLDMDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTET 180
            DEIENVLDMDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTET
Sbjct: 121  DEIENVLDMDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTET 180

Query: 181  SLTNQPPNHHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLAYXXXXXX 240
            SLTNQPPNHHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLAY      
Sbjct: 181  SLTNQPPNHHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLAYTNNTNT 240

Query: 241  XXXXXXXXGQKDSTANDFPFAPIQMPFDNGSAPDIPPKIPITKATTXXXXXXXXXXXXXX 300
                    GQKDSTANDFPFAPIQMPFDNGSAPDIPPKIPITKATT              
Sbjct: 241  KTNTDNNNGQKDSTANDFPFAPIQMPFDNGSAPDIPPKIPITKATTNIINNSESENNVNE 300

Query: 301  GTMPFTTSSLEXXXXXXXXXXYKTIEQTNPDRASNHRKDSYHSIYMVDDGSADGITQYYD 360
            GTMPFTTSSLE          YKTIEQTNPDRASNHRKDSYHSIYMVDDGSADGITQYYD
Sbjct: 301  GTMPFTTSSLENINNINNINNYKTIEQTNPDRASNHRKDSYHSIYMVDDGSADGITQYYD 360

Query: 361  SNPYIHSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMID 420
            SNPYIHSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMID
Sbjct: 361  SNPYIHSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMID 420

Query: 421  PMLLWNSKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFT 480
            PMLLWNSKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFT
Sbjct: 421  PMLLWNSKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFT 480

Query: 481  FFYLLVTSKTNKNIKSAPTHLLGGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKH 540
            FFYLLVTSKTNKNIKSAPTHLLGGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKH
Sbjct: 481  FFYLLVTSKTNKNIKSAPTHLLGGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKH 540

Query: 541  HDDLVDSHILQPPSWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTNSTLPPISSTTEQS 600
            HDDLVDSHILQPPSWK                            LTNSTLPPISSTTEQS
Sbjct: 541  HDDLVDSHILQPPSWKPPELPLRMRKRPPPPPPVAIPTPPVPHLLTNSTLPPISSTTEQS 600

Query: 601  PGIVLKTKTMTDLHSTKSQQHRNQYLTSYQHQVELARDDETRRKYHQERESLMLTRSRKF 660
            PGIVLKTKTMTDLHSTKSQQHRNQYLTSYQHQVELARDDETRRKYHQERESLMLTRSRKF
Sbjct: 601  PGIVLKTKTMTDLHSTKSQQHRNQYLTSYQHQVELARDDETRRKYHQERESLMLTRSRKF 660

Query: 661  SIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKF 720
            SIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKF
Sbjct: 661  SIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKF 720

Query: 721  PNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDR 780
            PNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDR
Sbjct: 721  PNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDR 780

Query: 781  LHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENS 840
            LHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENS
Sbjct: 781  LHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENS 840

Query: 841  LQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDC 900
            LQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDC
Sbjct: 841  LQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDC 900

Query: 901  PKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTS 960
            PKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTS
Sbjct: 901  PKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTS 960

Query: 961  PAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI 1020
            PAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI
Sbjct: 961  PAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI 1020

Query: 1021 VLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNH 1080
            VLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNH
Sbjct: 1021 VLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNH 1080

Query: 1081 GDMDKGILQVSSRDVYVLFYERIYE 1105
            GDMDKGILQVSSRDVYVLFYERIYE
Sbjct: 1081 GDMDKGILQVSSRDVYVLFYERIYE 1105

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  967 bits (2501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/1102 (48%), Positives = 679/1102 (61%), Gaps = 92/1102 (8%)

Query: 9    FTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDV 68
            FTPEYSNELL+ VQ++Y DDIKHY+ Q                               D 
Sbjct: 8    FTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQ-DA 66

Query: 69   LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128
            LTAFI+GCYYL+LI+PQSI+FQ++NKSY I+ +L K+Y+N+ +MTNVLLMVKDE++++LD
Sbjct: 67   LTAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDSILD 126

Query: 129  MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188
             +      +  H+   R RAYS+      +++ +L+I N                     
Sbjct: 127  RNARE-FKEFEHQK-ARTRAYSVPDRNFESRLTNLNIHN--------------------- 163

Query: 189  HHLLPIILH---CDEEFSNEEINATDFDR-ASPLWTAPSLEPKDQLKLAYXXXXXXXXXX 244
             + LP+  H      E   E++N    D  +SP+WTAP LEP DQL++A           
Sbjct: 164  ENPLPLGDHQAASKSEQGREDMNNLQNDEDSSPVWTAPPLEPNDQLRIAL---------- 213

Query: 245  XXXXGQKDSTANDFPFAPIQMPFDNGSAPDIPPKIPITKATTXXXXXXXXXXXXXXGTMP 304
                   D+T    P +P  M  D    P    ++ I+ +                    
Sbjct: 214  -------DAT----PLSPSIMALDQ---PMATKELAISTSRKALSRRASAMGPTPYPIEE 259

Query: 305  FTTSSLEXXXXXXXXXXYKTIEQTNPDRASNHRKDSYHSIYMVDDGSADGITQYYDSNPY 364
               S  +           KT+   N DR + HRKDSYHS+YM + GS D +     S  +
Sbjct: 260  LDISGQDGNSHYDELGFNKTLWNANVDRQTTHRKDSYHSVYMFEGGSDDHMPSI--SKDF 317

Query: 365  IHSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLL 424
               LERLQKQ IITA ELF+ILS+  E  KLLLID R  KR   NHI+AP  + IDP  L
Sbjct: 318  TQGLERLQKQSIITAPELFTILSSSEESEKLLLIDFRLSKRSKVNHIIAPTTVEIDPRQL 377

Query: 425  WNSKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYL 484
            W+ KTNTPI +  TL+ ++ +P        R  ++YIV+YTD KTYM  ++DY FT FYL
Sbjct: 378  WDPKTNTPISNAATLDEIIKKPA----FLERGSYDYIVYYTDMKTYMTIDYDYMFTLFYL 433

Query: 485  LVTSKTNKNIKSAPTHLLGGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKHHDDL 544
            L  S T  N++S PTHLLGGY+KWKK++ +YS  +  NM +Y+Y+P+   G+S K   D 
Sbjct: 434  LTASPT-VNLRSLPTHLLGGYEKWKKIMKNYSVDHGVNMDNYIYRPY---GESKKALPDT 489

Query: 545  VDSHILQPPSWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTNSTLPPISSTTEQSPGIV 604
                  + PSWK                                   P   + E  P   
Sbjct: 490  SSKRTPELPSWKPPAIPPRIRKRPPPPPPISVPVPTEKPPAAPPPPIPPKVSLETHP--- 546

Query: 605  LKTKTMTDLHSTKSQQHRNQYLTSYQHQVELARDDETRRKYHQERESLMLTRSRKFSIPT 664
             +     D HS ++ +              + R     R  H       L+  R +SIPT
Sbjct: 547  -EEPPAVDDHSVETTR-----------PTRITRKAIGSRPLHTHPHDQRLSLQRHYSIPT 594

Query: 665  IEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTP 724
            IEKS N YVSLSITGLRNLGNTCYINSMLQCLFAT  FRDLF+S KF+ F N + + N P
Sbjct: 595  IEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVSGKFEEFFNQN-YSNRP 653

Query: 725  KISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDE 784
            ++S SFN+LF+KMY+NGGCSVVPTSFLK  + LRPDLRIPDDQQDTQEFLM+ LDRLHDE
Sbjct: 654  QLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFLMVTLDRLHDE 713

Query: 785  LSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQ 844
            LSNQ  V NEYP+LLLYDE+ + V  KEYK WF+++VIGNGL+PIDHIF GQ+EN L+CQ
Sbjct: 714  LSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPIDHIFQGQIENILECQ 773

Query: 845  RCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCG 904
            RCGNSS++YSTFYVLSLAIPKPS++TFSR+KRVKLE+CINMFT+DE+LSGENAWDCPKCG
Sbjct: 774  RCGNSSFSYSTFYVLSLAIPKPSTSTFSRAKRVKLEDCINMFTNDEILSGENAWDCPKCG 833

Query: 905  SSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTS---P 961
            S+ +    +     ++  SKKK  S   E  R KS FF +H++S RS SPFR   S   P
Sbjct: 834  SAVTDMGPN-----HLKKSKKKKKSELGEERRSKSGFFRIHSKSKRSKSPFRMLGSTKFP 888

Query: 962  AAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV 1021
             A+      E WKSK+L T KTLNFI LPP+L+IHLSRFYYDLTKKN+T++TYPL+LNI+
Sbjct: 889  LAM------EDWKSKELSTKKTLNFIFLPPVLIIHLSRFYYDLTKKNDTIVTYPLVLNII 942

Query: 1022 LKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHG 1081
            LKNNE A+YRLY +VNH+GNLISGHYTSLVNKEP H L   +Q+WYYFDDE VKEE  HG
Sbjct: 943  LKNNETARYRLYAVVNHTGNLISGHYTSLVNKEPMHKLDKGRQKWYYFDDEVVKEETKHG 1002

Query: 1082 DMDKGILQVSSRDVYVLFYERI 1103
            ++D+GIL+VSS DVYVLFYER+
Sbjct: 1003 NIDQGILKVSSSDVYVLFYERL 1024

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
            {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  859 bits (2219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1130 (44%), Positives = 667/1130 (59%), Gaps = 130/1130 (11%)

Query: 9    FTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDV 68
            +TPEYSNELLQ VQ +Y  DIKHYYP+                               D 
Sbjct: 5    YTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQE-DA 63

Query: 69   LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128
            LTAFI+G +Y++LIIPQSIQF ++NKSYGIY +L+K Y++ET MTNVLLMV  +++ +L 
Sbjct: 64   LTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAIL- 122

Query: 129  MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188
                    D +   I R+RAYS+    L+NQ++SL+++N+   E                
Sbjct: 123  ----CKSRDFDDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQ--------------- 163

Query: 189  HHLLPIILHCDEEFSNEEINATDF-DRASPLWTAPSLEPKDQLKLAY-----------XX 236
               LP       E S E    T++ D  + +W+AP LEP DQLKLA              
Sbjct: 164  ---LP-------EVSKESDTLTNYADDYTTIWSAPKLEPDDQLKLALNPPSKSSSATSSL 213

Query: 237  XXXXXXXXXXXXGQKDSTANDFPFAPIQ--MPFDNGSAPDIPPKIPITKATTXXXXXXXX 294
                           +S++++F   P Q  +P D+ +  +I  +   T+  +        
Sbjct: 214  SSFVMDQHSKKFSIGESSSDEFEPIPTQEALPMDHATPSEISQR---TRHHS-------- 262

Query: 295  XXXXXXGTMPFTTSSLEXXXXXXXXXXYKTIEQTNPDRASNHRKDSYHSIYMVDDGSADG 354
                        +S+               I   N DR + HRKDSYHS+YM+++   D 
Sbjct: 263  ----------IVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSYHSVYMLNE---DD 309

Query: 355  ITQYYDSNPYIHSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAP 414
             T  YD   +  +L RLQKQ +I+ +EL  IL +  E++ +LL+DLR  KRF +NHIVAP
Sbjct: 310  DTNEYD---FFQNLSRLQKQYVISCEELMDILQSD-ERNNVLLVDLRISKRFHNNHIVAP 365

Query: 415  NLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTN 474
            NLI IDP  LW+     PI     LE  +    + +  Q+R++F+YIV+YTD KT++N +
Sbjct: 366  NLINIDPRDLWDVDRKVPISSDVELEKKM---GSYQTFQSRSKFKYIVYYTDMKTFLNID 422

Query: 475  FDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHS 534
            FDY   FF LL  S + + ++S P  LLG Y++WK  +  Y++ ++   GDYL++P+  S
Sbjct: 423  FDYRLVFFQLLYASSSTR-LRSPPKALLGDYEQWKTFIGQYAKHHDIVTGDYLFRPYASS 481

Query: 535  GDSIKHHDDLVDSHILQPPSWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTNSTLPPIS 594
              S K          ++P S                                  TLP  +
Sbjct: 482  AKSQKDK--------VKPISAPPVPATRPPPPPLPAQAPPALPSQ------APPTLPSQA 527

Query: 595  STTEQSPGI---VLKTKTMTDLH--------------STKSQQHRNQYLTSYQHQVELAR 637
              T+  P +    L  K+  +LH              +T S  HR++YL+          
Sbjct: 528  PPTQSIPAVHLPPLPPKSAINLHYSVATGMQPPMPQVTTVSHAHRHRYLS---------- 577

Query: 638  DDETRRKYHQERESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLF 697
               ++R  HQ    +     +  S+PTIE+S N+YVSLSITGLRNLG+TCYINSMLQCLF
Sbjct: 578  --HSKRSQHQHYSPI---SHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLF 632

Query: 698  ATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNIL 757
            ATR FRD+F+S K+  +I+   + +  +IS SF++LFKKMY+NGGCSVVP+ FLK CN +
Sbjct: 633  ATRKFRDIFLSPKYHDYISKG-YIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSM 691

Query: 758  RPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWF 817
            RPD +IP+DQQDTQEFL+ +LD+LHDELS+ ++V N+YP LLL+D++NL+V  KEY  WF
Sbjct: 692  RPDFKIPNDQQDTQEFLLFLLDQLHDELSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWF 751

Query: 818  DKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRV 877
            + ++  NGLSPID IF GQMEN LQCQRCG+SSYNYSTFYVLSLAIP P ++TF ++K+V
Sbjct: 752  EDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKV 811

Query: 878  KLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNE--HH 935
             LE+CIN+FTSDEVLSGENAWDCP+CG+S S +     K       K+K +  H+   ++
Sbjct: 812  LLEDCINLFTSDEVLSGENAWDCPRCGTSMSGSGPGEGK----AKKKRKFLLPHDHVNNN 867

Query: 936  RYKSKFFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVI 995
            R    F        RS SPF       +  S   +E WKSKKL TIKT NFI +PPILVI
Sbjct: 868  RTSRFFKFRSKSRSRSSSPFNSSNGHNSGSSMPGSEKWKSKKLTTIKTFNFITMPPILVI 927

Query: 996  HLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEP 1055
            HLSRF+YDLTKKN+TVITYPLILNIVLKNNEVAKYRLYGIVNH GNLISGHYTSLVNK+ 
Sbjct: 928  HLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDL 987

Query: 1056 NHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105
             H++   +Q+WYYFDDE VK++ NHGD D GI  VSS DVYVLFYERIY+
Sbjct: 988  KHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIYD 1037

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1161

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/836 (50%), Positives = 535/836 (63%), Gaps = 72/836 (8%)

Query: 323  KTIEQTNPDRASNHRKDSYHSIYMVDDGSADGITQYYD-SNPYIHSLERLQKQCIITAQE 381
            ++ +   PDR+  HRK+SYHS+YM+++  +     YYD SN YI SLERLQKQ IITA E
Sbjct: 343  RSFKDFTPDRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIITAPE 402

Query: 382  LFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLEN 441
            LFSILSN  +  +LLLIDLR   R++++ I+APN + IDP +LWNS +  P+Y+IT LE+
Sbjct: 403  LFSILSNEQQSKQLLLIDLRLDYRYNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELES 462

Query: 442  LLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHL 501
             L  P    L   R +F+Y+V+++D KT+M  NFDY FTFFYLL T++  K +K  PT L
Sbjct: 463  KLNNP----LFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTAR-GKPLKCVPTVL 517

Query: 502  LGGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKHHDDLVDSHILQPPSWKXXXXX 561
            LGGY+KWKKV+  Y +QYN  + DYL +         +  DD    H  Q   ++     
Sbjct: 518  LGGYEKWKKVILEYGKQYNICVTDYLVR-------ITEGEDDTPARHDCQELPYRQQNFA 570

Query: 562  XXXXXXXXXXXXXXXXXXXXXXXLTNSTLPPISSTTEQSPGIVLKTKTMTDLHSTKSQQH 621
                                           +  + +  P  V+  + M D   +K  QH
Sbjct: 571  GINGPGAVEPWKPHEVPATIRKRPPPPPPASVPQSPDVVP--VIPPRIMLD---SKVSQH 625

Query: 622  RNQY---LTSYQHQVELARDDE------TRRKYHQERESLMLTRSRKFSIPTIEKSPNLY 672
            R  +   L     Q+  A +D       T+R   +   S        +SIPTIE++PN+Y
Sbjct: 626  RAPFQSNLNFVTGQILEADEDTALQVAPTKRIQQEPFRSATNGLHETYSIPTIEQNPNIY 685

Query: 673  VSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIND-----SKFPNTPKIS 727
            VSLSITGLRNLGNTCYINSM+QCLFAT+ FR+LFIS K++ F+ +         + P IS
Sbjct: 686  VSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVIS 745

Query: 728  NSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN 787
             +F +LFKKMYLNGGCSVVP SFLK+C++LRPD +IPDDQQDT EFLM+ILDRLHDELSN
Sbjct: 746  RTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN 805

Query: 788  QQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCG 847
            Q  VVNEYP+L+LYDE  L VQNKEYK WFDK+VIGNGLSPID IF GQMENSL CQRCG
Sbjct: 806  QDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCG 865

Query: 848  NSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSA 907
            +SS+NYSTFYVLSLAIPK +S+TFSRSKRV LEEC+NM+TSDEVLSGENAWDCP C    
Sbjct: 866  HSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKIT 925

Query: 908  SSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLH----------------TRSHRS 951
                   EK     +++       +     K K F+                  ++ +RS
Sbjct: 926  KDYKGMVEKTKRNKAARDTLSPGSSSSSSKKGKLFSFSLHHRHHHRSELGELNVSKINRS 985

Query: 952  ISPFR--KKTSPAAVPSSTKN----------------------EPWKSKKLITIKTLNFI 987
            +SPFR    +S  +V  S  +                      + WKSKKL TIKTLNFI
Sbjct: 986  LSPFRVLGGSSSKSVRKSEDSHSRADVDAQRDIDELREMKEEMKQWKSKKLFTIKTLNFI 1045

Query: 988  VLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHY 1047
             +P  L+IHLSRFYYDLTKKN+T++TYPLILNIVLK+NEV KY+LYG+VNH+GNLISGHY
Sbjct: 1046 RMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVVNHTGNLISGHY 1105

Query: 1048 TSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERI 1103
            TS+V+K+ +H L S    WYYFDDE VK E  HGD+  G++++SS DVYVLFYERI
Sbjct: 1106 TSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161

 Score =  130 bits (327), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 82/236 (34%), Positives = 127/236 (53%), Gaps = 16/236 (6%)

Query: 8   PFTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD 67
           PFTPE S+EL Q+V  +Y DDI    PQ                               D
Sbjct: 13  PFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNM-D 71

Query: 68  VLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVL 127
            L +FI GC+Y++L++PQSIQF ++N+++ +Y++++ LYE++ +MTNVLLMVK+E++ VL
Sbjct: 72  ALGSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVL 131

Query: 128 DMDENNNGSDLNHRIIKRQRAYSI-SINELSNQVKSLSISNSIDQEHINNKTETSLTNQP 186
             +   + + LN R I R RAYS+     +   +  L++ +  +      +++     Q 
Sbjct: 132 --ESQWDSASLNER-IPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQL 188

Query: 187 PNHHLLPIILHCDEEFSNEE---INATDF------DRASPLWTAPSLEPKDQLKLA 233
           P    +P+  H D EF  E+   ++  D       D++SPLW AP LEP DQLKLA
Sbjct: 189 PRPGNVPV--HSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLA 242

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (REAL)
          Length = 1060

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/836 (51%), Positives = 543/836 (64%), Gaps = 92/836 (11%)

Query: 331  DRASNHRKDSYHSIYMVDDGSADGITQYY---DSNPYIHSLERLQKQCIITAQELFSILS 387
            DR+  HRKDSYHS+YMVD  +       +   +++ +I SL+ LQKQ IITA ELFSILS
Sbjct: 256  DRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILS 315

Query: 388  NPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPK 447
            N +E+ K+LLIDLR P+R + NHIVAPNL+ +DP LLW+ KTNTP+Y    LE+LL   K
Sbjct: 316  NRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLL---K 372

Query: 448  ARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDK 507
              +   NR +F+YIV+Y+D KT+M  NFDY F FFYL++TS+    + + PT LLGGY+K
Sbjct: 373  ENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTP-LTTVPTALLGGYEK 431

Query: 508  WKKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKHHDDL------------VDSHILQPPSW 555
            WKK L+SY+++Y+ ++ DYLY+P+     + +                   + + +PPSW
Sbjct: 432  WKKTLHSYAQEYHISVEDYLYRPYSQKARAQQQQQQQQPNSQDSSSSKETPTKVPEPPSW 491

Query: 556  KXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTNSTLP--PISSTTEQSPGIVLKTKTMTDL 613
            K                                 +   P   +  + P I  K       
Sbjct: 492  KPPDLPIRLRKRPPPPPPASMPTTPEIPPPLPPKIMVYPHEGSVPRKPPIPAKQ------ 545

Query: 614  HSTKSQQHRNQYLTSYQHQVELARDDETRRKYHQERESLMLTRSRKFSIPTIEKSPNLYV 673
            H  K Q + N+ +               R++ H  ++ L     + +SIPTIE++PN+YV
Sbjct: 546  HVKKKQSNSNEII------------QRKRQQQHYGQQLLQPLPPKDYSIPTIERNPNVYV 593

Query: 674  SLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN--DSKFPN-TPKISNSF 730
            SLSITGLRNLGNTCYINSM+QCLFA + FR LFISS +++++    S  P+ +PK+SNS 
Sbjct: 594  SLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSL 653

Query: 731  NLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQE 790
            ++LF KMYLNGGCSVVPT FLK  N LRPDL+IPDDQQDTQEFLMI+LDRLHDELSNQQ 
Sbjct: 654  SMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQH 713

Query: 791  VVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSS 850
            V N+YPNLLLY+ + LKV N EYKHWFDKNVIGNG+SPID IF GQMENSLQC+RCG ++
Sbjct: 714  VANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTT 773

Query: 851  YNYSTFYVLSLAIP----KPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSS 906
            +NYSTFYVLSLAIP    K S    S  KRVKLE+CINMFTSDEVLSGENAWDCP+CG +
Sbjct: 774  FNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPT 833

Query: 907  ASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRS------------------ 948
            AS T S S   L       +N SS  +  + KS+FFTLHT S                  
Sbjct: 834  ASFTASASASAL-------ENESSILKSKKKKSRFFTLHTGSKRRHLDIFGDSNGEGNNI 886

Query: 949  --------HRSISPFR---------KKTSPAAVPSSTKNEP--WKSKKLITIKTLNFIVL 989
                     RS SPF+           ++P A   +  N    +K+KK+ T+KT+NF+ L
Sbjct: 887  NNTMIFERERSRSPFKMLGGSGKRSSSSTPFANGGNDSNNTGDFKNKKMTTVKTINFVTL 946

Query: 990  PPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTS 1049
            P ILVIHLSRFYYDLTKKNNTVITYPLILNI+LKNN+  KYRL+G+VNH+G LISGHYTS
Sbjct: 947  PKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTS 1006

Query: 1050 LVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105
            LVNK+  H +   + +WYYFDDE VK ++ HG  DK  L++SS DVYVLFYER+Y+
Sbjct: 1007 LVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKN-LKISSSDVYVLFYERVYD 1060

 Score =  177 bits (450), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 103/225 (45%), Positives = 133/225 (59%), Gaps = 31/225 (13%)

Query: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDV 68
           FTPEYS+ELL++VQ +YH+DIKHYYPQ                               D 
Sbjct: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHHGRPN-DA 66

Query: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128
           LTAF++GCYY+FLIIPQS+QFQ++NKSY IYT+LKK+YENE +MTNV+LMVK EI  VLD
Sbjct: 67  LTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLD 126

Query: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188
            +   +   + HRI K+ RA+S+  N+LS QV SLS+  +  Q+H     +  LT     
Sbjct: 127 -ESVKHVVGIEHRINKK-RAFSVPANDLSGQVASLSLDTAGPQQH---NIKVPLTED--- 178

Query: 189 HHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLA 233
                                 D D++SP+WTAP+LEP DQLKLA
Sbjct: 179 ----------------------DMDQSSPVWTAPNLEPNDQLKLA 201

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (REAL)
          Length = 1064

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/838 (50%), Positives = 542/838 (64%), Gaps = 93/838 (11%)

Query: 331  DRASNHRKDSYHSIYMVDDGSADGITQYYD------SNPYIHSLERLQKQCIITAQELFS 384
            DR+  HRKDSYHSIYMVD   +D + +  D      ++ +I SL+ LQKQ IITA ELFS
Sbjct: 256  DRSITHRKDSYHSIYMVD---SDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFS 312

Query: 385  ILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLY 444
            ILSN IE+ K+LLIDLR P+R   NHIVAPNL+ IDP LLW+ KTNTP+Y    LE+LL 
Sbjct: 313  ILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLE 372

Query: 445  EPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGG 504
            E    ++  NR +FEY+V+YTD KT+M  NFDY F FFYL++TS+   ++ S PT LLGG
Sbjct: 373  E---NEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKT-HLTSVPTALLGG 428

Query: 505  YDKWKKVLYSYSEQYNFNMGDYLYKPHRH------------SGDSIKHHDDLVDSHILQP 552
            Y+KWKK L++Y+++Y+ ++ DYLY+P+              S            + + +P
Sbjct: 429  YEKWKKTLHTYAQEYDVSIEDYLYRPYSQKAHQQQQQEQQQSNAQDSSSSKESSAKVPEP 488

Query: 553  PSWKXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTNSTLPPIS--STTEQSPGIVLKTKTM 610
            PSWK                                 +   S  ++  + P I  K    
Sbjct: 489  PSWKPPDLPIRLRKRPPPPPPVSMPTTPGIPPPLPPKIMVYSHDNSFSRKPPIPAKQ--- 545

Query: 611  TDLHSTKSQQHRNQYLTSYQHQVELARDDETRRKYHQERESLMLTRSRKFSIPTIEKSPN 670
               H  K Q + N+ +          R  + ++  H  ++ L     R ++IPTIE+S N
Sbjct: 546  ---HVKKQQLNSNEII---------QRKRQQQKHRHYGQQLLQPQPQRAYNIPTIEQSSN 593

Query: 671  LYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN---DSKFPNTPKIS 727
            +YVSLSITGLRNLGNTCYINSM+QCLFA ++FR LFIS+ +++++     S+  ++ K+S
Sbjct: 594  VYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLS 653

Query: 728  NSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN 787
            NS N+LF KMYLNGGCSVVPT FLK  N LRPDL+IPDDQQDTQEFLMI+LDRLHDELSN
Sbjct: 654  NSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSN 713

Query: 788  QQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCG 847
            QQ V N+YPNLLLY+ + LKV N EYKHWFDKNVIGNG+SPID IF GQMENSLQC+RCG
Sbjct: 714  QQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCG 773

Query: 848  NSSYNYSTFYVLSLAIPKPSS--TTFSRS--KRVKLEECINMFTSDEVLSGENAWDCPKC 903
             +++NYSTFYVLSLAIP+ S   +   RS  KRVKLE+CINMFT DEVLSGENAWDCP+C
Sbjct: 774  YTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRC 833

Query: 904  GSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRS--------------- 948
            G +ASS+ + +      + S              KS+FFTLHT S               
Sbjct: 834  GPTASSSSASASASAFESESPIAKSKKK------KSRFFTLHTGSKRRHLDFFGDNINES 887

Query: 949  ----------HRSISPFR-----KKTSPAAVPSS------TKNEPWKSKKLITIKTLNFI 987
                       RS SPF+      K S ++ P +           +K+KKL T+KT+NF+
Sbjct: 888  NSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFANNNNDGNNINDFKNKKLTTVKTINFV 947

Query: 988  VLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHY 1047
             LP ILVIHLSRFYYDLTKKN+TVITYPLILNI+LKNNE  KYRL+G+VNH+G L+SGHY
Sbjct: 948  TLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVSGHY 1007

Query: 1048 TSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105
            TSLVNK+  H +   + +WYYFDDE VK +  HG  DK  L++SS DVYVLFYER+++
Sbjct: 1008 TSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKN-LKISSSDVYVLFYERVHD 1063

 Score =  180 bits (456), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/225 (46%), Positives = 133/225 (59%), Gaps = 31/225 (13%)

Query: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDV 68
           FTPEYSNELL++VQ +YH+DIKHYYPQ                               D 
Sbjct: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRHNRPN-DA 66

Query: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128
           LTAFI+GCYY+FLIIPQS+QFQ++NKSY IYT+LKK+YENE +MTNV+LMVK EI  VLD
Sbjct: 67  LTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLD 126

Query: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188
            +   +   + HRI K+ RA+S+  N+LS QV SLS+ N+                 P  
Sbjct: 127 -ESVKHAVGIEHRITKK-RAFSVPANDLSGQVASLSLENA----------------GPHG 168

Query: 189 HHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLA 233
           H            F+ E     D +++SP+WTAP+LEP DQLKLA
Sbjct: 169 HGF-------KASFTEE-----DAEQSSPVWTAPNLEPNDQLKLA 201

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/453 (77%), Positives = 394/453 (86%), Gaps = 9/453 (1%)

Query: 655  TRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSF 714
            T +R+ SIPTIE+SPNLYVSLSITGLRNLGNTCYINSMLQCLFATR FRDLF++SK+ SF
Sbjct: 585  TLTRRPSIPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYSSF 644

Query: 715  INDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFL 774
            +N SKFPN+P ISNSFNLLFKKMYLNGGCSVVPTSFLK CN+LRPDL+IPDDQQDTQEFL
Sbjct: 645  LNGSKFPNSPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFL 704

Query: 775  MIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFS 834
            MIILDRLHDELSNQQEVVNEYP+L+LYD N+L+VQ++EYKHWF+K+VIGNGLSPID IF 
Sbjct: 705  MIILDRLHDELSNQQEVVNEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSPIDEIFQ 764

Query: 835  GQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSG 894
            GQ+EN LQCQRCG+SS+NYSTFYVLSLAIPKPS T FSRSKRVKLE+CINMFT+DE+LSG
Sbjct: 765  GQIENGLQCQRCGHSSFNYSTFYVLSLAIPKPSPTGFSRSKRVKLEDCINMFTNDEMLSG 824

Query: 895  ENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISP 954
            ENAWDCP CGS+A   +      +N   S KK      E HR+KS+FF L TR HRS+SP
Sbjct: 825  ENAWDCPNCGSNAQDRVR-----VNTDQSVKK--KRQGEEHRHKSRFFGLPTRPHRSLSP 877

Query: 955  FRKKTSPAAVPSS--TKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVI 1012
            FRK  S +   +S     + WK+KKLITIKTLNFI+LPP+LVIHLSRF+YDLTKKN TVI
Sbjct: 878  FRKSGSSSTNSTSKIKHEQQWKTKKLITIKTLNFIMLPPVLVIHLSRFFYDLTKKNKTVI 937

Query: 1013 TYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDE 1072
            TYPLILNIVLKNNEVAKY+LYGIVNH+GNLISGHYTSLVNKEP H+L   +QRWYYFDDE
Sbjct: 938  TYPLILNIVLKNNEVAKYKLYGIVNHTGNLISGHYTSLVNKEPGHNLNHNQQRWYYFDDE 997

Query: 1073 TVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105
             VK E NHGD+D GI +VSS+DVYVLFYER+YE
Sbjct: 998  VVKAEGNHGDIDNGISKVSSKDVYVLFYERLYE 1030

 Score =  431 bits (1108), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 256/561 (45%), Positives = 342/561 (60%), Gaps = 53/561 (9%)

Query: 2   SVHGPSPFTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXX 61
           S +  S FTPEYSNELL+++QS+Y +DIKHYYPQ                          
Sbjct: 3   SAYEKSTFTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHE 62

Query: 62  XXXXXDVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKD 121
                D LT+FIVGCYYLFLI+PQSIQFQS+NKSYGIY++LKKLYEN+  MTNVLLMVKD
Sbjct: 63  GNNK-DALTSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKD 121

Query: 122 EIENVLDMDENNNGSDLNHRIIKRQRAYSI-SINELSNQVKSLSISNSIDQEHINNKTET 180
           EIE +L+       ++ N+RI+ RQRAYS+   N+L+ Q+ SLS+S+       N K+  
Sbjct: 122 EIETILEKTAEREINETNNRIV-RQRAYSVPDSNDLTEQLHSLSVSDR------NLKS-- 172

Query: 181 SLTNQPPNHHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLAYXXXXXX 240
                PP      I+++   E S+ ++   + D +SPLWTAP LEP DQLKLA       
Sbjct: 173 -----PPRK----ILMNNSFEHSDSDVINEENDMSSPLWTAPPLEPTDQLKLA------- 216

Query: 241 XXXXXXXXGQKDSTANDFPF-APIQMPFDNGSAPDIPPKIPITKATTXXXXXXXXXXXXX 299
                   G +       P+ A IQ   D    P IP   P T +               
Sbjct: 217 ------VLGNETLPPPVIPYEADIQERTDLLKQPSIPELSPTTTSLKNSKDFNS------ 264

Query: 300 XGTMPF-TTSSLEXXXXXXXX-XXYKTIEQTNPDRASNHRKDSYHSIYMVDDGSADGITQ 357
               PF +  SL+            ++  +TN DR+  HRKDSYHS+YM+D+ S D + Q
Sbjct: 265 ----PFQSVISLDNDIPLVREPSNNRSFRETNADRSQTHRKDSYHSVYMIDEESTDKLNQ 320

Query: 358 YYDSNPYIHSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLI 417
           +YDS  YI  L+RLQKQ IITAQEL SILS P E+ KLLLIDLR+ KR + NHIVAPN++
Sbjct: 321 FYDSTDYIQDLQRLQKQSIITAQELLSILSCPPERIKLLLIDLRWSKRTALNHIVAPNVV 380

Query: 418 MIDPMLLWNSKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDY 477
            IDP LLW+S T+TPIY++ TLE LL      +L   R +FEY+V+YTD KTYM+++FDY
Sbjct: 381 SIDPHLLWDSATSTPIYNMETLEKLL----DNELFNRRHEFEYVVYYTDMKTYMHSDFDY 436

Query: 478 SFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHS--G 535
           +FT FYLL T  TN  ++S PT+LLGGYDKWK  L+ Y+++Y+ N+ DYLY+P+  +   
Sbjct: 437 NFTLFYLLTTETTNI-LRSTPTYLLGGYDKWKVFLHHYAKEYDINIPDYLYRPYDKALKS 495

Query: 536 DSIKHHDDLVDSHILQPPSWK 556
           ++ +  ++  + H+L+PPSW+
Sbjct: 496 ETPEEFEETKNKHVLEPPSWR 516

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
            {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156W UBP7 Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1044

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/795 (49%), Positives = 508/795 (63%), Gaps = 55/795 (6%)

Query: 331  DRASNHRKDSYHSIYMVDDGSADGITQYYDSNPY--IHSLERLQKQCIITAQELFSILSN 388
            DRA  HRKDSYHS+YM DDG  D       + P   + +++RLQKQ IIT+ ELFSILSN
Sbjct: 282  DRAVAHRKDSYHSVYM-DDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSN 340

Query: 389  PIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKA 448
              E+++LLLIDLR   R+  N+I+APN++ IDP +LW+  T TP+ DI+ L+  L     
Sbjct: 341  KKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERL----K 396

Query: 449  RKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKW 508
              +   R  F++IV+YTD KTYM  +FDY F F+ L+V S+   +++S P++LLGGY+KW
Sbjct: 397  NSIFNKRGSFDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQ-EVSLRSLPSYLLGGYEKW 455

Query: 509  KKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKHHDDLVDSHILQPPSWKXXXXXXXXXXXX 568
            K VL  Y  Q+   + DYLY+P+  + +     +   ++  ++P  WK            
Sbjct: 456  KAVLKKYLTQFGIRVDDYLYRPYSSNKEG---KEKSANAKHIEPVPWKPPALPERMRNLP 512

Query: 569  XXXXXXXXXXXXXXXXLTNSTLPPISSTTEQSPGIVLKTKTMTDLHSTKSQQHRNQYLTS 628
                               +TLP    T E  P +  K +    L   + + H      +
Sbjct: 513  PPP--------------PPATLP---ITKEMPPPVPPKIQ----LEQQEDKNHTRPRSRT 551

Query: 629  YQHQVELARDDETRRKYHQERESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCY 688
                 E+ ++     +  Q     M  R R+FS+PTIE+S N YV+LSITGLRNLG TCY
Sbjct: 552  VSSPAEVPKNVVAPEQLSQLDSYPM--RQRQFSVPTIERSNNKYVALSITGLRNLGATCY 609

Query: 689  INSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPT 748
            INSMLQCLFAT +FRDLF  S ++ F N  +  +T K+S SF++L +KMY+NGGCSVVPT
Sbjct: 610  INSMLQCLFATNMFRDLFEPSNYERFFN-PELEDTGKLSKSFSVLIRKMYMNGGCSVVPT 668

Query: 749  SFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKV 808
            SFLK CN LRPD  IPDDQQD QEFLM+ +DRLHDELSNQ EV+N +P LLLYD    KV
Sbjct: 669  SFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKV 728

Query: 809  QNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSS 868
            Q +EYK WF+ ++I    SPID IF GQ+EN L C++CG SSY+YSTFY+LSLAIPKPSS
Sbjct: 729  QKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGYSSYSYSTFYILSLAIPKPSS 788

Query: 869  TTFSRSKR--VKLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSS--- 923
            +  S SK   V LE+CINMFTSDEV+S ENAWDCPKCG +     S+S +  N  SS   
Sbjct: 789  SFLSSSKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEKSESNQRHNKQSSSSG 848

Query: 924  --------KKKNMSSHNEHHRYKSKFFTL----HTRSHRSISPF---RKKTSPAAVPSST 968
                    K K         + K+KF        + S +S+SPF      +S +   +++
Sbjct: 849  STASPEPRKAKKKDEEGSSLKSKTKFLLFPRKRKSSSSKSLSPFNLLNSSSSSSNTNNNS 908

Query: 969  KNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVA 1028
             +     K   +I+  NF+ LPP+LVIHLSRFYYDLTKKN TVITYPLILNIVLKNNE  
Sbjct: 909  SSNSGSKKNSFSIRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETL 968

Query: 1029 KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGIL 1088
            KYRLY +VNH+GNLISGHYTSLVNK  +HDL + +Q+WYYFDDE VK E +HG++ +G+ 
Sbjct: 969  KYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVN 1028

Query: 1089 QVSSRDVYVLFYERI 1103
            +VSS+DVYVLFYERI
Sbjct: 1029 KVSSKDVYVLFYERI 1043

 Score =  139 bits (350), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 122/226 (53%), Gaps = 29/226 (12%)

Query: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDV 68
           FTPEYS+ELL+ V+ IY DDIK +Y                                 D 
Sbjct: 8   FTPEYSSELLRLVEDIYEDDIKPHY-AVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDA 66

Query: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128
           LTA+I+GCY+L+LIIPQS QFQ++NK++ ++  LKKLYEN+ +MTNVLLMVKDE+++VLD
Sbjct: 67  LTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLD 126

Query: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188
            D          + ++R+RA+S   N L +++  L+++                     N
Sbjct: 127 RDFR------KLKDVERKRAFSSPDNGLDSEISRLTLAG--------------------N 160

Query: 189 HHLLPIILHCDEEFSNEEINATDFDRAS-PLWTAPSLEPKDQLKLA 233
              LP  +H   +F   + N    D  + PLW AP+LEP DQLKLA
Sbjct: 161 GSTLP-KMHKKWDFIRSDSNFHSHDTGNVPLWKAPNLEPNDQLKLA 205

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] {ON}
            complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/417 (67%), Positives = 330/417 (79%), Gaps = 19/417 (4%)

Query: 692  MLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFL 751
            M+QCLF T+L RDLFISSK++ +++  +   +  +S SF++LFKKMYLNGGCSVVPTSFL
Sbjct: 1    MVQCLFGTKLLRDLFISSKYEKYLS-KRIDRSSNLSRSFSILFKKMYLNGGCSVVPTSFL 59

Query: 752  KTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNK 811
            KTCN LRPDLRIPDDQQDTQEFLM++LDRLHDELSNQ+ V  +YP+L+LYD   L+V NK
Sbjct: 60   KTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVNNK 119

Query: 812  EYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTF 871
            EY  WFDK +  NGLSPIDHIF GQ+EN+L CQRCG  SYNYSTFYVLSLAIPKPSS TF
Sbjct: 120  EYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGTF 179

Query: 872  SRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSH 931
            SRSKRVKLE+CINMFT+DEVLSGENAWDC  CGSS+         + NV   K K   + 
Sbjct: 180  SRSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSS---------VHNVEQRKDKTTGNG 230

Query: 932  NEHHR-YKSKFFTL---HTRSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFI 987
             E  R  KS+ F L   + RS RSISPFRK  SP        +E  K KKL+TIK++NFI
Sbjct: 231  EEKKRSRKSRLFLLPNINGRSSRSISPFRKSASPRP-----PHEKLKHKKLVTIKSMNFI 285

Query: 988  VLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHY 1047
             LPP LVIHLSRFYYDL+KKN T++TYPLILNIVL NNE AKYRLYGIVNH+GNLISGHY
Sbjct: 286  SLPPTLVIHLSRFYYDLSKKNETIVTYPLILNIVLNNNETAKYRLYGIVNHTGNLISGHY 345

Query: 1048 TSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            T+LVNKE NH+L   KQ+WYYFDDE VKEE NHG++D+G+++VSS  VYVLFYER+Y
Sbjct: 346  TTLVNKEKNHELKKDKQKWYYFDDEVVKEENNHGNIDEGVIKVSSSQVYVLFYERVY 402

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/466 (62%), Positives = 357/466 (76%), Gaps = 27/466 (5%)

Query: 655  TRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSF 714
            T +RKFSIPTIEK+ N YV+ S+TGLRNLGNTCYIN MLQ LFAT   ++LFIS K++ +
Sbjct: 625  TLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREY 684

Query: 715  I---NDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQ 771
                ND+K      ISN+F  LF KMY+NGGC+VVP+ FLK CN LRPDLRIPDDQQDTQ
Sbjct: 685  QMKPNDNK---ESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQ 741

Query: 772  EFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDH 831
            EFL+ IL+RLHDELSNQ  V+N+YPNLLLYD++ + V  ++YK WFDK V+ NGLSP+D 
Sbjct: 742  EFLLFILNRLHDELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPVDG 801

Query: 832  IFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEV 891
            +F GQMEN+LQCQRCG  S NYSTFYVLSLA+PKPS+  F +S RVKLE+CINMFTSDEV
Sbjct: 802  VFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEV 861

Query: 892  LSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRS--H 949
            L+GENAWDCPKCGS A        +  + TS+  + +  ++ HH  KSKFF L T     
Sbjct: 862  LTGENAWDCPKCGSKAVEP-----RFTSRTST--QTILPNSPHHHKKSKFFGLPTGKAIS 914

Query: 950  RSISPFRK---------KTSPAAVPSSTKNEPW---KSKKLITIKTLNFIVLPPILVIHL 997
            RS SPFRK         K          + E W   KSKKL+TIKT+NFI LP +L+IHL
Sbjct: 915  RSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHL 974

Query: 998  SRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNH 1057
            SRFYYDLTKKN+ V++YPL+LNIVLKN E+ +Y+LY IVNH+GNLISGHYTSLVNK+P+H
Sbjct: 975  SRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHH 1034

Query: 1058 DLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERI 1103
            +LG+ +Q+WYYFDDE VK E+ HG++DKGI +VSS++VYVLFYER+
Sbjct: 1035 NLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080

 Score =  229 bits (583), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 155/234 (66%), Gaps = 10/234 (4%)

Query: 323 KTIEQTNPDRASNHRKDSYHSIYMVDDGSADGITQYYDSNPYIHSLERLQKQCIITAQEL 382
           K  E  + +R   HRKDSYHSIYM+DD + +    +  SN +I  LERLQKQ IITA EL
Sbjct: 333 KDFEDLHANRLITHRKDSYHSIYMIDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPEL 392

Query: 383 FSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENL 442
           FSILSNP E+ KLLLIDLR  KR  +NHIVAPN++ IDP  LW+++ N+PIY  T LE  
Sbjct: 393 FSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQR 452

Query: 443 LYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLL 502
           L  P    L   R +++YIV+Y+D KTYMN  +DYSF  FYLL TS   K++ S PT LL
Sbjct: 453 LNNP----LFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTS--GKHLSSVPTALL 506

Query: 503 GGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKHHDDLVDSHILQPPSWK 556
           GGY+KWKKV+ +Y  QY   + DYLY+P+  S +  + +    ++ I   P+WK
Sbjct: 507 GGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNNKGEQN----NAQIPDVPTWK 556

 Score =  113 bits (282), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 90/294 (30%), Positives = 139/294 (47%), Gaps = 71/294 (24%)

Query: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDV 68
           FTPE+S +LL ++Q IY D+I+  +PQ                                 
Sbjct: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCVDVDTSK--A 61

Query: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128
           +  FI GC+Y++L++P+S+QFQ+++KSY +YTEL+ LYE++ +MTNV+ MVK+E+  + +
Sbjct: 62  VRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQE 121

Query: 129 MDEN---NNGSD---------------LNH--RIIKRQRAYSIS----INELS------- 157
             +N   N G D               LN   R+I R+ AYSIS    ++ LS       
Sbjct: 122 QCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDELPE 181

Query: 158 ----NQVKSLSI----SNSIDQEHINNKTETSL-------TNQP---------PNHHLLP 193
                Q +  S+    SN +  + +  K ++          NQP          N+ +  
Sbjct: 182 HRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNEIPT 241

Query: 194 IILHCDEEFSNEEIN--------ATDFDR------ASPLWTAPSLEPKDQLKLA 233
           + LH D++   ++ N        ATD D        SP+WTAP L+P DQLKLA
Sbjct: 242 LSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLA 295

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
            YIL156W (REAL)
          Length = 1062

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/494 (61%), Positives = 364/494 (73%), Gaps = 59/494 (11%)

Query: 658  RKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIND 717
            R + IPTIE+S N YVSLSITGLRNLGNTCYINSM+QCLFA ++FR LFISSK++S++  
Sbjct: 582  RVYHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQ 641

Query: 718  SKFP--NTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLM 775
            S+    ++P++SNS N+LF KMYLNGGCSVVPT FLK  N LRPDL+IPDDQQDTQEFLM
Sbjct: 642  SRGNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLM 701

Query: 776  IILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSG 835
            I+LDRLHDELSNQ  V N+YPNLLLYD + LKV NKEYKHWFDKNVIGNG+SPID IF G
Sbjct: 702  ILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQG 761

Query: 836  QMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSS--TTFSR--SKRVKLEECINMFTSDEV 891
            QMENSLQC+RCG +++NYSTFYVLSLAIP+ S   +   R   KRVKLE+CINMFTSDEV
Sbjct: 762  QMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEV 821

Query: 892  LSGENAWDCPKCG----SSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTR 947
            LSGENAWDCP+CG    +S S++ S  E   N+  S+KK           KS+FFTLHTR
Sbjct: 822  LSGENAWDCPRCGPTASTSLSASASALENDSNIVKSRKK-----------KSRFFTLHTR 870

Query: 948  S-------------------------HRSISPFR---------KKTSPAAVPSSTKNE-- 971
            S                          RS SPF+            +P A  S+  N   
Sbjct: 871  SKRRHLDFFGDSSNESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFANSSNDGNNFN 930

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYR 1031
             +K+KKL T+KT+NF+ LP ILVIHLSRFYYDLTKKNNTVITYPLILNI+LKNN+  KYR
Sbjct: 931  DFKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYR 990

Query: 1032 LYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVS 1091
            L+G+VNH+G LISGHYTSLVNK+  H++   + +WYYFDDE VK ++ HG  DK  L++S
Sbjct: 991  LFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKS-LKIS 1048

Query: 1092 SRDVYVLFYERIYE 1105
            S D YVLFYER+++
Sbjct: 1049 SSDAYVLFYERVHD 1062

 Score =  214 bits (544), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 110/208 (52%), Positives = 147/208 (70%), Gaps = 7/208 (3%)

Query: 327 QTNPDRASNHRKDSYHSIYMVDDG---SADGITQYYDSNPYIHSLERLQKQCIITAQELF 383
           +   DR+  HRKDSYHS+YMVD     S +      +++ +I SLE LQKQ IITA ELF
Sbjct: 252 EITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELF 311

Query: 384 SILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLL 443
           +ILSN  E  KLLLIDLR P+R + N+IVAPNL+ IDP LLW+ KTN P+Y    LE LL
Sbjct: 312 TILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLL 371

Query: 444 YEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLG 503
              +  +   NR +F+Y+V Y+D KT+M  NFDYSF FFYLL+TS+  + + + PT LLG
Sbjct: 372 ---EGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFYLLLTSQKTR-LATVPTALLG 427

Query: 504 GYDKWKKVLYSYSEQYNFNMGDYLYKPH 531
           GY+KWKK L++Y++QY+ ++ DYLY+P+
Sbjct: 428 GYEKWKKTLHTYAQQYHISIDDYLYRPY 455

 Score =  174 bits (441), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/225 (44%), Positives = 135/225 (60%), Gaps = 31/225 (13%)

Query: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDV 68
           FTPEYSNELL++V+ +YH+DIKHYYPQ                               D 
Sbjct: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRHERPN-DA 66

Query: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128
           LTAF++GCYY+FLIIPQS+QFQ++NKSY IY++LKK+YENE +MTNV+LMVK EI  VLD
Sbjct: 67  LTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLD 126

Query: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188
            D   +   + HRI K+ RA+S+   +LS+Q+ SLS+  +  + H++  + T        
Sbjct: 127 -DSVKHVVGIEHRITKK-RAFSVPGIDLSDQLASLSLDAAGPRGHLHKTSST-------- 176

Query: 189 HHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLA 233
                           EE    D D++SP+WTAP+LEP DQLKLA
Sbjct: 177 ----------------EE----DADQSSPVWTAPNLEPNDQLKLA 201

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
            UBP7Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1071

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/501 (60%), Positives = 368/501 (73%), Gaps = 61/501 (12%)

Query: 653  MLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQ 712
            +L   R ++IPTIE+SPN+YVSLSITGLRNLGNTCYINSM+QCLFA + FR LFISSK++
Sbjct: 584  ILQPQRAYNIPTIERSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYK 643

Query: 713  SFI-----NDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQ 767
            S++     N S +  +PK+SNS ++LF KMYLNGGCSVVPT FLK  N LRPDL+IPDDQ
Sbjct: 644  SYLQPIRSNGSHY--SPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQ 701

Query: 768  QDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLS 827
            QDTQEFLMI+LDRLHDELS+QQ V N+YPNLLLY+ + LKV N EYKHWFDKNVIGNG+S
Sbjct: 702  QDTQEFLMILLDRLHDELSDQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGIS 761

Query: 828  PIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSS--TTFSRS--KRVKLEECI 883
            PID IF GQMENSLQC+RCG +++NYSTFYVLSLAIP+ S   +   RS  KRVKLE+CI
Sbjct: 762  PIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCI 821

Query: 884  NMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFT 943
            NMFTSDEVLSGENAWDCP+CG +AS + S          S  +N  S  +  + KS+FFT
Sbjct: 822  NMFTSDEVLSGENAWDCPRCGPTASVSTS---------VSALENEPSIVKSKKKKSRFFT 872

Query: 944  LHT---RSH-------------------------RSISPFR---------KKTSPAAVPS 966
            LHT   R H                         RS SPFR           ++P +   
Sbjct: 873  LHTGTKRRHLDFFGDGITEGHNSNNNNTTIFERERSRSPFRMLGGSGKRSSSSTPFSTGG 932

Query: 967  STKNEP--WKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKN 1024
            +  N    +K+KKL T+KT+NF+ LP ILVIHLSRFYYDLTKKNNTV+TYPLILNI+LKN
Sbjct: 933  NDSNNSSDYKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKN 992

Query: 1025 NEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMD 1084
            N+  KY+L+G+VNH+G LISGHYTSLVNK+  H++   + +WYYFDDE VK +R HG  D
Sbjct: 993  NDTMKYKLFGVVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGS-D 1051

Query: 1085 KGILQVSSRDVYVLFYERIYE 1105
            K  L++SS DVYVLFYER+Y+
Sbjct: 1052 KN-LKISSSDVYVLFYERVYD 1071

 Score =  211 bits (538), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 161/245 (65%), Gaps = 25/245 (10%)

Query: 331 DRASNHRKDSYHSIYMVDDGS--ADGITQY-YDSNPYIHSLERLQKQCIITAQELFSILS 387
           DR+  HRKDSYHS+YMVD G+   D    +  +++ +I SL+ LQKQ IITA ELFSILS
Sbjct: 265 DRSVTHRKDSYHSVYMVDSGNLKEDNDDLFNVENDGFIQSLDILQKQSIITAPELFSILS 324

Query: 388 NPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPK 447
           N +E+ K+LLIDLR P+R + NHIVAPNL+ +DP LLW+ +TNTPIY    LE+LL   K
Sbjct: 325 NRVEREKVLLIDLRIPQRSAINHIVAPNLVNVDPNLLWDKQTNTPIYKDDILEHLL---K 381

Query: 448 ARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDK 507
             +   NR +F+YIV+YTD KT+M  NFDY+F FFYL++TS+         T LLGGY+K
Sbjct: 382 ENENFINRNKFDYIVYYTDVKTFMTINFDYAFIFFYLMLTSQKTPLTTVP-TTLLGGYEK 440

Query: 508 WKKVLYSYSEQYNFNMGDYLYKPHRH----------------SGDSIKHHDDLVDSHILQ 551
           WKK L+SY+++Y+ ++ DYLY+P+                  S DS    +    + + +
Sbjct: 441 WKKTLHSYAQEYHISIEDYLYRPYSQKARLQQEQQQQQQQPDSQDSFSAKES--STKVPE 498

Query: 552 PPSWK 556
           PPSWK
Sbjct: 499 PPSWK 503

 Score =  186 bits (472), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 105/227 (46%), Positives = 136/227 (59%), Gaps = 31/227 (13%)

Query: 7   SPFTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 66
           +PFTPEYSNELL++VQ +YH+DIKHYYPQ                               
Sbjct: 15  TPFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHHDRPN- 73

Query: 67  DVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENV 126
           D LTAFI+GCYY+FLIIPQS+QFQ++NKSY IYT+LKK+YENE +MTNV+LMVK EI  V
Sbjct: 74  DALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVV 133

Query: 127 LDMDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQP 186
           LD +   +G+ + HRI K+ RA+S+  ++LS QV SLS+  +  Q+H    T T      
Sbjct: 134 LD-ESVKHGAGIEHRITKK-RAFSVPADDLSGQVASLSLDTAAPQDHGLKGTFTE----- 186

Query: 187 PNHHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLA 233
                                   D +++SP+WTAP+LEP DQLKLA
Sbjct: 187 -----------------------DDAEQSSPVWTAPNLEPNDQLKLA 210

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/451 (63%), Positives = 345/451 (76%), Gaps = 16/451 (3%)

Query: 660  FSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSK 719
            FSIPTIE+SPN +VSLSITGLRN+GNTCYINSMLQCLF    FRDLF+  K+  ++N  K
Sbjct: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLN-PK 628

Query: 720  FPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILD 779
              NT  IS  F+LLF+KMYLNGGCSVVP  FLK C++LRPD  IP DQQDTQEFL+ +LD
Sbjct: 629  RSNTI-ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFLLD 687

Query: 780  RLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMEN 839
             LHDELS   +V N+YPNLLL+D+  L V NKEY  WFD+ +  NGLSPID IF GQMEN
Sbjct: 688  TLHDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMEN 747

Query: 840  SLQCQRCGNSSYNYSTFYVLSLAIPK-PSSTTFSRSKR-VKLEECINMFTSDEVLSGENA 897
            SL+CQRCG +SYNYSTFYVLSLAIP  P   TFSRSK+ ++LE+CIN++T DE+L+GENA
Sbjct: 748  SLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENA 807

Query: 898  WDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHT--RSHRSISPF 955
            WDCPKCG+ ++S+         V   KKKN  S N  H+ +SKFF L +     RS+SPF
Sbjct: 808  WDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHKSRSKFFKLSSSRSGKRSLSPF 867

Query: 956  RKKTSPAAVPSSTKNEPW--KSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVIT 1013
            +         +S K E    KSKK+ TIKTLNFI +P ILVIHLSRF+YDLTKKN T+I 
Sbjct: 868  KS--------NSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMIN 919

Query: 1014 YPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDET 1073
            YPLIL++VLKNNE+A+YRLYGI+NH GNL+SGHYTSLVNK  +H++   +Q+WYYFDDE 
Sbjct: 920  YPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEV 979

Query: 1074 VKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            VK+E NHGD D+GI  +SS DVYVLFYERI+
Sbjct: 980  VKKEFNHGDFDRGITSISSGDVYVLFYERIH 1010

 Score =  131 bits (330), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 75/199 (37%), Positives = 110/199 (55%), Gaps = 16/199 (8%)

Query: 331 DRASNHRKDSYHSIYMVDDGSADGITQYYDSNPYIHSLERLQKQCIITAQELFSILSNPI 390
           DR+  HRKDSYHS+Y+ D        +  D N     L R Q++  I    LFS+L +  
Sbjct: 280 DRSRTHRKDSYHSVYLGD--------ELEDLNNISTGLARHQQENTIDCFALFSLLKDAE 331

Query: 391 EKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKARK 450
            +  LLLIDLR PKRF SNH+VAPNL+ IDP LL++++  T +     L+ ++  P    
Sbjct: 332 SRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANP---- 387

Query: 451 LLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWKK 510
           +L   +Q++ IV+YTD K++M+  F+Y    F LL      K   + P  LLGGY++WK 
Sbjct: 388 ILDKISQYDNIVYYTDYKSFMHLTFNYELILFELLF----KKTGTAIPKSLLGGYEQWKA 443

Query: 511 VLYSYSEQYNFNMGDYLYK 529
            L        F+   +L++
Sbjct: 444 FLNKQLRDSEFDKSLFLFR 462

 Score =  108 bits (271), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/225 (31%), Positives = 113/225 (50%), Gaps = 37/225 (16%)

Query: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDV 68
           +TPEYS+ELL  VQ +Y  D+KHYY +                               D 
Sbjct: 5   YTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKYE-DC 63

Query: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128
           L  +++G +Y+FLIIP S+QF ++NKSY IY++LKKLY++E +M+NVLLMV  ++++VL 
Sbjct: 64  LCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVL- 122

Query: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188
            ++N       H    R+RA+S+    +  Q+ +L ++N+ DQ+ +++  ++        
Sbjct: 123 -NQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNA-DQKSVDDDYKSF------- 173

Query: 189 HHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLA 233
                                     AS  W AP L+P D+L LA
Sbjct: 174 --------------------------ASTEWKAPQLDPNDRLHLA 192

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 974

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/455 (62%), Positives = 346/455 (76%), Gaps = 23/455 (5%)

Query: 657  SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
            S+  +IPTIE+SPN YV+LSITGLRN+G TCY+NSMLQCLFAT+ FRDLF+S+K++ + +
Sbjct: 535  SKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS 594

Query: 717  DSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMI 776
              K+ N  ++S  FN+LFKKMY+NGGCSVVPT FLK CN LRPD RIP DQQDTQEFL+ 
Sbjct: 595  -RKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLF 653

Query: 777  ILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQ 836
            +L +LHDELS    V N+YP LLL+D+  L V  KEY  WF+K++  NG+SPID+IF GQ
Sbjct: 654  LLSQLHDELSESNRVANDYPGLLLHDDKKLDVDQKEYDTWFEKHISENGISPIDNIFQGQ 713

Query: 837  MENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGEN 896
            MEN L CQRCG+SS+NYS FYVLSLAIP  S++TFS+ K+V+LE+CIN+FTSDE L+ EN
Sbjct: 714  MENGLFCQRCGHSSFNYSVFYVLSLAIPS-STSTFSQRKKVRLEDCINLFTSDEQLTNEN 772

Query: 897  AWDCPKCGSSASSTISDSEK-----LLNVTSSKKKNMSSHNEHHRYKSKFFTL-HTRSHR 950
            AWDCPKCG+SAS T  + EK     LLN  +    N          +S+FF L      R
Sbjct: 773  AWDCPKCGTSASGTGPEEEKKKKRFLLNPDTRASGN----------RSRFFKLRSKSRSR 822

Query: 951  SISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNT 1010
            S+SPFRK++S          E  KSKKL TIKTLNFI LP +L IHLSRF+YDLTKKNN 
Sbjct: 823  SVSPFRKQSS-----QQQNLEKLKSKKLTTIKTLNFISLPTVLTIHLSRFFYDLTKKNNK 877

Query: 1011 VITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFD 1070
            VITYPLIL+IVLKN ++ KYRLY I NH GNLISGHYTSLVNK+ +HDL   KQ+WYYFD
Sbjct: 878  VITYPLILSIVLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFD 937

Query: 1071 DETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105
            DETVK++ NHGD+D GI  +SS DVYVLFYE+I E
Sbjct: 938  DETVKKDINHGDIDAGITSISSSDVYVLFYEKIDE 972

 Score =  171 bits (432), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 119/189 (62%), Gaps = 17/189 (8%)

Query: 331 DRASNHRKDSYHSIYMVDDGSADGITQYYDSNPYIHSLERLQKQCIITAQELFSILSNPI 390
           +R + HRKDSYHS++M +D          D + +  +L RLQKQ ++T  +L  IL +  
Sbjct: 264 NRYATHRKDSYHSVHMSND----------DYDAFTFNLARLQKQSVVTCDQLMRILCSQ- 312

Query: 391 EKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKARK 450
           ++  LLLIDLRF KRF +NHI+APNL+ +DP LLWN    +PI     LE  L      K
Sbjct: 313 DRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTL----DNK 368

Query: 451 LLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWKK 510
           LL  R+QFEYIV+YTD KT+M  +FDY   FF L+ TS  NKN+K  P  LLGGY++WKK
Sbjct: 369 LLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTS--NKNLKCTPKVLLGGYEQWKK 426

Query: 511 VLYSYSEQY 519
            L   S+ Y
Sbjct: 427 FLSKSSQAY 435

 Score =  130 bits (326), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 114/224 (50%), Gaps = 39/224 (17%)

Query: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDV 68
           ++PEYSNELLQ V+ +Y  DI HY+P+                               D+
Sbjct: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAE-DL 63

Query: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128
           LTAF+ GC+Y++LIIP SIQFQS++KSY IY +LKK Y++E +MTNVLLMV + IE+ + 
Sbjct: 64  LTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES-MS 122

Query: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188
            DE           I R+RAYS+   +    +++LS +NS              T +P  
Sbjct: 123 KDEVETAR------IMRKRAYSVPYGKSPVTIQALSKANSA-------------TVEP-- 161

Query: 189 HHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKL 232
                           +    T+F+  + +WTAP LEP D LK+
Sbjct: 162 ----------------DAPTETEFENGTTMWTAPELEPNDHLKV 189

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
            (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/445 (63%), Positives = 342/445 (76%), Gaps = 15/445 (3%)

Query: 661  SIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKF 720
            +IPTIE+S N YV+LSITGLRN+GNTCYINSMLQCLFATR FRDLF+S K++ + +  ++
Sbjct: 539  TIPTIEQSSNEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYFS-KRY 597

Query: 721  PNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDR 780
             N  ++S  FN+LFKKMY+NGGCSVVPT FLK CN LRPDL+IP +QQDTQEFL+ +L +
Sbjct: 598  SNPHQLSKYFNILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQ 657

Query: 781  LHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENS 840
            LHDELS    V N+YPNLLL+D+ +L V  KEY  WF+ N+  NG+SPID IF GQMEN 
Sbjct: 658  LHDELSESNHVANDYPNLLLHDDESLAVDQKEYDKWFESNISENGISPIDAIFQGQMENG 717

Query: 841  LQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDC 900
            L CQRCG+SSYNYS FYVLSLAIP  S ++F + K+++LE+CIN+FTSDE L+ ENAWDC
Sbjct: 718  LLCQRCGHSSYNYSMFYVLSLAIP-ASMSSFGQKKKMRLEDCINLFTSDEKLTNENAWDC 776

Query: 901  PKCGSSASSTISDSEKLLNVTSSKKKNMS-SHNEHHRYKSKFFTL-HTRSHRSISPFRKK 958
            PKCGS+ S    D +K       K+K +S S N + R +S+FF L      RS+SPF K 
Sbjct: 777  PKCGSAVSGNGPDGDK------KKRKFLSTSDNSNGRSRSRFFKLRSKSRSRSVSPFHKP 830

Query: 959  TSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLIL 1018
            +S +  P+S   E WKSKKL TIKTLNF+ LP +L IHLSRF YDLT KNN VITYPL L
Sbjct: 831  SSQS--PAS---EKWKSKKLSTIKTLNFVSLPSVLTIHLSRFLYDLTNKNNKVITYPLTL 885

Query: 1019 NIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEER 1078
            +IVLKNNEV  YRLY I NH GNLISGHYTSLVNK+ +HDLG+ +Q+WYYFDDE  K + 
Sbjct: 886  SIVLKNNEVVNYRLYAIANHFGNLISGHYTSLVNKDLSHDLGNGRQKWYYFDDEVAKRDL 945

Query: 1079 NHGDMDKGILQVSSRDVYVLFYERI 1103
            NHG++D GI  VSS DVYVLFYE+I
Sbjct: 946  NHGNIDAGITSVSSSDVYVLFYEKI 970

 Score =  145 bits (365), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 108/182 (59%), Gaps = 17/182 (9%)

Query: 331 DRASNHRKDSYHSIYMVDDGSADGITQYYDSNPYIHSLERLQKQCIITAQELFSILSNPI 390
           DR + HRK SYHS++M  D         YDS  +  +  RLQKQ IIT  +L  IL +  
Sbjct: 264 DRYNTHRKGSYHSVHMTGDE--------YDS--FTFNTARLQKQSIITCDKLLRILDSE- 312

Query: 391 EKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKARK 450
           E  +LLL+DLRF KRF +NHIVAPNL+ +DPM LW+      I     LE L        
Sbjct: 313 EAERLLLVDLRFIKRFETNHIVAPNLVNLDPMNLWDFAKGRAIEGDAPLEVL----NKNH 368

Query: 451 LLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWKK 510
            L++ +QF++IV+YTD KT+M  +FDY   FF +L TS  N  I   P  LLGGY++WKK
Sbjct: 369 ALKDLSQFKHIVYYTDMKTFMRLDFDYQLVFFQMLYTS--NWRISCTPKVLLGGYEQWKK 426

Query: 511 VL 512
            L
Sbjct: 427 FL 428

 Score =  134 bits (338), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 117/224 (52%), Gaps = 39/224 (17%)

Query: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDV 68
           ++PEYSNELLQ V+ +Y  DI HYYP+                               ++
Sbjct: 5   YSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQNS-EL 63

Query: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128
           LTAF+VGC+Y++LIIP SIQF S++KSY IY +L+K Y++ET+MTNVLLMV   IE+V  
Sbjct: 64  LTAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTGVIESV-- 121

Query: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188
                +  +L    I R+RAYS+   +LS+++++L++S              S TN  P 
Sbjct: 122 -----SRDELESAKIMRKRAYSVPHKKLSDKMQALTLS----------PETASSTNAGPE 166

Query: 189 HHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKL 232
                                TD +  S +WTAP LEP D LK+
Sbjct: 167 ---------------------TDNENDSTMWTAPELEPNDHLKV 189

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  555 bits (1430), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 280/476 (58%), Positives = 349/476 (73%), Gaps = 40/476 (8%)

Query: 645  YHQERESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRD 704
            Y+Q++      +S    +PTIE++PN YVSLSITGLRNLGNTCYI+SMLQCLFAT   RD
Sbjct: 592  YNQKKHQYKALKSYATPVPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRD 651

Query: 705  LFISSKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIP 764
            LFI++K++S+IN  K  +   +S SF++LF+KMYLNGGCSVVP SFLKTCN LRPDL+IP
Sbjct: 652  LFITTKYESYIN-HKVTDKINLSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIP 710

Query: 765  DDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGN 824
            DDQQDTQEFLM++LDRLHDELS +  V+N+Y NLLLYD   + V+  +YK WF+ + +  
Sbjct: 711  DDQQDTQEFLMLVLDRLHDELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSG 770

Query: 825  GLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECIN 884
            G+SPID IF GQ+ENS+ CQRCG SS+NYS+FYVLSLAIPK S  +FSR+ RVKLE+CIN
Sbjct: 771  GVSPIDDIFQGQIENSINCQRCGYSSFNYSSFYVLSLAIPKISVMSFSRTNRVKLEDCIN 830

Query: 885  MFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHR-------- 936
            MFT DEVLSGENAWDC +CGS + + +                 +SHN+HH+        
Sbjct: 831  MFTRDEVLSGENAWDCSRCGSQSDNFVK----------------TSHNDHHKEHTSETTD 874

Query: 937  -----YKSKFFTLHTR---SHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIV 988
                  KS+ F L  +   + RS+SPF + +S  +           SKK+ TIK+LNFI 
Sbjct: 875  DSKQNRKSRLFLLPKKYNPTSRSLSPFGRHSSHKSSEKWK------SKKMETIKSLNFIK 928

Query: 989  LPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLI-SGHY 1047
            +P ILVIHLSRF+YD++KKN TV+ YPLILNIVLKN EV KYRLY IVNH GN + SGHY
Sbjct: 929  MPKILVIHLSRFFYDMSKKNETVVAYPLILNIVLKNEEVCKYRLYAIVNHMGNQVASGHY 988

Query: 1048 TSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERI 1103
            T+LVNK  NHDLG  +Q+WYYFDDE VK E NHG++D+G+ +VSS  VYVLFYE+I
Sbjct: 989  TTLVNKNRNHDLGKNEQQWYYFDDEVVKHELNHGNIDEGVNKVSSSHVYVLFYEKI 1044

 Score =  205 bits (522), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 103/208 (49%), Positives = 146/208 (70%), Gaps = 6/208 (2%)

Query: 325 IEQTNPDRASNHRKDSYHSIYMVD-DGSADGITQYYDSNPYIHSLERLQKQCIITAQELF 383
           IE    DR+  HRKDSYHS+YM + D  +D    Y  SN YI S++RLQKQ +IT  EL+
Sbjct: 294 IEDLPVDRSVTHRKDSYHSVYMNNQDEESDSGAHYGLSNSYIQSMDRLQKQNVITCSELY 353

Query: 384 SILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLL 443
           SILS+P E+ KLLL+DLR PK   +NHI+AP++I IDP LLWN +T TPIY    L   +
Sbjct: 354 SILSSPTERQKLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNEETQTPIYSFEELVKRI 413

Query: 444 YEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLG 503
             P    L+    +F+YIV+Y+D +T+M T++D+ FTFFYLL+++K+  N+K  PT+LLG
Sbjct: 414 NNP----LISEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYLLLSTKS-LNLKQVPTNLLG 468

Query: 504 GYDKWKKVLYSYSEQYNFNMGDYLYKPH 531
           G++KWKKVL +Y+++Y  ++  ++ K H
Sbjct: 469 GFEKWKKVLKTYNKEYGIDITPFIKKLH 496

 Score =  126 bits (316), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 128/233 (54%), Gaps = 11/233 (4%)

Query: 7   SPFTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 66
           S FTPEYSNELL++V   Y+++IK ++PQ                               
Sbjct: 5   STFTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYD- 63

Query: 67  DVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENV 126
           + L+A+IVGC+YL+LIIP S QFQ +NKS+ IY ELK LY+N+ +MTNVL +VK+E++++
Sbjct: 64  ECLSAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSI 123

Query: 127 LDMDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTN-- 184
           L  DE+    +   ++IKR RAYS    +++N  K   +  SI+  H N +T ++     
Sbjct: 124 L--DESILELEGIEKVIKRDRAYSSPAPKVNNISKFSKL--SINDNHHNGETISTDNKLQ 179

Query: 185 ----QPPNHHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLA 233
               Q PN+              +   ++ + +  +P+W  PSLEP DQLKLA
Sbjct: 180 SHFPQTPNYSNSNNSTGSFNNVKSNSNSSEEAEDTAPIWHIPSLEPNDQLKLA 232

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
            UBP11Ubiquitin-specific protease that cleaves ubiquitin
            from ubiquitinated proteins
          Length = 717

 Score =  515 bits (1327), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 260/459 (56%), Positives = 343/459 (74%), Gaps = 22/459 (4%)

Query: 650  ESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISS 709
            E++  +  + +++P IE S +L   LSITGL+N  NTCYINS++QCLF T LFRDLF++ 
Sbjct: 270  EAIESSAPKAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTK 329

Query: 710  KFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQD 769
            K++ F+N +K+P   ++S S  +LFKKMYLNGG +++P  FLK C  LRPDL IPDDQQD
Sbjct: 330  KYRLFLNTNKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQD 389

Query: 770  TQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPI 829
            TQEFL+I+L R+H+ELSN+  VV  YP+L+ YD N L+V   +Y+ W+++NVI +GLSPI
Sbjct: 390  TQEFLLIVLARIHEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPI 448

Query: 830  DHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTF-SRSKRVKLEECINMFTS 888
            DHI+ GQ+EN L+CQRCGNSSY+YSTFYVLSLAIPK S  +F S+S+++KLE+CIN+FT 
Sbjct: 449  DHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTG 508

Query: 889  DEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRS 948
            DE LSG+NAWDCP C       I+DS+       SKK+ ++S  +    KS  F  H+RS
Sbjct: 509  DEELSGDNAWDCPNC------RITDSK-------SKKEEITSQKK----KSTIFGFHSRS 551

Query: 949  HRSISPFRKKTSPAAVPSSTKNEPWK-SKKLITIKTLNFIVLPPILVIHLSRFYYDLTKK 1007
             RS SP        +   STKN   + SKKL TIK+L+FIVLPPILVIHLSRFYYDLTKK
Sbjct: 552  -RSKSPHHHHHHHHSSDDSTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKK 610

Query: 1008 NNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWY 1067
            N+TVITYPLILNI+LKN +V +Y+LYG VNHSGNLI+GHYTS+VNKE +H++G  +Q W 
Sbjct: 611  NSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWV 670

Query: 1068 YFDDETVKEER-NHGDMDKGILQVSSRDVYVLFYERIYE 1105
             FDD+ +++ R +  + + G  ++SS +VYVLFYER+ E
Sbjct: 671  TFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFYERMDE 709

 Score = 90.9 bits (224), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 83/158 (52%), Gaps = 7/158 (4%)

Query: 15  NELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVLTAFIV 74
           +++L  V+ +Y  DIK +Y Q                               + LTAFI+
Sbjct: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEM-EALTAFII 64

Query: 75  GCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD--MDEN 132
           GCYYL+LIIPQS+QFQ++N  Y  Y +LK  Y++E  M  VL +V+DE   ++D  + E+
Sbjct: 65  GCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAES 124

Query: 133 NNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSID 170
           N       R IKR+RAYS+ +  L   + SLSI N  D
Sbjct: 125 NGIC----RTIKRKRAYSLPLRPLPVHMASLSIHNKFD 158

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
            YKR098C (REAL)
          Length = 721

 Score =  511 bits (1315), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 258/460 (56%), Positives = 335/460 (72%), Gaps = 23/460 (5%)

Query: 649  RESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFIS 708
            RE   +  S    +PTIE S +L   LSITGL+N  NTCYINS++QCLF T LFRDLF++
Sbjct: 274  REKKTVRSSALNKLPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLT 333

Query: 709  SKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQ 768
             K++ F+   K+P   ++S S  +LFKKMYLNGG ++ P  FLK C  LRPDL IPDDQQ
Sbjct: 334  KKYRLFLQTDKYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQ 393

Query: 769  DTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSP 828
            DTQEFL+IIL RLH+ELSN   V   YP+L+ YD N  +V   +Y+ W++ +V+ +GLSP
Sbjct: 394  DTQEFLLIILARLHEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSP 452

Query: 829  IDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTF-SRSKRVKLEECINMFT 887
            ID+IF GQMEN L+CQRCGNSS++YSTFYVLSLAIPK S  +F S+SK++KLE+CIN+FT
Sbjct: 453  IDYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFT 512

Query: 888  SDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTR 947
            SDE LSG+N+WDCP CG+      +D +  +N ++S+KK           KS FF+ H+R
Sbjct: 513  SDEELSGDNSWDCPNCGT------TDLKTKINESTSQKK-----------KSTFFSFHSR 555

Query: 948  SHRSISPFRKKTSPAAVPSSTK--NEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLT 1005
            S RS SP            +T+  ++ W S+KL T+K+ +FIVLPPILVIHLSRFYYDLT
Sbjct: 556  S-RSKSPHHHHHHHHHSHDNTEKHSKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLT 614

Query: 1006 KKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQR 1065
            +KNNTVITYPLILN++LKNN+V +Y+LYG VNH GNL++GHYTS VNKE NH++G  +Q 
Sbjct: 615  RKNNTVITYPLILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQV 674

Query: 1066 WYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105
            W  FDD+ +K+  +H D + G  +VSS +VYVLFYER+ E
Sbjct: 675  WITFDDDYIKQH-HHDDFEAGKTEVSSSEVYVLFYERMDE 713

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/158 (33%), Positives = 85/158 (53%), Gaps = 7/158 (4%)

Query: 15  NELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVLTAFIV 74
           ++++  V+++Y  DIK +Y Q                               + LTAFI+
Sbjct: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEM-EALTAFII 64

Query: 75  GCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD--MDEN 132
           G YYL+L+IPQS+QFQ++N  Y  Y +LK  Y++E  M+ VL +VK+E   ++D  + ++
Sbjct: 65  GGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDS 124

Query: 133 NNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSID 170
           N  S    R I R+RAYS+ +  L   + SLSI N ++
Sbjct: 125 NRIS----RTITRKRAYSLPLRPLPVHMASLSILNQLE 158

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  528 bits (1359), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 268/499 (53%), Positives = 340/499 (68%), Gaps = 20/499 (4%)

Query: 612  DLHSTKSQQHRNQYLTSYQHQVELA-----RDDETRRKYHQERESLMLTRSRKFSIPTIE 666
            D  S +     N Y ++Y+    ++     R  E       +   L+      FSIPTIE
Sbjct: 1034 DRRSERRNHRSNAYASAYRKNSSISHKGADRSPEETNNIKVDGHKLIRNPIPHFSIPTIE 1093

Query: 667  KSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKI 726
             S N YV+LSITGLRN+ NTCYINSMLQCLF+T  FR+LF+S+K+  ++   K P    +
Sbjct: 1094 NSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL---KSPEMDTM 1150

Query: 727  SNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELS 786
            S SF +LF+KMY+NGGCSVVP+ FLK CN L+PDLRIP  QQDTQEFL+ +LD+LHDELS
Sbjct: 1151 SRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFLLDKLHDELS 1210

Query: 787  NQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRC 846
            + + V N+Y +LLL+D   L V + +Y  WFD+N+  NGLSPID +F GQMEN L CQRC
Sbjct: 1211 SIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRC 1270

Query: 847  GNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSS 906
            G SSY YSTFYVLSLA+P P +  F ++K+++LE+CIN FT DEVLS +NAWDCP+C S 
Sbjct: 1271 GYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCCSP 1330

Query: 907  ASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTSPAAVPS 966
            +     D +    +++S      S N  +  +SK F    +         +  S A   S
Sbjct: 1331 SDYMSYDHKGKRKISTS----FESLNGGNSSRSKLFKFGYK--------MRSRSEAPKFS 1378

Query: 967  STKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNE 1026
            S  ++   + K  T+K+LNFI +P ILVIHLSRF YDLTKKNN V++YPLILNIVLKN+E
Sbjct: 1379 SKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSE 1438

Query: 1027 VAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKG 1086
            VAK+RLY IVNH G LISGHYTSLVNKE NH++   KQ+WYYFDDE VK + NHGD D G
Sbjct: 1439 VAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNG 1498

Query: 1087 ILQVSSRDVYVLFYERIYE 1105
            I  VSS +VYVLFYERI++
Sbjct: 1499 IASVSSSNVYVLFYERIFD 1517

 Score =  110 bits (274), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 101/180 (56%), Gaps = 15/180 (8%)

Query: 367 SLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWN 426
           S+  L +   I   +L S L++  E+S +LLIDLR PKR+  +HI+A N+I IDP LLW+
Sbjct: 311 SIMWLYESSSIKCLDLLSKLTSS-ERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWD 369

Query: 427 SKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLV 486
            +   P+  +  LE ++       L ++R QF  IV YTDN TYM  +FD+ F  F LL 
Sbjct: 370 DEKGAPVSSVKELELVI----DNHLFRSRRQFATIVCYTDNYTYMQIDFDFVFLLFRLLY 425

Query: 487 TSKTNKNIKSAPTHLLGGYDKWKKVLYSYSEQYNFNMGDYLYK-PHRHSGDSIKHHDDLV 545
             +    +K+    L GGY++WK  L       +  + D+L+K PH++     +H +D+V
Sbjct: 426 LGRPQLVLKT----LSGGYEQWKSFLKELKRTESIILSDFLWKRPHKN-----EHSNDIV 476

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 115/233 (49%), Gaps = 29/233 (12%)

Query: 7   SPFTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 66
           +P+ PEYS EL Q V+ +Y ++++  Y Q                               
Sbjct: 3   APYMPEYSLELQQFVEEVYVENLEDCY-QKLRLEKLIDLLEHGAYLLESYRELLGRGQVE 61

Query: 67  DVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENV 126
             +TA++VG +YL+LIIPQSI+F ++N SY IY +LK+ YE++ +M NV+L+V  ++ +V
Sbjct: 62  AGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSV 121

Query: 127 LDMDENNNGSD-LNHRIIKRQRAYSIS---INELSNQVKSLSISNSIDQEH--INNKTET 180
           + +  +  G +    R   R+RAYS+     ++L++ +  LSI  S  +       KTE 
Sbjct: 122 MQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQ 181

Query: 181 SLTNQPPNHHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLA 233
               Q             D+E+ +             +W+AP+LEP DQLKLA
Sbjct: 182 GAFGQQ----------QQDDEWEDT------------VWSAPNLEPDDQLKLA 212

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
            YKR098C (REAL)
          Length = 712

 Score =  502 bits (1293), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 262/483 (54%), Positives = 336/483 (69%), Gaps = 23/483 (4%)

Query: 627  TSYQHQVELARDDETRRKYHQERESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNT 686
            TS Q  V         +K  Q+ E+     S  F  PTIE S  L   LSITGL+N  NT
Sbjct: 241  TSSQAAVSSQDSSSQSKKAKQKEEAASSFISETFEPPTIEDSKGLLSKLSITGLQNPCNT 300

Query: 687  CYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVV 746
            CYINS++QCLF +  FRDLF++ K++ F+   ++P   ++S S   LFKKMY NGG ++V
Sbjct: 301  CYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEEYPKEVQLSRSIYSLFKKMYANGGSAIV 360

Query: 747  PTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNL 806
            P  FLK C  LRPDL IPDDQQDTQEFL+IIL R+H+ELSN+  V   Y +L+ YD N L
Sbjct: 361  PNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARIHEELSNEN-VTKYYCDLVSYDTNAL 419

Query: 807  KVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKP 866
            +V   +Y+ W+++ ++ +GLSPIDHIF GQMEN L+CQRCGNSS++YSTFYVLSLAIPK 
Sbjct: 420  QVNPIKYQKWYEETILADGLSPIDHIFRGQMENILKCQRCGNSSFSYSTFYVLSLAIPKN 479

Query: 867  SSTTF-SRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKK 925
            S  +F S+SK++KLE+CIN+FTSDE L+G+NAWDCP+C       I DS+      SS+K
Sbjct: 480  SVHSFTSKSKKIKLEDCINLFTSDEELTGDNAWDCPEC------RIDDSKLKTGENSSQK 533

Query: 926  KNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTSPA-AVPSSTKNE-PWKSKKLITIKT 983
            K           +S  F+ H+RS RS SP            ++TKN   WKSK+L TIK+
Sbjct: 534  K-----------RSPLFSFHSRS-RSKSPHHHHHYHHHGSDNTTKNSNKWKSKRLTTIKS 581

Query: 984  LNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLI 1043
            L+FI LPPILVIHLSRFYYDLTKKNN VITYPLILNI+LKNN+V +Y+LYG VNHSGNLI
Sbjct: 582  LDFIFLPPILVIHLSRFYYDLTKKNNAVITYPLILNIILKNNKVVRYKLYGTVNHSGNLI 641

Query: 1044 SGHYTSLVNKEPNHDLGSKKQRWYYFDDE-TVKEERNHGDMDKGILQVSSRDVYVLFYER 1102
            +GHYTS+VNKE +H++G  KQ W  FDD+  ++  ++    + G  ++SS +VYVLFYER
Sbjct: 642  TGHYTSVVNKERSHEIGLNKQVWVTFDDDFIIQHHKDRDGFEAGKTKMSSSEVYVLFYER 701

Query: 1103 IYE 1105
            + E
Sbjct: 702  MDE 704

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 83/159 (52%), Gaps = 9/159 (5%)

Query: 15  NELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVLTAFIV 74
           +++L  V+ +Y  DIK +Y Q                               + LTAFI+
Sbjct: 6   DQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREV-EALTAFII 64

Query: 75  GCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLDMDENNN 134
           G YYL+LIIPQS+QFQ+++  Y  Y +LK  Y++E  M+ VL +V+DE  +++D      
Sbjct: 65  GGYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVD----QY 120

Query: 135 GSDLNHRI---IKRQRAYSISINELSNQVKSLSISNSID 170
            SD N RI   I R+RAYS+ +  L   + SLSI N  D
Sbjct: 121 LSDSN-RITVTITRKRAYSLPLRPLPVHMASLSIHNQSD 158

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  513 bits (1322), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/470 (58%), Positives = 340/470 (72%), Gaps = 24/470 (5%)

Query: 646  HQERESLMLTRSRK---FSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLF 702
            H ER    L+       FS+PTIEK+PN Y++LSITGLRN+ NTCYINSMLQCLF+T  F
Sbjct: 711  HTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEF 770

Query: 703  RDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLR 762
            R+LF+S+K+  ++  S   N   +S SF +LFKKMY+NGGCSVVP+ FLK C+ L+PDLR
Sbjct: 771  RNLFLSNKYSRYLKSSNMDN---MSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLR 827

Query: 763  IPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVI 822
            IP  QQDTQEFL+ +LDRL DELS    VVN+YP LLL++ + LKV +KEY  WFD+N  
Sbjct: 828  IPHGQQDTQEFLLFLLDRLRDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFE 887

Query: 823  GNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEEC 882
             NGLSPID IF GQ+E+ L CQRC  SSY+YSTFYVLSLA+P P S  F ++K+++LE+C
Sbjct: 888  KNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDC 947

Query: 883  INMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKK--------NMSSHNEH 934
            IN FT DEVL+G+N WDCPKCG ++S      ++ +N   SK+K        N +S N +
Sbjct: 948  INFFTCDEVLTGQNPWDCPKCGVNSS-----GDRQMNSEKSKRKNKFFMGSENANSANSN 1002

Query: 935  HRYKSKFFTL-HTRSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPIL 993
              +  + F +      RS SPF   + P +  S   +E   +KKL TIK+LNFI LP IL
Sbjct: 1003 RDHLPRLFKIGSKSRSRSSSPF--ISGPKS--SGKTHEKRYNKKLATIKSLNFITLPRIL 1058

Query: 994  VIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNK 1053
            +IHLSRF YDLTKKNNTV+TYPLILNIVLKNNEVAKYRLY  +NH G LISGHYTSLVNK
Sbjct: 1059 IIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNK 1118

Query: 1054 EPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERI 1103
            +  H++   KQ+WYYFDDE VK + NHG+ D+GI  VSS DVY+LFYERI
Sbjct: 1119 DLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168

 Score =  115 bits (287), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 109/206 (52%), Gaps = 19/206 (9%)

Query: 324 TIEQTNPDRASNHRKDSYHSIYMVDDGSADGITQYYDSNPYIHSLERLQKQCIITAQELF 383
           + EQ   DR  N R + Y+      +G+A G+      NP    L RL +   I   +L 
Sbjct: 407 SFEQQELDRPHNSRVEPYNPF---ANGNAAGLE---SCNP----LTRLYETSSIKCSDLM 456

Query: 384 SILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLL 443
            IL + I+  ++L IDLR PKR+  NHIVA +LI IDP+LLW+++ + PI  +   E  L
Sbjct: 457 IILESDIQ-DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRL 515

Query: 444 YEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLG 503
             P    L   R QF Y+V YTDN T MN +F +  TFF L+   K     K     L G
Sbjct: 516 DNP----LFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPRLLTKC----LQG 567

Query: 504 GYDKWKKVLYSYSEQYNFNMGDYLYK 529
           GYD+W+  L + ++  +  + D++++
Sbjct: 568 GYDQWRLYLKTNTKSIHAKISDFMWR 593

 Score = 92.0 bits (227), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 105/224 (46%), Gaps = 27/224 (12%)

Query: 8   PFTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD 67
           P+ PEYS+EL   VQ  Y   ++  YP+                               +
Sbjct: 4   PYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTR-E 62

Query: 68  VLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVL 127
            L A+++G +YL+LIIPQSI+F ++N SY +YT+L+K YE E +MTNV+ MV ++++ VL
Sbjct: 63  GLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVL 122

Query: 128 DMDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPP 187
                 +G   + ++  R+RAYS+    ++        S+S+    ++ K          
Sbjct: 123 LRQTPEDGERGDTKLY-RKRAYSVPEKGVARS------SDSLQHLTVDGKRRGG------ 169

Query: 188 NHHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLK 231
            HH +   +         E+      +A  LW+AP LE  D L+
Sbjct: 170 -HHAIGGAI--------PEVAV----QADTLWSAPKLEENDLLR 200

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
            YKR098C (REAL)
          Length = 724

 Score =  498 bits (1281), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 262/474 (55%), Positives = 332/474 (70%), Gaps = 37/474 (7%)

Query: 642  RRKYHQERESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRL 701
            + K  +E E++  + S+ F +P IE S NL   LSITGLRN  NTCYINSM+QCLF+T L
Sbjct: 260  KSKEQEEEETVSASTSKTFKLPVIENSDNLLSELSITGLRNPCNTCYINSMVQCLFSTTL 319

Query: 702  FRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDL 761
            FRDLF++ K++ F+ + K+P   ++S+S  +LFKKMYLNGG +++P  FLK C  LRPDL
Sbjct: 320  FRDLFLTKKYKLFLENEKYPKGLQLSHSIYVLFKKMYLNGGRAIIPNGFLKVCKKLRPDL 379

Query: 762  RIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNV 821
             IPDDQQDTQEFLMIIL R+H+ELSN   V   Y +L+L D   L+V   +Y+ W ++ V
Sbjct: 380  NIPDDQQDTQEFLMIILARIHEELSNNN-VTKYYSDLILNDATALQVNPSKYQKWCEETV 438

Query: 822  IGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTF-SRSKRVKLE 880
            + +GLSPIDHIF GQMEN L+CQRCGNSSY+YSTFYVLSLAIPK S  +F S+SK++KLE
Sbjct: 439  LSDGLSPIDHIFQGQMENILKCQRCGNSSYSYSTFYVLSLAIPKASLYSFTSKSKKIKLE 498

Query: 881  ECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSK 940
            +CIN FTSDE LS +NAWDCPKC  +A   +   E L     S+KK           +S 
Sbjct: 499  DCINFFTSDEELSDDNAWDCPKC-RTAEYKLKKDENL-----SQKK-----------RSI 541

Query: 941  FFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWKS-------------KKLITIKTLNFI 987
             F LH+R  RS SP   +          KN+  K              KKL TIK+L+FI
Sbjct: 542  LFNLHSRP-RSKSP---RHRHHHHHHRHKNDDAKKNDDATKNSKKWKSKKLTTIKSLDFI 597

Query: 988  VLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHY 1047
            VLPPILVIHLSRFYYDLTKKNNTVITYPLILNI+LKNN+V +Y+LY  VNHSGNLI+GHY
Sbjct: 598  VLPPILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNKVVRYKLYATVNHSGNLINGHY 657

Query: 1048 TSLVNKEPNHDLGSKKQRWYYFDDETVKE-ERNHGDMDKGILQVSSRDVYVLFY 1100
            TS+VNKE +H++G  +Q W  FDD+ +K+  ++  D + G  ++SS +VYVLFY
Sbjct: 658  TSVVNKEKSHEIGLNRQVWVTFDDDVIKQHHKDRDDFETGRTEISSNEVYVLFY 711

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/158 (37%), Positives = 88/158 (55%), Gaps = 7/158 (4%)

Query: 67  DVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENV 126
           + LTAFIVG +YL+L+IP S+QFQ++N  Y  Y +LK  Y++E  M+ VL +VKD  E+ 
Sbjct: 57  NALTAFIVGGFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKD--EST 114

Query: 127 LDMDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQP 186
           + +D+  + S    R +KR+RAYS+ +  L   + SLSI N +D        E S   +P
Sbjct: 115 IIVDQCLSDSKRISRSMKRKRAYSLPLRPLPVHMASLSIHNQLDVPLREMPIEIS---KP 171

Query: 187 PNHHLLPIILHCDEE--FSNEEINATDFDRASPLWTAP 222
            N  L+  +   + E  FSNE    TD +      T P
Sbjct: 172 INDTLVKGLAKEENELKFSNELEEGTDTEGRDSTSTEP 209

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
            YIL156W
          Length = 846

 Score =  451 bits (1160), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 239/460 (51%), Positives = 319/460 (69%), Gaps = 33/460 (7%)

Query: 649  RESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFIS 708
            R   ++TR  K+ +P +  S NLYV LSI+GLRNLGNTCYINSMLQCLFAT  FR+LF+S
Sbjct: 417  RPKRIVTRYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLS 476

Query: 709  SKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQ 768
            ++++ +I        P +SNSF++LF+KMYLNGGC+V+P  FLKTCN LRPDLRIPD QQ
Sbjct: 477  NRYKEYIGTKV---DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQ 533

Query: 769  DTQEFLMIILDRLHDEL-SNQQEVVNEYPNLLLYDENNLKVQNK-EYKHWFDKNVIGNGL 826
            DTQEFL+++LD+LH+EL SNQ  +V+E+P+L+ YD +++ V+N  EYK WF +++   GL
Sbjct: 534  DTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGL 593

Query: 827  SPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMF 886
            S I  IF GQ+ENSL+CQRC  +S NYS F  LSL+IP          K V LE+CI++F
Sbjct: 594  SLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKF---RKLVDLEDCISLF 650

Query: 887  TSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHT 946
              +E+L+GENAW+CPKC SS+++  S  +       SK KN  SHN+         T   
Sbjct: 651  IENEMLTGENAWNCPKCSSSSNNNTSKRKSRGFFKFSKHKN-RSHND--------LTFSE 701

Query: 947  RSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYD-LT 1005
             +H S               S+ +  +  KKL+T K+ +FI LP +L+IHLSRF    L 
Sbjct: 702  YNHNS---------------SSDDVKFSKKKLVTRKSTSFIKLPNLLIIHLSRFSMSGLL 746

Query: 1006 KKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQR 1065
             KNNT I YP IL I LKN E  +++LYG+VNH GNL +GHYTSL+NKEP+HDL  ++Q+
Sbjct: 747  DKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQK 806

Query: 1066 WYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105
            W+YFDDETVK++ N+ D+DK + ++SS DVYVLFYE+I E
Sbjct: 807  WFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFYEKIIE 846

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 103/162 (63%), Gaps = 12/162 (7%)

Query: 368 LERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNS 427
           L+ L ++C IT  ELFSILSNP ++ K+L+IDLR  + F+   I +PNLI  DP+ LWN+
Sbjct: 206 LKHLYEECFITPHELFSILSNPSDRLKILIIDLRLSRYFNLQTIRSPNLIKFDPIELWNN 265

Query: 428 KTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMN-TNFDYSFTFFYLLV 486
           +  TP+   T+L        +  L Q    F YI+ Y+DN+T     +F+Y+F+FF LL+
Sbjct: 266 RDQTPVLHRTSL-------FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNFSFFKLLM 318

Query: 487 TSKTNKNIKSAPTHLLGGYDKWKKVLYSYSEQYNFNMGDYLY 528
           +S    ++K  P  LLGG++KW++++ SYSEQY     +Y++
Sbjct: 319 SS----SMKVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIF 356

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 43/63 (68%), Gaps = 2/63 (3%)

Query: 67  DVLTAFIVGCYYLFLIIPQS-IQFQSKNKSY-GIYTELKKLYENETHMTNVLLMVKDEIE 124
           D L +FI+G +Y+ L+IP S    +S N  Y  IY +LKK YE++ +++++L +++ E E
Sbjct: 60  DSLDSFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESE 119

Query: 125 NVL 127
           N+L
Sbjct: 120 NIL 122

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 16/21 (76%)

Query: 213 DRASPLWTAPSLEPKDQLKLA 233
           D ++ +W AP LEP DQLKLA
Sbjct: 143 DSSTTIWQAPFLEPNDQLKLA 163

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
            YIL156W possible pseudogene; NNN added to avoid internal
            stop codon
          Length = 656

 Score =  409 bits (1050), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 235/474 (49%), Positives = 303/474 (63%), Gaps = 41/474 (8%)

Query: 648  ERESLMLTRS---RKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRD 704
            E  S +L R    +K ++P I+ + N+   LS+ GLRN GNTCYINSM+QCLF T++ RD
Sbjct: 205  ESLSFVLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRD 264

Query: 705  LFISSK-FQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRI 763
            LFIS   ++ FI   K     KIS  F  L   MY NGG SV+P +FL+  ++LRPDL I
Sbjct: 265  LFISEXXYKDFI---KKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNI 321

Query: 764  PDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIG 823
            P DQQDTQEFL+I+LD LHDEL    ++++   N  + D+ NL    KEY  W   N+  
Sbjct: 322  PKDQQDTQEFLVILLDILHDELVYTDDLIS---NNYVSDDINL---GKEYMPWLQNNLKA 375

Query: 824  NGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECI 883
            NG SPID IF GQ+EN LQCQRCGN+SYNYS FY+LSLAIPK +    +   RVKLE+CI
Sbjct: 376  NGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKE--NSKNRVKLEDCI 433

Query: 884  NMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSS-KKKNMSSHNEHHRYKSKFF 942
            N FTSDE+L+GENAW+CPKC  +   T  +++    V +  K K+++  N        FF
Sbjct: 434  NFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLN--------FF 485

Query: 943  TLHTRSHRSISPFRKKTSPAAV------PSSTKNEPWKSKKLITIKTLNFIVLPPILVIH 996
             LH    + +SP                        +K++KLIT+K LNFI LPPILVIH
Sbjct: 486  KLH----KVLSPSSGNHHRHHHHHHHHKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIH 541

Query: 997  LSRFYYDLTKKNNTVITYPLILNIVLKNN-EVAKYRLYGIVNHSGNLISGHYTSLVNKEP 1055
            LSRFYY+ TKKNN VITYPLILNI++KNN +V KY+LYG++NH G L  GHYTS+VNK+ 
Sbjct: 542  LSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDL 601

Query: 1056 NHDLGSKKQRWYYFDDETVKEERNHGDMDKGIL------QVSSRDVYVLFYERI 1103
            NH L   +Q+WY FDDE +K+  ++  ++K         +  S  VYVLFYERI
Sbjct: 602  NHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERI 655

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 71/149 (47%), Gaps = 5/149 (3%)

Query: 2   SVHGPSPFTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXX 61
           S+ G   F+    ++L   V SI+  DIK YY +                          
Sbjct: 15  SLDGDPIFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSH 74

Query: 62  XXXXXDVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKD 121
                    AF+ G +YLFLIIP  +QFQ+KNK +  Y +LK  YE +  M N+L  VK+
Sbjct: 75  KSRKRQATLAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKE 134

Query: 122 EIENVLDMDENNNGSDLNHRIIKRQRAYS 150
           +  ++L+ D     S +N RI+K+ RAY+
Sbjct: 135 KSVSILEQDL----SGINRRILKK-RAYT 158

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
            weakly similar to uniprot|P36026 Saccharomyces cerevisiae
            YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  367 bits (943), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 190/449 (42%), Positives = 277/449 (61%), Gaps = 11/449 (2%)

Query: 657  SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
            S+++++P I  +      LS+ G+RN+GNTCY+NSMLQCLF +  FRDLF++ KF+ F  
Sbjct: 192  SKQYTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFLTDKFEMFKA 251

Query: 717  DSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMI 776
            ++    +  I+N  +LLFKKMY NGGC+++P SF++TC  LRPD +IP  QQDTQEFLM 
Sbjct: 252  ETN-SESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFLMF 310

Query: 777  ILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQ 836
            +L+RL  EL+N    V +   +     N    +NK Y  W+++ +  N LSPID +F G 
Sbjct: 311  VLERLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNLSPIDLLFRGD 370

Query: 837  MENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGEN 896
            +E+ L C+ C  S+  +S+FY+LSL IPK  S+ F +SK ++LE+CIN+FT  E+L+GEN
Sbjct: 371  VESKLICKHCNESASTFSSFYILSLNIPKEKSSLFFKSKTIRLEDCINLFTRKEILTGEN 430

Query: 897  AWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFR 956
            +W CP C + A   + D++K       K  N+  H++  R+ S      T  +   + F 
Sbjct: 431  SWACPSCETKARYNVIDNDK---TYQQKHTNIGKHSKFPRFFSHIEAGKTERNSGANKFS 487

Query: 957  KKTSPAAVPSSTKNEP--WKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITY 1014
            +         + +NE    + KK  TI +++F+ LPPILVIHLSRF YD++KKN + I+Y
Sbjct: 488  Q-----LKYDNLENEQRHRQQKKSETILSVSFVSLPPILVIHLSRFCYDISKKNTSNISY 542

Query: 1015 PLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            P+ L +   +N    YRLYG +NH G+   GHYT+LVNKE NH    + Q+W  FDD+ V
Sbjct: 543  PMSLTVETLDNSSVTYRLYGTINHIGSPRGGHYTALVNKEKNHFTDLELQKWVEFDDDLV 602

Query: 1075 KEERNHGDMDKGILQVSSRDVYVLFYERI 1103
                +       I  +++ D YVLFYERI
Sbjct: 603  FNRTDFFKSKTEINSITNNDAYVLFYERI 631

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 72/157 (45%), Gaps = 31/157 (19%)

Query: 72  FIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLY----ENETHMTNVLLMVKDEIE--N 125
           +  GC+Y++L++P + QFQ ++  YG Y +LK  Y    E +     +L  V+++     
Sbjct: 67  YAAGCFYIYLLVPNANQFQLEDTEYGTYLQLKNNYLVKGEGDLTFQYLLDRVREKCRTSQ 126

Query: 126 VLDMDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQ 185
            L+M++N N  +           +S+ +++ +N    LS   +++ +  N  T++S ++ 
Sbjct: 127 TLEMNKNRNSGN-----------FSVKLSQKANSCCDLS---TVEDKSQNTSTDSSGSS- 171

Query: 186 PPNHHLLPIILHCDEEFSNEEINATDFDRASPLWTAP 222
                     L C +  S    +  D D  S  +T P
Sbjct: 172 ----------LECSDSKSALAKSPIDIDHDSKQYTLP 198

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score =  378 bits (970), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 172/250 (68%), Positives = 208/250 (83%), Gaps = 1/250 (0%)

Query: 658 RKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIND 717
           R FSIP +EKS N YVSLSITGLRNLGNTCYINSMLQCLFAT  FR++F+S K++ ++ D
Sbjct: 733 RHFSIPILEKSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEKYM-D 791

Query: 718 SKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMII 777
              P   ++S SFN+LFKKMY+NGGCSVVPT FLKTCNILRPDLRIPDDQQDTQEFLM+I
Sbjct: 792 HDIPTNQRLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEFLMLI 851

Query: 778 LDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQM 837
           LDRLHDELSNQ EV  +YP+L+ YD ++++VQ  +Y  W++++V  NGLSPIDH+F GQ 
Sbjct: 852 LDRLHDELSNQHEVKLDYPDLVDYDVDDMEVQPGQYIKWYNESVKSNGLSPIDHVFQGQT 911

Query: 838 ENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENA 897
           E+ L CQRCG SS+ YSTFY+LSLAIPK S+  F + KRV LE+CI MFT+DE+LS ENA
Sbjct: 912 EDGLVCQRCGCSSFTYSTFYILSLAIPKASTNAFGKIKRVNLEDCIKMFTNDEILSDENA 971

Query: 898 WDCPKCGSSA 907
           WDCP+CGS+A
Sbjct: 972 WDCPRCGSAA 981

 Score =  222 bits (565), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 142/200 (71%), Gaps = 6/200 (3%)

Query: 331 DRASNHRKDSYHSIYMVDDGSADGITQYYD-SNPYIHSLERLQKQCIITAQELFSILSNP 389
           DR+  HRKDSYHS+YM +D + D     YD ++ YI SLE +QKQ +IT  ELFS+LSN 
Sbjct: 447 DRSVTHRKDSYHSVYMFNDSNEDNNNHGYDETSEYIESLEHIQKQDVITCPELFSLLSNN 506

Query: 390 IEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKAR 449
           +E+ K+LLIDLRFP+RF  NHIVAPN++ ++P LLW+  TNTP+Y    LE ++  P   
Sbjct: 507 VEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTAEKLEQIINNP--- 563

Query: 450 KLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWK 509
            L   R  F+Y+V+Y+D KTYMN  FDY FT FYLLVT  T+K +KS PT LLGGY+KW 
Sbjct: 564 -LFSKRDTFKYVVYYSDMKTYMNMTFDYLFTLFYLLVTC-TSKPVKSLPTSLLGGYEKWY 621

Query: 510 KVLYSYSEQYNFNMGDYLYK 529
           KV+ SY  QY+  M DY+Y+
Sbjct: 622 KVINSYVNQYSITMNDYVYR 641

 Score =  204 bits (519), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 114/129 (88%)

Query: 975  SKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYG 1034
            S K++TIK++NF+  P ILVIHLSRFYYDLTKKNNTVITYPL LNI LKN EVA+Y+LYG
Sbjct: 1083 SGKMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNISLKNGEVARYKLYG 1142

Query: 1035 IVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRD 1094
            +VNH+G L+SGHYTSLVNK+ +H+LGS+KQ+W+YFDDE VKEE+NHGD++ G+  +SS  
Sbjct: 1143 LVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHGDIEGGVTSISSSH 1202

Query: 1095 VYVLFYERI 1103
            VYVLFY+RI
Sbjct: 1203 VYVLFYQRI 1211

 Score =  125 bits (314), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 133/275 (48%), Gaps = 51/275 (18%)

Query: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDV 68
           +TPEYS+ELLQ VQ IY+++ K +YPQ                               D 
Sbjct: 10  YTPEYSDELLQCVQEIYNNEFKTHYPQ-LKLEKLIDLLDHSSFLFETYTKSLRDSHFDDA 68

Query: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128
           L+AFIVG +Y++ IIPQS QF +KN+ Y +Y ELK LYE+E +MTNVL MVK EI  +LD
Sbjct: 69  LSAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILD 128

Query: 129 -----MDENNNGSDLNHRIIKRQRAYSIS--------------INELSNQVKSLSISNSI 169
                 +E++N   ++ + I+R+RA+S+                ++L N + +L+ S++ 
Sbjct: 129 SNYKSQNESSNNLFVDSKFIRRERAFSVPNASNPFSLMNDTSLDSQLDNSMDTLNTSSTT 188

Query: 170 DQEHINNKTETSLTNQP--PNHHL-----------------------------LPIILHC 198
              +       S +N    PN                                LP   + 
Sbjct: 189 VLSNKGTSAGPSFSNNSVTPNPTFRITLAKDANNMSANGNNSNSNSGINSSLQLPRYQYT 248

Query: 199 DEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLA 233
           +E  S+ E +  D D +SPLWTAP L+ K+QLKLA
Sbjct: 249 NEVHSDVEYSIEDTDESSPLWTAPQLDSKNQLKLA 283

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  300 bits (767), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 203/531 (38%), Positives = 283/531 (53%), Gaps = 71/531 (13%)

Query: 7   SPFTPEYSNELLQKVQSIYHDDIKHYYPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 66
           S FTPEYS EL ++VQ IY +DIK   PQ                               
Sbjct: 9   STFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYD- 67

Query: 67  DVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENV 126
           D L+A+IVGCYYL+LIIPQS QFQ+KNKSY +Y + K LY+NE +MTNV  MV++E++++
Sbjct: 68  DALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSI 127

Query: 127 LDMDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQP 186
           LD  ++    +   R+I R RA+S+      +  K  +      +E  ++ T+  L+   
Sbjct: 128 LD--KSYQEPEPTKRVIPRGRAFSVK----DDTPKDYNTIEFPIRERKSSTTQRPLSMAK 181

Query: 187 PNHHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLAYXXXXXXXXXXXX 246
           P +  LP+                + D ++PLWTAPSL P DQLKLA             
Sbjct: 182 P-YDSLPM----------------ELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQL- 223

Query: 247 XXGQKDSTANDFPFAPIQMPFDNGSAPDIPPKIPITKATTXXXXXXXXXXXXXXGTMPFT 306
                D T ++     I   ++N + P +P +IP+    T                    
Sbjct: 224 ----SDKTQHNL----IDDKYNNFTIP-LPHQIPLPVKVTDFNHD--------------- 259

Query: 307 TSSLEXXXXXXXXXXYKTIEQTNP-DRASNHRKDSYHSIYMVDDGSADGITQYYDSNPYI 365
                           K I++  P DR+  HRKDSYHS+YM +D SA  + +  ++N YI
Sbjct: 260 ----------------KKIQKIYPVDRSETHRKDSYHSVYMDNDNSAGYVRKNDEANNYI 303

Query: 366 HSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLW 425
            +LERLQKQ +IT  ELFSILS+P  K  +LLI L  P+R  SN+IVA N I IDP +LW
Sbjct: 304 QTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPNVLW 363

Query: 426 NSKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLL 485
           + + N PI + T LE +L +    +L   R  F Y+V+YTD KTYM  NFDY+FT FYLL
Sbjct: 364 DFENNCPISEDTKLEKILND----QLFNIRKSFAYVVYYTDLKTYMKINFDYNFTLFYLL 419

Query: 486 VTSKTNKNIKSAPTHLLGGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGD 536
            +S+T+  +K+ PT LLGG +KWKKV+ +Y  +   N  +YL+K H H+ D
Sbjct: 420 TSSRTSV-LKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHKFHVHNID 469

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
            Ashbya gossypii AFR007W
          Length = 851

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 117/447 (26%), Positives = 184/447 (41%), Gaps = 103/447 (23%)

Query: 678  TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
             GL N GN+CY++ ++QCL  T+    +F+++ +Q+ IN +S+  +   ++  F+ L  +
Sbjct: 486  VGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGVLARYFSQLIHQ 545

Query: 737  MYLNG----------GCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELS 786
            MY  G            +V+P  F   C  +    R    QQD QEF   +LD LH++L 
Sbjct: 546  MYQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFR-DRSQQDCQEFCQFLLDGLHEDL- 603

Query: 787  NQQEVVNEYPNLLLYDENNLKVQN------KEYKHWFDKNVIGNGLSPIDHIFSGQMENS 840
            NQ       P L    E   K++            W  +  +    S I  +F GQ  + 
Sbjct: 604  NQ---CGNNPPLKELSEKAEKMREMMPMRIASSIEW--ERYLTTDFSVIVDLFQGQYASQ 658

Query: 841  LQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDC 900
            L+C+ CG +S  Y  F VLS+ +P         S++  + +C   FT  E L  +  W C
Sbjct: 659  LRCKVCGRTSTTYQPFSVLSVPVPS--------SRQCTIIDCFTEFTKVETLDLDEQWSC 710

Query: 901  PKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTS 960
            P C                    KK+                           P  KK +
Sbjct: 711  PDC--------------------KKRQ--------------------------PSTKKIT 724

Query: 961  PAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFY---YDLTKKNNTVITYPLI 1017
               +P   +N     K+   +   N + +    V++L+ F+   YD    NN  +  P  
Sbjct: 725  ITRLP---RNLIIHLKRFDNMLNKNNVFVSYSAVLNLTSFWANDYDKKVMNNNNVELPSR 781

Query: 1018 LNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEE 1077
              +   N     Y+LYG+  H+G L  GHYT+ VNK     LG     W Y+DD   ++ 
Sbjct: 782  GQVPPFN-----YQLYGVACHTGTLYGGHYTAYVNK--GATLG-----WCYYDDTNWRQI 829

Query: 1078 RNHGDMDKGILQVSSRDVYVLFYERIY 1104
            R+  +         S++ YVLFY RI+
Sbjct: 830  RSSNE-------YISQNAYVLFYHRIH 849

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 71/156 (45%), Gaps = 13/156 (8%)

Query: 377 ITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYD- 435
           I++  L ++++ P   + +LLID+R    F + HI   +LI I+P+   +S ++  I   
Sbjct: 159 ISSLMLHNLITTPATATSVLLIDIRPRVDFVNFHIKFESLICIEPVSFKDSHSDIDIAKK 218

Query: 436 --ITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKN 493
             IT+ +N +       L Q R +FEYI+ YT      + N         LL+     K+
Sbjct: 219 SMITSPDNEI------ALFQERDKFEYIILYTQGSEKNDYNIHQQEVLVDLLINRSFQKS 272

Query: 494 IKSAPTHLL-GGYDKWKKVLYSYSEQYNFNMGDYLY 528
           + +     L GG+  W     +  E +    GD +Y
Sbjct: 273 LYNTKILTLDGGFSSWSTAYPNLCESFQ---GDSVY 305

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
            (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score =  116 bits (291), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 114/456 (25%), Positives = 175/456 (38%), Gaps = 119/456 (26%)

Query: 678  TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
             GL NLGN+CY+N ++QCL  TR    +F+   +++ +N +S+  +   ++  F+ L   
Sbjct: 56   VGLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHVNLNSRLGSKGVLAKYFSQLIHN 115

Query: 737  MYL-------------NGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHD 783
            M               N   +V P  F   C  +    +    QQD QEF   +LD LH+
Sbjct: 116  MQQQAISASGRKSTSGNERNAVQPLHFKVACGSINSLFKT-TSQQDCQEFCQFLLDGLHE 174

Query: 784  ------------ELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDH 831
                        ELS + E + E           L ++      W  +  +    S I  
Sbjct: 175  DLNQCGGNPALKELSEEAEAIRE----------KLCMRIASSIEW--ERYLTTDFSVIVD 222

Query: 832  IFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEV 891
            +F GQ  + L C+ CG +S  Y  F VLS+ +P        R  R  L +C   FT  E 
Sbjct: 223  LFQGQYASQLMCKVCGRTSTTYQPFSVLSVPVP--------RGARCNLLDCFEEFTKIET 274

Query: 892  LSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHR---YKSKFFTLHTRS 948
            L  +  W CP+C     ST     K + +T    +N+  H +      +K+  F  +  +
Sbjct: 275  LEKDEQWSCPRCKVKQPST-----KKITIT-RLPRNLIIHLKRFDNLLHKNNIFVSYPHT 328

Query: 949  HRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKN 1008
               ++PF       ++P      P + +             PP        F+Y+L    
Sbjct: 329  -LDLTPFWANDFDGSLPKGVAELPTRGQT------------PP--------FHYNL---- 363

Query: 1009 NTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYY 1068
                                    Y +  H G L  GHYT+ VNKE        K  W Y
Sbjct: 364  ------------------------YAVACHFGTLYGGHYTAYVNKE-------DKNGWCY 392

Query: 1069 FDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            FDD   ++ ++    D+ I    +   YVLFY R Y
Sbjct: 393  FDDTCWRKAKSE---DECI----TTSAYVLFYHRKY 421

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
            to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
            Ubiquitin hydrolase required for recycling ubiquitin from
            proteasome-bound ubiquitinated intermediates acts at the
            late endosome/prevacuolar compartment to recover
            ubiquitin from ubiquitinated membrane proteins en route
            to the vacuole
          Length = 893

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 114/452 (25%), Positives = 177/452 (39%), Gaps = 108/452 (23%)

Query: 678  TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
             GL NLGN+CY+N ++QCL  T     +F++  +++ IN +SK  +   ++  F+ L   
Sbjct: 523  VGLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHINFNSKLGSKGVLAKYFSQLVHN 582

Query: 737  MYLNGGC----------------SVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDR 780
            MY                     +V P +F   C  +    R    QQD QEF   +LD 
Sbjct: 583  MYRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTINSLFR-DCSQQDCQEFCQFLLDG 641

Query: 781  LHDELSNQQEVVNEYPNLLLYDENNLKVQNK------EYKHWFDKNVIGNGLSPIDHIFS 834
            LH++L+         P L    E   K++ K          W  +  +    S I  +F 
Sbjct: 642  LHEDLNQ----CGGNPRLKELSEEAEKIREKLSMRIASSIEW--ERYLTTDFSVIVDLFQ 695

Query: 835  GQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSG 894
            GQ  + L+CQ CG +S  Y  F VLS+ +P          K   + +C   FT  E L  
Sbjct: 696  GQYASQLKCQVCGRTSTTYQPFSVLSVPLPS--------LKSCNILDCFQEFTKVETLEK 747

Query: 895  ENAWDCPKCGSSASST--ISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSI 952
            +  W CP C     ST  I+ +    N+    K+  +  N+++ + S   TL       +
Sbjct: 748  DEQWSCPDCKKRQPSTKKITITRLPRNLIIHLKRFDNMMNKNNVFVSYPHTL------DL 801

Query: 953  SPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVI 1012
            +PF        +P      P + +            +PP        F Y L        
Sbjct: 802  TPFWANDFDGRLPPGVTELPTRGQ------------VPP--------FSYKL-------- 833

Query: 1013 TYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDE 1072
                                Y + +H+G L  GHYT+ V+K      GS++  W YFDD 
Sbjct: 834  --------------------YAVASHTGTLYGGHYTAYVHK------GSQRG-WCYFDDT 866

Query: 1073 TVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
              +  R+         +  + + YVLFY R+Y
Sbjct: 867  NWRRSRSDN-------ECITSNAYVLFYHRVY 891

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 73/157 (46%), Gaps = 8/157 (5%)

Query: 386 LSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYE 445
           L N +  S +LLIDLR    F  +HI +P++I I+P+   ++ ++  +      ++++  
Sbjct: 167 LQNLMAASSVLLIDLRPRMEFIKSHIKSPSVICIEPISFKDTYSDLDL----AKKSMITS 222

Query: 446 PKAR-KLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLL-G 503
           P    +L   R  F++IV YT                  LL++   +K +      +L G
Sbjct: 223 PNCEIELFSKRDTFQFIVLYTHEDGRTQYYKQQQLKLLDLLLSRSFDKPLDKVKVLILEG 282

Query: 504 GYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKH 540
           G+++W + +     + + N  D +Y     SG S++H
Sbjct: 283 GFEEWLREIGDC--ETSRNKDDGIYTDGDISGLSLQH 317

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score =  114 bits (284), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 123/262 (46%), Gaps = 36/262 (13%)

Query: 668 SPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKI 726
           +P+L +   + GL N+GN+CY+N ++QCL        +F+++ ++  IN +SK  +   +
Sbjct: 726 TPDLDLDFKV-GLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHININSKLGSKGIL 784

Query: 727 SNSFNLLFKKMYLNGGCS-----------VVPTSFLKTCNILRPDLRIPDDQQDTQEFLM 775
           + SF  L   MY NG  S           V P +F   C  +   L    +QQD QEF  
Sbjct: 785 AKSFARLVHSMYQNGTLSIKNHSNKKNPPVQPITFKTACGSIN-SLFKGSNQQDCQEFCQ 843

Query: 776 IILDRLHDELSNQ-------QEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSP 828
            +LD LH++L NQ       +E+  E   +       L ++      W  +  +    S 
Sbjct: 844 FLLDGLHEDL-NQCGANPPLKELSTEAERM----REKLSLRIASSIEW--ERFLTTDFSV 896

Query: 829 IDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTS 888
           I  ++ GQ  + L+CQ CG +S  Y TF VLS+ +PK        +K + L +C N FT 
Sbjct: 897 IIDLYQGQYASQLKCQVCGTTSTTYQTFSVLSVPVPK--------NKSIHLLDCFNEFTK 948

Query: 889 DEVLSGENAWDCPKCGSSASST 910
            E L  +  W C +C     ST
Sbjct: 949 TEFLGKDELWSCTECKKKQPST 970

 Score = 65.1 bits (157), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 70/156 (44%), Gaps = 40/156 (25%)

Query: 969  KNEPWKS----KKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI---- 1020
            K+E W      KK  + KTL    LP  L+IHL RF  ++  KNN  + YPLIL++    
Sbjct: 954  KDELWSCTECKKKQPSTKTLTITRLPKNLIIHLKRF-DNMLHKNNVFVKYPLILDLTNYW 1012

Query: 1021 ---------------VLKNNEVA--KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKK 1063
                           +    ++   KY L G+  H G+L  GHYT+ VNK         K
Sbjct: 1013 ANDFDGKLPPGVTEELPARGQIPPFKYELSGVALHMGSLYGGHYTAYVNK-------GLK 1065

Query: 1064 QRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLF 1099
              WYYFDD   +  +   +M        +++ YVLF
Sbjct: 1066 NGWYYFDDTVYRSIKYSSEM-------ITQNAYVLF 1094

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 69/151 (45%), Gaps = 23/151 (15%)

Query: 377 ITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDI 436
           IT+  L +IL    +    LLID+R    F  NHI + ++I I+P+   N+ ++  I   
Sbjct: 180 ITSSVLATILQ--TDPDSTLLIDVRTRHDFELNHIKSNSIICIEPISFKNNYSDVDI--- 234

Query: 437 TTLENLLYEPKAR-KLLQNRTQFEYIVFYTDNK---------TYMNTNFDYSF----TFF 482
              ++L+  P +  ++ +NR  +++I+ YTD+          +  N   D+        F
Sbjct: 235 -ERKSLITSPNSEIEIFKNRENYKFIILYTDDSRPTNQFNNNSNSNVTNDFYIHKLNVLF 293

Query: 483 YLLVTSKTNKNIKSAPTH---LLGGYDKWKK 510
            +L+     KN+ S   H   L GG   W K
Sbjct: 294 NILLNHSVAKNLNSNLNHVYYLEGGIQNWIK 324

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score =  112 bits (281), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 114/250 (45%), Gaps = 30/250 (12%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFK 735
           + GL N+GN+CY+N ++QCL        +F+ + F+ ++N +SK  +   ++  F+ L  
Sbjct: 619 MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYVNLNSKLGSKGVLARYFSRLIH 678

Query: 736 KMYLN------GG--CSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN 787
            MY N      GG    V P  F   C  +    +    QQD QEF   +LD LH++L N
Sbjct: 679 TMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK-GGSQQDCQEFCQFLLDGLHEDL-N 736

Query: 788 Q-------QEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENS 840
           Q        E+  E  NL       L ++      W  +  +    S I  +F GQ  + 
Sbjct: 737 QCGGNKRLAELTEEAENL----REKLSLRIASSIEW--ERFLTTDFSVIGDLFQGQYASR 790

Query: 841 LQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDC 900
           LQC+ CG +S  Y  F VLS+ +P           +  + +C + FT  E L  +  W C
Sbjct: 791 LQCKTCGKTSTTYQPFSVLSIPVPS------KHISKCSIIDCFDEFTKVENLEVDEQWSC 844

Query: 901 PKCGSSASST 910
           P+C S   ST
Sbjct: 845 PRCKSKQPST 854

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 70/153 (45%), Gaps = 35/153 (22%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV---------- 1021
            P    K  + K L    LP  L+IHL RF   L K NN ++ YP  L++           
Sbjct: 845  PRCKSKQPSTKKLTITRLPRNLIIHLKRFDNRLNK-NNILVQYPFTLDLTTFWANDFDGK 903

Query: 1022 --LKNNEVA--------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDD 1071
              L  +E+          Y+LYG+  H G+L  GHYT+ V+K         K  WYYFDD
Sbjct: 904  LPLNVSELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDK-------GIKNGWYYFDD 956

Query: 1072 ETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
             + +  +N        ++  +   YVLFY+RIY
Sbjct: 957  TSCRPIKNS-------MEPITSSAYVLFYKRIY 982

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 7/123 (5%)

Query: 391 EKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKARK 450
           + S++L ID+R    F+  H   PN+I I+P+   +S ++   +D+     +        
Sbjct: 190 DSSQVLFIDVRTRLDFNKGHFKVPNIICIEPVSFKSSYSD---HDLEKKSMITSTNDEIV 246

Query: 451 LLQNRTQFEYIVFYTDNKTYMNTNFDY---SFTFFYLLVTSKTNKNIKSAPTHLLGGYDK 507
           L   R +F +IV Y+ N T   +   Y         LL+     K + +    L  G+D 
Sbjct: 247 LFHRRQEFAFIVLYS-NDTDKKSGIVYKERKTLLANLLLNHSFEKPLSNRLYVLENGFDS 305

Query: 508 WKK 510
           W K
Sbjct: 306 WTK 308

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 119/262 (45%), Gaps = 29/262 (11%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFK 735
           I GL N+GN CY+N +LQCL  T     +F+ + + +FIN DS   +   ++ +F +L  
Sbjct: 445 IVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSRGSKGLLAKNFAILVN 504

Query: 736 KMYLNGGCS--------VVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN 787
            M+ +G  +        V    F K C  + P +     QQD QEF   +LD LH++L N
Sbjct: 505 NMHRHGAFTPPNVRTIPVQTIQFKKICGHINP-MYSDSMQQDCQEFCQFLLDGLHEDL-N 562

Query: 788 QQEVVNEYPNLLLYDEN---NLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQ 844
           Q         L   +E     + ++      W  +  +    S I  +F GQ  + LQCQ
Sbjct: 563 QNGSKKHLKQLSDEEERMREKMSIRKASALEW--ERFLLTDFSAIIDLFQGQYASRLQCQ 620

Query: 845 RCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCG 904
            C ++S  Y TF VLS+ +P        R K   + +C   FT  E L  +  W CPKC 
Sbjct: 621 VCEHTSTTYQTFSVLSVPVP--------RVKTCNILDCFREFTKCERLGVDEQWSCPKCL 672

Query: 905 SSASSTISDSEKLLNVTSSKKK 926
               ST     K L +T   KK
Sbjct: 673 KKQPST-----KQLKITRLPKK 689

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 71/158 (44%), Gaps = 38/158 (24%)

Query: 970  NEPWKSKKLI----TIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI----- 1020
            +E W   K +    + K L    LP  L+I+L RF   + K NN  + YP  L++     
Sbjct: 663  DEQWSCPKCLKKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYSLDLTPYWA 721

Query: 1021 ------VLKNNEVA--------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRW 1066
                   + N ++         +YRLYG+  HSG+L  GHYTS V K P       K+ W
Sbjct: 722  RDFNHEAIVNEDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-------KKGW 774

Query: 1067 YYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            Y+FDD   +      +         +   YVLFYERI+
Sbjct: 775  YFFDDSLYRPITFSTEF-------ITPSAYVLFYERIF 805

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 59/125 (47%), Gaps = 10/125 (8%)

Query: 395 LLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKAR-KLLQ 453
           LLLID+R    F   HI   N+I IDP    +S T+  I  ++    L+  P +      
Sbjct: 163 LLLIDVRPRSEFVRAHIKCKNIICIDPASFKDSFTDQQIESVS----LITSPHSDITFFS 218

Query: 454 NRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLL---GGYDKWKK 510
           NR +F++I+ YTD  T ++ NF    T     + S+ +     + T +L    G+  W K
Sbjct: 219 NRDKFKFIILYTD--TQLHNNFQQRQTRILAKILSQNSVIKPLSGTKILILENGFSNWVK 276

Query: 511 VLYSY 515
           +  +Y
Sbjct: 277 LGGAY 281

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  110 bits (274), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 117/267 (43%), Gaps = 32/267 (11%)

Query: 662 IPTIEKSPNL-----YVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
            P+ E SP L     Y      GL N+GN+CYIN ++QCL  T    ++F++  ++  IN
Sbjct: 442 FPSRESSPALGSANKYDLDFAVGLENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHIN 501

Query: 717 -DSKFPNTPKISNSFNLLFKKMYLNG-------GCSVVPTSFLKTCNILRPDLRIPDDQQ 768
            +S+  +   ++  F  L   MY N        G  V P  F   C  +    R    QQ
Sbjct: 502 MNSRLGSKGVLAKYFAKLTHSMYQNASHKLNEKGKPVQPMEFKMACGTINSLFR-ESGQQ 560

Query: 769 DTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDE-----NNLKVQNKEYKHWFDKNVIG 823
           D QEF   +LD LH++L+   +     P   L DE       L ++      W  +  + 
Sbjct: 561 DCQEFCQFLLDGLHEDLN---QCGGNPPLKELSDEAEKMREKLSLRIASSIEW--ERFLT 615

Query: 824 NGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECI 883
              S I  +F GQ  + L+CQ CG +S  Y  F VLS+ +P         +K   + +C 
Sbjct: 616 TDFSVIVDLFQGQYASQLRCQVCGLTSTTYQPFSVLSVPVP--------HAKSCNIIDCF 667

Query: 884 NMFTSDEVLSGENAWDCPKCGSSASST 910
             FT  E L  +  W CP+C     ST
Sbjct: 668 KEFTKVEKLETDEQWSCPRCKKKQPST 694

 Score = 75.5 bits (184), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 83/186 (44%), Gaps = 43/186 (23%)

Query: 945  HTRSHRSISPFRKKTSPAAVPSSTKNEPWKS----KKLITIKTLNFIVLPPILVIHLSRF 1000
            H +S   I  F++ T    V     +E W      KK  + K L    LP  L+IHL RF
Sbjct: 657  HAKSCNIIDCFKEFTK---VEKLETDEQWSCPRCKKKQPSTKKLTITRLPRNLIIHLKRF 713

Query: 1001 YYDLTKKNNTVITYPLILNIV--LKNNEVAK-------------------YRLYGIVNHS 1039
              ++  KNN  + YP  L++     N+   +                   Y+LYGI +H 
Sbjct: 714  D-NMMNKNNVFVKYPFTLDLTPYWANDFDGRLPPGVTEELPTRGQSPPFNYKLYGIASHV 772

Query: 1040 GNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLF 1099
            G+L  GHYTS V+K P       K+ W YFDD + +  RN         +  + + YVLF
Sbjct: 773  GSLYGGHYTSYVDKGP-------KRGWCYFDDTSFRPVRN-------ATECITPNAYVLF 818

Query: 1100 YERIYE 1105
            Y R+Y+
Sbjct: 819  YHRVYQ 824

 Score = 39.7 bits (91), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 396 LLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKAR-KLLQN 454
           LLIDLR    FS  HI A N+I I+P+      T+  I      ++L+  PK    L + 
Sbjct: 179 LLIDLRQRGEFSKLHINAKNVICIEPISFKAQYTDLEIEK----KSLITSPKEEIGLFRA 234

Query: 455 RTQFEYIVFYT-DNKTYMNTNFD 476
           R  F++IV YT ++K   + +FD
Sbjct: 235 RDTFKFIVLYTSEDKESHSRSFD 257

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score =  110 bits (275), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 114/250 (45%), Gaps = 36/250 (14%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKKM 737
           GL N+GN+CY+N ++QCL ++  F  +F+++ ++  IN  SK  +   ++ +F  L   M
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARNFARLINTM 668

Query: 738 YLNGG--------CSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQ 789
           Y  G           V P  F   C  +    R  D QQD+QEF   +LD LH++L NQ 
Sbjct: 669 YTEGSEQSKNDRNGPVKPAQFKLACGSINSIFR-SDLQQDSQEFCQFLLDGLHEDL-NQ- 725

Query: 790 EVVNEYPNLLLYDENNLKVQNK---------EYKHWFDKNVIGNGLSPIDHIFSGQMENS 840
                 P L     N  K++ K         E++ +   +      S I   F GQ  + 
Sbjct: 726 --CGANPPLKELSPNAEKMREKLSLRIASSIEWERYLTTD-----FSVIVDQFQGQYASQ 778

Query: 841 LQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDC 900
           L+C+ CG +S  Y  F VLS+ +P        R K   + +C N FT  E L  +  W C
Sbjct: 779 LRCKVCGGTSTTYQAFSVLSVPVP--------RGKSCNIIDCFNEFTKVENLETDELWAC 830

Query: 901 PKCGSSASST 910
           P C     ST
Sbjct: 831 PHCKKKQPST 840

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 67/154 (43%), Gaps = 37/154 (24%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV--LKNNEVAK 1029
            P   KK  + K L    LP  L+IHL RF  ++  KNN  + YP +L++     N+   +
Sbjct: 831  PHCKKKQPSTKKLTITRLPRNLIIHLKRF-DNMLNKNNIFVKYPFLLDLTPYWANDFDGR 889

Query: 1030 -------------------YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFD 1070
                               Y+L  +  H G+L  GHYTS V+K         K  W YFD
Sbjct: 890  LPPGVTEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDK--------GKFGWRYFD 941

Query: 1071 DETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            D  ++  +N         +  + + YVLFY R+Y
Sbjct: 942  DTKIRPLKNS-------YECITSNAYVLFYHRVY 968

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score =  108 bits (269), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 118/257 (45%), Gaps = 31/257 (12%)

Query: 669 PNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKIS 727
           P L +  ++ GL N+GN+CY+N ++QCL +T     +F+++ ++  IN +SK  +   ++
Sbjct: 511 PKLDLDFTV-GLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHINLNSKLGSKGVLA 569

Query: 728 NSFNLLFKKMYLNGGCS--------VVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILD 779
             F  L   MY  G           + P  F   C  +   L   + QQD+QEF   +LD
Sbjct: 570 KYFARLVHTMYREGSFKRPLEKNKPIQPIQFKMACGSIN-SLFKDNTQQDSQEFCQFLLD 628

Query: 780 RLHDELSNQQEVVNEYPNLLLYDENNLKVQNK------EYKHWFDKNVIGNGLSPIDHIF 833
            LH++L+         P L    E+  K++ K          W  +  +    S I  +F
Sbjct: 629 GLHEDLNQ----CGANPPLKELSEDAEKMREKLSMRIASSIEW--ERFLTTDFSVIVDLF 682

Query: 834 SGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLS 893
            GQ  + L+C+ CG +S  Y TF VLS+ +P  SS          + +C N FT  E L 
Sbjct: 683 QGQYASQLKCKVCGCTSTTYQTFSVLSVPVPHVSS--------CHILDCFNEFTKVEKLG 734

Query: 894 GENAWDCPKCGSSASST 910
            +  W CP C     ST
Sbjct: 735 TDELWSCPTCKKKQPST 751

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 70/154 (45%), Gaps = 36/154 (23%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI----------- 1020
            P   KK  + K L    LP  L+IHL RF  ++  KNN  + YP +L++           
Sbjct: 742  PTCKKKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFLLDLTPYWANDFDGR 800

Query: 1021 --------VLKNNEVA--KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFD 1070
                    +    +V   +Y+L  + +H G+L  GHYT+ VNK  N         W+YFD
Sbjct: 801  LPPGVTDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNKGINRG-------WHYFD 853

Query: 1071 DETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            D + +  +N  +         + + YVLFY R+Y
Sbjct: 854  DTSYRPIKNETE-------CITPNAYVLFYHRVY 880

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 393 SKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEP-KARKL 451
           S LLLID+R    F S HI A ++I ++P+   NS T+  +      ++L+  P K   L
Sbjct: 184 SSLLLIDVRPRAEFDSKHIKAKSVICVEPVSFKNSFTDLEVEK----KSLITSPQKEIAL 239

Query: 452 LQNRTQFEYIVFYT 465
            Q R ++ YIV YT
Sbjct: 240 FQARDKYNYIVIYT 253

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score =  108 bits (269), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 118/247 (47%), Gaps = 22/247 (8%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
           TGL N+ N+CY+N ++QCL +T     L++++ F + IN ++K  +   +S +F  L + 
Sbjct: 458 TGLENVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLTQINVENKLGSKGFLSKNFANLIQT 517

Query: 737 MYLNGGCS---------VVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN 787
           MY               V P  F   C ++   +     +QD QEF   +LD LH++L+ 
Sbjct: 518 MYKKSAFQPYNPNFLHPVAPLEFKNACGMMN-SIYAESTEQDCQEFCEFLLDGLHEDLN- 575

Query: 788 QQEVVNEYPNLLLYDENNLK----VQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQC 843
            Q   N  P  L  +E  L+    ++      W  ++ +    SPI ++F GQ  + LQC
Sbjct: 576 -QCSGNPRPKELSANEAELRESLSMRIASEIEW--ESFLTTNFSPIINLFQGQYASRLQC 632

Query: 844 QRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
             C ++S  Y  F +LS+ +P   S  FS  +   + +C   FT  E L  +  W CPKC
Sbjct: 633 LICQHTSTTYQPFSLLSIPVP---SMVFSNGQTCNILDCFKEFTKCERLDNDEKWFCPKC 689

Query: 904 GSSASST 910
                ST
Sbjct: 690 RRKQIST 696

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 69/155 (44%), Gaps = 36/155 (23%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV-LKNNEVA-- 1028
            P   +K I+ K L    LP  L+IH  RF  +   KNN  + YP  L++  L  N+    
Sbjct: 687  PKCRRKQISTKQLKITRLPKNLIIHFKRFD-NFMNKNNIFVQYPYQLDLTSLWVNDYDGK 745

Query: 1029 ------------------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFD 1070
                              KY+L  +  HSGNL SGHYT+ V+K          + W+ FD
Sbjct: 746  LPPNFNEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDK-------GLYRGWFRFD 798

Query: 1071 DETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105
            D + +         K   +  + D Y+LFY+RIYE
Sbjct: 799  DASYRPV-------KFGTEFLTPDAYLLFYQRIYE 826

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 90/198 (45%), Gaps = 27/198 (13%)

Query: 365 IHSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLL 424
           IH +  L    I+  ++L  +LS+   K  LLLID+R  K F + HI AP ++ I P+  
Sbjct: 158 IHQVTNLSDSFIL-PEKLHDLLSS--HKRNLLLIDVRTRKEFDTLHIDAPIILPIGPLSF 214

Query: 425 WNSKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYL 484
            ++ T+  I   + L +   E   R   + R QF YIV YT +       +    + F +
Sbjct: 215 KSTFTDLQIEQTSLLTSTFQE---RNYFKKRNQFRYIVLYTKDDNDTTYYYTQVISLFNI 271

Query: 485 LVTSKTNKNI-KSAPTHLL--GGYDKWKKVLYSY----------SEQYNFNMGDYLYKPH 531
           L  + + +NI +  P+  +  GG   W  V +SY          + QYN N    L+K  
Sbjct: 272 LTIAASKRNIDQICPSIFILKGGITSW--VQHSYECKTNLTGKTANQYNQN----LFK-- 323

Query: 532 RHSGDSIKHHDDLVDSHI 549
           R    SI  H  L D+ +
Sbjct: 324 RSKDSSIYKHVALSDNSL 341

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score =  106 bits (264), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 126/270 (46%), Gaps = 35/270 (12%)

Query: 661 SIPTIEKSPNLYVSLS----ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
           SI T+ +  NL V++S      GL N GN+CY++ ++QCL  T+    +F+++ +Q+ IN
Sbjct: 468 SIKTLGQQ-NLTVAVSNLNFSVGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHIN 526

Query: 717 -DSKFPNTPKISNSFNLLFKKMYLNG----------GCSVVPTSFLKTCNILRPDLRIPD 765
            +S+  +   ++  F+ L  +MY  G            +V+PT F   C  +    +  +
Sbjct: 527 LNSRLGSKGLLARYFSQLIHQMYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-DN 585

Query: 766 DQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENN-----LKVQNKEYKHWFDKN 820
            QQD QEF   +LD LH++L+   +  N  P   L +E       + ++      W  + 
Sbjct: 586 TQQDCQEFCQFLLDGLHEDLN---QCGNNPPLKELSEEAEKMREMMPMRLASAIEW--ER 640

Query: 821 VIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLE 880
            +    S I  +F GQ  + LQC+ C  +S  Y  F VLS+ +P   + T        L 
Sbjct: 641 YLTTDFSVIVDLFQGQYASQLQCKVCQRTSTTYQPFSVLSVPVPSTRTCT--------LT 692

Query: 881 ECINMFTSDEVLSGENAWDCPKCGSSASST 910
           +C   FT  E L  E  W CP C     ST
Sbjct: 693 DCFTEFTKIETLEQEEQWSCPSCKKRQPST 722

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 75/158 (47%), Gaps = 42/158 (26%)

Query: 963  AVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV- 1021
            + PS  K +P  S K ITI  L     P  L+IHL RF  ++  KNN  ++YP +L++  
Sbjct: 711  SCPSCKKRQP--STKKITITRL-----PRNLIIHLKRFD-NMLNKNNVFVSYPSVLDLTA 762

Query: 1022 ---------LKNNEVA----------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSK 1062
                     + NN V            Y+LYGI  H G L +GHYT+ VNK     LG  
Sbjct: 763  FWANDYDKKVTNNNVELPSRGQVPPFNYQLYGIACHDGTLRAGHYTAYVNK--GAVLG-- 818

Query: 1063 KQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFY 1100
               W Y+DD   ++ R+  +    I+Q    + YVL Y
Sbjct: 819  ---WCYYDDTNWRQIRSAREY---IIQ----NGYVLLY 846

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 72/165 (43%), Gaps = 9/165 (5%)

Query: 377 ITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDI 436
           I A  L ++L  P     +LL+D+R    F   HI + ++I I+P+    S T+  +   
Sbjct: 158 IPATLLRNLLMGPSASGTVLLVDVRPRLDFMRCHIKSSSIICIEPVSFKESYTDIDLGK- 216

Query: 437 TTLENLLYEPKAR-KLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIK 495
              ++++  P A   L Q+R +F+YIV YT +      N         LL+     K + 
Sbjct: 217 ---KSMITSPDAEIALFQDRDKFDYIVVYTQDSEKNKHNVQQQQLLVDLLINRSFEKALD 273

Query: 496 SAPTHLL-GGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGDSIK 539
                +L GG+ +W      +      + GD +Y     SG S++
Sbjct: 274 RTKVFILAGGFSEWSNAHPDFCVS---SQGDSVYLNGDTSGLSLQ 315

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score =  106 bits (264), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 118/250 (47%), Gaps = 23/250 (9%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFK 735
           I GL N+GN+CY+N ++QC+  T     +F+++ ++  IN  S+  +   ++ +F  L  
Sbjct: 604 IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHINLSSRLGSKGVLAKNFARLIH 663

Query: 736 KMYLNGGCSVV------------PTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHD 783
            MY++   S +            P  F   C  +    R    QQD+QEF   +LD LH+
Sbjct: 664 TMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFR-DSQQQDSQEFCQFLLDGLHE 722

Query: 784 ELSNQQEVVNEYPNLLLYDE---NNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENS 840
           +L NQ         L L  E    NL ++      W  +  +    S I  +F GQ  + 
Sbjct: 723 DL-NQCGGNPPLKELSLEAERLRENLSLRIASSIEW--ERYLTTDFSVIVDLFQGQYASR 779

Query: 841 LQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDC 900
           L+C+ C ++S  Y +F VLS+ +PK       +++++ L +C N FT  E L  +  W C
Sbjct: 780 LECKVCHHTSTTYQSFSVLSVPLPKKFD---PQTRKIDLIDCFNEFTKIENLEVDEQWSC 836

Query: 901 PKCGSSASST 910
           P C     ST
Sbjct: 837 PTCKKKQPST 846

 Score = 71.6 bits (174), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 75/154 (48%), Gaps = 36/154 (23%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV---------- 1021
            P   KK  + K L    LP  L+IHL RF  ++  KNN+ I YP  L++           
Sbjct: 837  PTCKKKQPSTKKLTITRLPRNLIIHLKRFD-NMLNKNNSFIDYPFNLDLTEFWADDFDGN 895

Query: 1022 ----LKNNEVAK-------YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFD 1070
                + N   A+       YRLYG+  H G+L  GHYT+ V+K     +G+    WYYFD
Sbjct: 896  LPPGVSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDK----GIGNG---WYYFD 948

Query: 1071 DETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            D T +  +N    DK  +  S+   YVLFY R+Y
Sbjct: 949  DTTYRPLKN----DKEPISSSA---YVLFYTRVY 975

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 6/84 (7%)

Query: 395 LLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKARKLLQN 454
           LL+ID+R    F  +HI + N+I I+P+   +S ++   Y++     +       +L  N
Sbjct: 202 LLIIDIRSRSEFIKSHIKSKNIICIEPISFKDSYSD---YELERKSIITSPNNEIRLFNN 258

Query: 455 RTQFEYIVFYT---DNKTYMNTNF 475
           R  F++IV YT   D K   N++F
Sbjct: 259 RQSFKFIVLYTEILDTKNKNNSHF 282

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score =  103 bits (258), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 122/278 (43%), Gaps = 29/278 (10%)

Query: 661 SIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSK 719
           S P I+ S  ++    I GL N+GN CY+N +LQCL  T     +F+ + + +FIN D+ 
Sbjct: 412 SKPPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFDNM 471

Query: 720 FPNTPKISNSFNLLFKKMYLNGG--------CSVVPTSFLKTCNILRPDLRIPDDQQDTQ 771
             +   ++ +F  L   M+ +G           V    F KTC  +   +     QQD Q
Sbjct: 472 RGSKGLLAKNFANLVHTMHRHGAFKPLNSRITPVQTIQFKKTCGHIN-SIYSDSMQQDCQ 530

Query: 772 EFLMIILDRLHDELSNQQEVVNEYPNLLLYDEN---NLKVQNKEYKHWFDKNVIGNGLSP 828
           EF   +LD LH++L NQ         L   +E    N+ ++      W  +  +    S 
Sbjct: 531 EFCQFLLDGLHEDL-NQNGGKKHLKQLSEEEERTRENMSIRKASALEW--ERFLLTDFSA 587

Query: 829 IDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTS 888
           +  +F GQ  + LQCQ C ++S  Y TF VLS+ +P        R     + +C   FT 
Sbjct: 588 VIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVP--------RIMTCNVLDCFREFTK 639

Query: 889 DEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKK 926
            E L     W C +C     ST     K L +T   KK
Sbjct: 640 CEKLGIGEQWSCSRCLKKQPST-----KQLKITRLPKK 672

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 72/158 (45%), Gaps = 38/158 (24%)

Query: 970  NEPWKS----KKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLK-- 1023
             E W      KK  + K L    LP  L+I+L RF   +  KNN  + YP  L++     
Sbjct: 646  GEQWSCSRCLKKQPSTKQLKITRLPKKLIINLKRFDNQM-HKNNVFVQYPCFLDLTPYWA 704

Query: 1024 ---NNEVA--------------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRW 1066
               N+E                +YRLYG+  HSG+L  GHYTS V K P       ++ W
Sbjct: 705  RDFNHEAIIDEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-------QKGW 757

Query: 1067 YYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            Y+FDD   +  R + +         + + YVLFYERI+
Sbjct: 758  YFFDDTIYRLIRFNNEF-------ITPNAYVLFYERIF 788

 Score = 35.4 bits (80), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 56/123 (45%), Gaps = 10/123 (8%)

Query: 395 LLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKAR-KLLQ 453
            LL+D+R    F   HI   +++ IDP    +S T+T +  ++    L   P+   +L  
Sbjct: 165 FLLVDVRPRPEFIKAHIKCKHIMCIDPASFKDSYTDTLVERVS----LAASPQLEIELFS 220

Query: 454 NRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWKKVLY 513
            R  F+ IV YTD  T +  +F    T   +L    T  ++    + L  G+  W K+  
Sbjct: 221 KRNTFKNIVLYTD--TQLQGDFQQRQT--RILANILTRHSVAKV-SILENGFSNWVKLGG 275

Query: 514 SYS 516
           ++S
Sbjct: 276 AFS 278

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score =  103 bits (258), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 117/263 (44%), Gaps = 31/263 (11%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFK 735
           I GL N GN CY+N +LQCL  T     +F+ + + +FIN DS   +   ++ +F  L +
Sbjct: 445 IVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSKGSKGLLAKNFATLVR 504

Query: 736 KMYLNGG--------CSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN 787
            M+ N            V    F K C  +   +     QQD QEF   +LD LH++L+ 
Sbjct: 505 NMHRNSAFMPVNSRTTPVQTIQFKKICGHIN-SIYSDSMQQDCQEFCQFLLDGLHEDLN- 562

Query: 788 QQEVVNEYPNLLLYDENN----LKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQC 843
            Q    E+   L  +E      + ++      W  +  +    S I  +F GQ  + LQC
Sbjct: 563 -QNGGKEHLKQLTEEEEQKREKMTIRKASALEW--ERFLLTDFSAIIDLFQGQYASRLQC 619

Query: 844 QRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
           Q C  +S  Y TF VLS+ +P+ ++          + +C   FT  E L  +  W CP+C
Sbjct: 620 QACDRTSTTYQTFSVLSVPVPRITT--------CNILDCFREFTKCEKLGIDELWSCPRC 671

Query: 904 GSSASSTISDSEKLLNVTSSKKK 926
                ST     K L +T   KK
Sbjct: 672 LKKQPST-----KQLKITRLPKK 689

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 72/152 (47%), Gaps = 34/152 (22%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI----------- 1020
            P   KK  + K L    LP  L+I+L RF   + K NN  + YP  L++           
Sbjct: 669  PRCLKKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYFLDLTPYWARDFNHE 727

Query: 1021 VLKNNEVA--------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDE 1072
             + N ++         +YRLYG+  HSG+L  GHYTS V K P       K+ WY+FDD 
Sbjct: 728  AIVNEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-------KKGWYFFDDS 780

Query: 1073 TVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
              +  R + +         + + YVLFYERI+
Sbjct: 781  IYRPIRFNDEF-------ITPNAYVLFYERIF 805

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (49%), Gaps = 5/103 (4%)

Query: 364 YIHSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPML 423
           YI +  +L     I A +L S+L        LLLID+R    F+  HI   N+I I+P+ 
Sbjct: 134 YIENYPKLLHLHTIDAGKLSSMLH--FHGDTLLLIDVRPRSDFTKAHIKCKNIICIEPVS 191

Query: 424 LWNSKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTD 466
             +S T+  + +++ + +         L  NR  F+YIV YTD
Sbjct: 192 FKDSFTDRQLENVSLITS---SQSDIDLFSNRNMFKYIVLYTD 231

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score =  103 bits (257), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 107/241 (44%), Gaps = 16/241 (6%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
            GL NLGN+CY+N ++QC+  T     +F+   +   IN +SK  +   ++  F  L   
Sbjct: 565 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 624

Query: 737 MYL-----NGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELS--NQQ 789
           MY      +   S+ P  F   C  +    +    QQD QEF   +LD LH++L+     
Sbjct: 625 MYKEQVDSSKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 683

Query: 790 EVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNS 849
             + E           L ++      W  +  +    S I  +F GQ  + L+C+ C ++
Sbjct: 684 PPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLRCKVCNHT 741

Query: 850 SYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASS 909
           S  Y  F VLS+ IPK +S       ++ +E+C   FT  E L  E  W CP C     S
Sbjct: 742 STTYQPFTVLSIPIPKKNS-----QNKITIEDCFKEFTKCENLEVEEQWLCPHCKQRQPS 796

Query: 910 T 910
           T
Sbjct: 797 T 797

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 65/147 (44%), Gaps = 37/147 (25%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV--------------LKNN 1025
            + K L    LP  L++HL RF  +   KNN  + YP +L++               + ++
Sbjct: 796  STKQLTVTRLPRNLIVHLKRFD-NFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPGVNDD 854

Query: 1026 EVA--------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEE 1077
            E+         KY LYG+  H G L  GHYT+ V K         K+ W YFDD   K  
Sbjct: 855  ELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKK-------GLKKGWLYFDDTKYKPV 907

Query: 1078 RNHGDMDKGILQVSSRDVYVLFYERIY 1104
            +N  D         + + YVLFY R+Y
Sbjct: 908  KNQTD-------AINSNAYVLFYHRVY 927

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 52/90 (57%), Gaps = 5/90 (5%)

Query: 382 LFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLEN 441
           +FS  ++   + + LLID+R    F+ +HI + N+I ++P+    S ++   +D+   ++
Sbjct: 196 IFSSTNSTSSQMETLLIDIRSRLEFNKSHIDSKNIICLEPISFKMSYSD---HDLER-KS 251

Query: 442 LLYEPKAR-KLLQNRTQFEYIVFYTDNKTY 470
           L+  P    KL Q+R  F++IV YTD+  Y
Sbjct: 252 LITSPNDEIKLFQSRNLFKFIVLYTDSNEY 281

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score =  102 bits (255), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 121/261 (46%), Gaps = 36/261 (13%)

Query: 669 PNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKIS 727
           P++ +  +I GL NLGN+CY+N ++QCL        +F+++ ++  +N +S+  +   ++
Sbjct: 424 PSINLDFAI-GLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNVNSRLGSKGLLA 482

Query: 728 NSFNLLFKKMYLNG-----------GCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMI 776
           N F+ L +KMY  G             +V PT F   C  +   L     QQD QEF   
Sbjct: 483 NYFSQLVQKMYQQGKLQAYNNTNMESTAVHPTQFKLACGSIN-SLFKGKQQQDCQEFCQF 541

Query: 777 ILDRLHDELSNQ-------QEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPI 829
           +LD LH++L NQ       +E+  E   +       + ++      W  +  +    S I
Sbjct: 542 LLDGLHEDL-NQCGTNPPLKELSPEAEKM----RETMPMRIASAIEW--ERYLTTDFSVI 594

Query: 830 DHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSD 889
             +F GQ  + L+C+ C ++S  Y  F VLS+ +P+  S T        + +C   FT  
Sbjct: 595 VDLFQGQYASQLRCKICAHTSTTYQAFSVLSVPVPRARSCT--------IYDCFKEFTKL 646

Query: 890 EVLSGENAWDCPKCGSSASST 910
           E L  +  W CP C     ST
Sbjct: 647 ETLEKDELWYCPYCKQRQPST 667

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 72/153 (47%), Gaps = 37/153 (24%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI----------- 1020
            P+  ++  + K +    LP  L+IHL RF  ++  KNN  + YP  L++           
Sbjct: 658  PYCKQRQPSTKQIIITRLPNNLIIHLKRFD-NMMNKNNVFVNYPNELDLTGFWIDDYNGE 716

Query: 1021 VLKNNEVA----------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFD 1070
            + K+N V+           YRL+ + +HSG L  GHYTS V+K         +  W  FD
Sbjct: 717  MPKDNGVSLPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFD 768

Query: 1071 DETVKEERNHGDMDKGILQVSSRDVYVLFYERI 1103
            D + ++ R     D+ I    + + YVLFY R+
Sbjct: 769  DVSWRKIRRK---DEYI----TPNAYVLFYRRV 794

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 15/119 (12%)

Query: 348 DDGSADGITQYYDSNPYIHSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFS 407
           ++ + DG    Y++  ++            +  +L S++ +  + S +LL+D+R    F+
Sbjct: 139 EEAAHDGTQHSYENGEFV------------SISQLHSLIRHDNDSSGILLVDIRPRMDFN 186

Query: 408 SNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTD 466
             HI   N+I I+P+    S T++   DI     +    +   L +NR +F  IV YTD
Sbjct: 187 DGHIKHNNVICIEPISFKESYTDS---DILRKSLITASDREVDLFKNRDKFRLIVLYTD 242

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score =  102 bits (253), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 83/277 (29%), Positives = 127/277 (45%), Gaps = 30/277 (10%)

Query: 649 RESLMLTRSRKFS---IPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDL 705
           +E L     RKF+   +P  +K  +L  ++   GL N+GN+CY+N +LQC+  T     +
Sbjct: 554 KEVLSSPTGRKFNHSVLPNTKKDYDLNFTV---GLENMGNSCYMNCILQCIMGTNELSQI 610

Query: 706 FISSKFQSFIN-DSKFPNTPKISNSFNLLFKKMYLNG------GCSVVPTSFLKTCNILR 758
           F+++ ++  IN +SK  +   ++  F  L   M+            V PT F      + 
Sbjct: 611 FLNNSYEKHININSKLGSKGVLARYFARLAHIMHQTSYDQEKKAAIVRPTQFRMAIASIN 670

Query: 759 PDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENN-----LKVQNKEY 813
              R   +QQD QEF   +LD LH++L+   +  N  P   L +E       L ++    
Sbjct: 671 SMFR-NTNQQDCQEFCQFLLDGLHEDLN---QCGNNPPLKELSEEAEKKRELLSLRIASS 726

Query: 814 KHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSR 873
             W  +  +    S I  +F GQ  + L+C  C N+S  Y  F VLS  +P P+ T  S 
Sbjct: 727 IEW--ERFLTTNFSVIIDLFQGQYASRLKCSVCSNTSTTYQPFSVLS--VPLPTGTKSS- 781

Query: 874 SKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
              V L +C N FT  E L  +  W+CP C     ST
Sbjct: 782 ---VNLMDCFNEFTKCEKLEHDEYWNCPTCKKKQPST 815

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 71/157 (45%), Gaps = 37/157 (23%)

Query: 970  NEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVL-----KN 1024
            N P   KK  + K L    LP  L+IHL RF   + K N  +I YP  L++       K+
Sbjct: 804  NCPTCKKKQPSTKQLTITRLPRNLIIHLKRFDNRMNK-NTKLIDYPFNLDLTSFWANDKD 862

Query: 1025 NEVA-----------------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWY 1067
            + +                  KY LY + NH G+L  GHYTS VNK          + WY
Sbjct: 863  DRLPPGVSIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNK-------GLSRGWY 915

Query: 1068 YFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            YFDD+  +       + K   +V + + YVLFY R++
Sbjct: 916  YFDDQNYR-------LVKKTSEVVNSNAYVLFYRRVH 945

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 62/138 (44%), Gaps = 12/138 (8%)

Query: 395 LLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKAR-KLLQ 453
           LL+ID+R  + +++ HI A N++ ++P+    + T    Y      +++  PK    LL 
Sbjct: 221 LLIIDVRERESYNNVHIRAQNILCLEPIAFSENYT----YRDLVKRSMITAPKDEILLLG 276

Query: 454 NRTQFEYIVFYT----DNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWK 509
           N + F+YI+  T    D     ++  D      Y  +T + N        H   G + W 
Sbjct: 277 NLSNFKYIILTTALSSDLLKSYSSKLDCLKEILYQYLTMQPNGRFSRLLVH-KDGIEAWC 335

Query: 510 KVLY--SYSEQYNFNMGD 525
           K  Y   +S+ +  ++GD
Sbjct: 336 KDGYIVEHSDDHEKSIGD 353

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score =  101 bits (252), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 108/241 (44%), Gaps = 16/241 (6%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
            GL NLGN+CY+N ++QC+  T     +F+   +   IN +SK  +   ++  F  L   
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 621

Query: 737 MY---LNGG--CSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELS--NQQ 789
           MY   ++G    S+ P  F   C  +    +    QQD QEF   +LD LH++L+     
Sbjct: 622 MYKEQVDGSKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 680

Query: 790 EVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNS 849
             + E           L ++      W  +  +    S I  +F GQ  + L+C+ C ++
Sbjct: 681 PPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKVCSHT 738

Query: 850 SYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASS 909
           S  Y  F VLS+ IPK +S        + +E+C   FT  E L  +  W CP C     S
Sbjct: 739 STTYQPFTVLSIPIPKKNS-----RNNITIEDCFREFTKCENLEVDEQWLCPHCEKRQPS 793

Query: 910 T 910
           T
Sbjct: 794 T 794

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 69/155 (44%), Gaps = 37/155 (23%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV---------- 1021
            P   K+  + K L    LP  L++HL RF  +L  KNN  + YP +L++           
Sbjct: 785  PHCEKRQPSTKQLTITRLPRNLIVHLKRFD-NLLNKNNDFVIYPFLLDLTPFWANDFDGV 843

Query: 1022 ----LKNNEVA--------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYF 1069
                + ++E+         KY LYG+  H G L  GHYT+ V K         K+ W YF
Sbjct: 844  FPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKK-------GLKKGWLYF 896

Query: 1070 DDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            DD   K  +N  D         + + YVLFY R+Y
Sbjct: 897  DDTKYKPVKNKAD-------AINSNAYVLFYHRVY 924

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 70/156 (44%), Gaps = 16/156 (10%)

Query: 394 KLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKAR-KLL 452
           ++LLID+R    F+ +HI   N+I ++P+    S ++   +D+   ++L+  P +  K+ 
Sbjct: 208 EILLIDIRSRLEFNKSHIDTKNIICLEPISFKMSYSD---HDLEK-KSLITSPNSEIKMF 263

Query: 453 QNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLL---GGYDKWK 509
           Q+R  F++I+ YTD   Y   N         +LV     K I    T +     G+  W 
Sbjct: 264 QSRNLFKFIILYTDANEY---NVKQQSVLLDILVNHSFEKPISDDFTKIFILESGFPGWL 320

Query: 510 KVLYSYSEQYNFNMG-----DYLYKPHRHSGDSIKH 540
           K  Y      +F        D +Y     SG S++H
Sbjct: 321 KSNYGRQVSSSFPSNNNIKDDSVYINGNTSGLSLQH 356

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score =  101 bits (252), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 105/241 (43%), Gaps = 16/241 (6%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
            GL NLGN+CY+N ++QC+  T     +F+   +   IN +SK  +   ++  F  L   
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 621

Query: 737 MY-----LNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELS--NQQ 789
           MY      +   S+ P  F   C  +    +    QQD QEF   +LD LH++L+     
Sbjct: 622 MYKEQVDASKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 680

Query: 790 EVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNS 849
             + E           L ++      W  +  +    S I  +F GQ  + L+C+ CG++
Sbjct: 681 PPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKICGHT 738

Query: 850 SYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASS 909
           S  Y  F VLS+ IP+           + +E+C   FT  E L  +  W CP C     S
Sbjct: 739 STTYQPFTVLSIPIPRKVP-----QNEITIEDCFKEFTKCENLEVDEQWLCPHCKKRQPS 793

Query: 910 T 910
           T
Sbjct: 794 T 794

 Score = 72.0 bits (175), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 71/155 (45%), Gaps = 37/155 (23%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV---------- 1021
            P   K+  + K L    LP  L+IHL RF  +L  KNN  + YP +L++           
Sbjct: 785  PHCKKRQPSTKQLTVTRLPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGV 843

Query: 1022 ----LKNNEVA--------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYF 1069
                + ++E+         KY LYG+  H G L  GHYT+ V K         ++ W YF
Sbjct: 844  FPPGVNDDELPVRGQIPPFKYELYGVACHFGTLYGGHYTAYVKK-------GLRKGWLYF 896

Query: 1070 DDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            DD   K  +N  D       V++ + YVLFY R+Y
Sbjct: 897  DDTKFKPVKNKTD-------VTNSNAYVLFYHRVY 924

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 72/155 (46%), Gaps = 18/155 (11%)

Query: 396 LLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKAR-KLLQN 454
           LLID+R    F  +HI + N+I ++P+     K +   +D+   ++L+  P    KL Q+
Sbjct: 210 LLIDIRSRLEFDKSHIASKNIICLEPISF---KISYSDHDLEK-KSLITSPNNEIKLFQS 265

Query: 455 RTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLL---GGYDKW--- 508
           R  F++I+ YTD+  Y   N         +L+     K I S  T +     G+  W   
Sbjct: 266 RNLFKFIILYTDSNEY---NIKQQSALLDILLNHSFEKPISSDFTKVFILKSGFPSWLNS 322

Query: 509 ---KKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKH 540
              K++  ++  ++N    D +Y     SG S++H
Sbjct: 323 NHGKQISSTFPSKHNIK-DDSVYVNGNTSGLSLQH 356

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score =  101 bits (251), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 76/261 (29%), Positives = 117/261 (44%), Gaps = 48/261 (18%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFK 735
           I GL+N+GN+CY+N ++QCL  T     +F++  F+ +IN +SK  +   ++ + + L  
Sbjct: 746 IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKLIH 805

Query: 736 KMY--------------LNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRL 781
            MY               +G   + P  F   C  +  +L     QQD QEF   +LD L
Sbjct: 806 LMYNHSTLKNNGDKTKKKSGNNFIKPIQFRMACGSIN-NLFKNCSQQDCQEFCQFLLDAL 864

Query: 782 HD------------ELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPI 829
           H+            ELS + E + E  +L +         + E++ +     +    S I
Sbjct: 865 HEDLNQCGSNPPLKELSTKAESMREKLSLRI-------ASSIEWERY-----LTTDFSVI 912

Query: 830 DHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSD 889
             +F GQ  + LQC+ C ++S  Y  F VLS+ IPK         K + L +C   FT  
Sbjct: 913 VDLFQGQYASRLQCKTCIHTSTTYQPFSVLSVPIPK--------KKNLNLLDCFKDFTKI 964

Query: 890 EVLSGENAWDCPKCGSSASST 910
           E L  +  W CP C S   ST
Sbjct: 965 ENLEVDEQWFCPNCKSKQPST 985

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 74/161 (45%), Gaps = 42/161 (26%)

Query: 970  NEPW-----KSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI---- 1020
            +E W     KSK+  T K L    LP  L+IHL RF  +   KNN +I YP IL++    
Sbjct: 970  DEQWFCPNCKSKQPST-KKLTITRLPRNLIIHLKRFDNN-LNKNNNLIDYPFILDLTQFW 1027

Query: 1021 ---------------VLKNNEVA--KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKK 1063
                           + K  ++   KYRLYG   H G+L  GHYT+ VNK         +
Sbjct: 1028 ADDFDGELPPGVTDELPKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNK-------GIR 1080

Query: 1064 QRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
              WYYFDD   +  +N         +  S + YVLFY RIY
Sbjct: 1081 NGWYYFDDTNYRPIKNER-------EPISSNAYVLFYHRIY 1114

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 46/104 (44%), Gaps = 20/104 (19%)

Query: 406 FSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKAR-KLLQNRTQFEYIVFY 464
           F  NHI  PN+I I+P+    S T+  I      ++L+  P    KL + R QF++I+ Y
Sbjct: 251 FVENHIDFPNIICIEPISFKPSYTDQDIQQ----KSLITSPDNEIKLFEMRNQFKFIILY 306

Query: 465 T-DNKTYMNTN--------------FDYSFTFFYLLVTSKTNKN 493
           T DN    +                FD S T FY+L     N N
Sbjct: 307 TSDNNDESHLLSLLKILLTHSFAKPFDRSLTKFYILKGGILNWN 350

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score =  100 bits (250), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 107/241 (44%), Gaps = 16/241 (6%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
            GL NLGN+CY+N ++QC+  T     +F+   +   IN +SK  +   ++  F  L   
Sbjct: 563 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 622

Query: 737 MYL-----NGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELS--NQQ 789
           MY      +   S+ P  F   C  +    +    QQD QEF   +LD LH++L+     
Sbjct: 623 MYKKQVDSSKKDSISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 681

Query: 790 EVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNS 849
             + E           L ++      W  +  +    S I  +F GQ  + L+C+ C ++
Sbjct: 682 PPLKELSQEAETRRERLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKTCNHT 739

Query: 850 SYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASS 909
           S  Y  F VLS+ IPK +S       ++ +E+C   FT  E L  +  W CP C     S
Sbjct: 740 STTYQPFTVLSIPIPKKNS-----QNKITIEDCFKEFTKCENLEIDEQWLCPHCEKRQPS 794

Query: 910 T 910
           T
Sbjct: 795 T 795

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 68/155 (43%), Gaps = 37/155 (23%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV---------- 1021
            P   K+  + K L    LP  L+IHL RF  +L  KNN  + YP +L++           
Sbjct: 786  PHCEKRQPSTKQLTITRLPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGV 844

Query: 1022 ----LKNNEVA--------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYF 1069
                + ++E+         KY LYG+  H G L  GHYTS V K          + W YF
Sbjct: 845  FPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTSYVKK-------GLSRGWLYF 897

Query: 1070 DDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            DD   +  +N  D         + + YVLFY R+Y
Sbjct: 898  DDTKYRPAKNQTD-------AINSNAYVLFYHRVY 925

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 396 LLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKAR-KLLQN 454
           LLID+R    F  +HI   N+I ++P+    S ++  +      ++L+  P    KL Q+
Sbjct: 210 LLIDIRSRLEFKKSHIDFKNIICLEPISFKTSYSDRDLEK----KSLITSPNDEIKLFQS 265

Query: 455 RTQFEYIVFYTDNKTY 470
           R  F++I+ YTD+  Y
Sbjct: 266 RNLFKFIILYTDSNDY 281

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score =  100 bits (249), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/265 (29%), Positives = 116/265 (43%), Gaps = 35/265 (13%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPK----ISNSFNL 732
           I GL N+GN CY+N +LQCL  T     +F+ + + +FIN   F NT      ++ ++  
Sbjct: 463 IVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFIN---FGNTRGSKGLLAKNYAT 519

Query: 733 LFKKMYLNGG--------CSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDE 784
           L   M+ +G           V    F K C  +   +     QQD QEF   +LD LH++
Sbjct: 520 LVHNMHRHGAFKPPHSRTTPVQTLQFKKVCGHIN-SIYSDSMQQDCQEFCQFLLDGLHED 578

Query: 785 LSNQQEVVNEYPNLLLYDEN---NLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSL 841
           L NQ         L   +E    ++ ++      W  +  +    S I  +F GQ  + L
Sbjct: 579 L-NQNGGKKHLKQLSEQEERMRESMSIRKASALEW--ERFLLTDFSAIIDLFQGQYASRL 635

Query: 842 QCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCP 901
           QCQ C ++S  Y TF VLS+ +P        R +   + +C   FT  E L  +  W C 
Sbjct: 636 QCQACEHTSTTYQTFSVLSVPVP--------RIRTCNILDCFREFTKCEKLGVDEQWSCS 687

Query: 902 KCGSSASSTISDSEKLLNVTSSKKK 926
           KC     ST     K L +T   KK
Sbjct: 688 KCLKKQPST-----KQLKITRLPKK 707

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 73/158 (46%), Gaps = 38/158 (24%)

Query: 970  NEPWKSKKLI----TIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV---- 1021
            +E W   K +    + K L    LP  L+I+L RF   + K NN  + YP  L++     
Sbjct: 681  DEQWSCSKCLKKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPCFLDLTPYWA 739

Query: 1022 -------LKNNEVA--------KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRW 1066
                   + N ++         +YRLYG+  HSG+L  GHYTS V K P       ++ W
Sbjct: 740  RDFNHESIVNEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-------QKGW 792

Query: 1067 YYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            Y+FDD      R + +         + + YVLFYERI+
Sbjct: 793  YFFDDSVYCPIRFNDEF-------ITPNAYVLFYERIF 823

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 395 LLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKAR-KLLQ 453
           +L+ID+R    F   HI   N+I I+P+   +S T+  +  I+    L   P++   L  
Sbjct: 179 ILVIDIRPRSEFIKAHIKCKNIICIEPVSFKDSFTDQQVGKIS----LATSPQSEIDLFS 234

Query: 454 NRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLG-GYDKWKKVL 512
           NR  F+YIV YTD + Y + +   +     +L      K +      +L  G+  W K+ 
Sbjct: 235 NRDTFKYIVLYTDTQLYGDFHQRQTRILTKILCQHSVLKPLGGTKVLILANGFSNWVKLG 294

Query: 513 YSY 515
            +Y
Sbjct: 295 GAY 297

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 99.0 bits (245), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 107/254 (42%), Gaps = 39/254 (15%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
            GL NLGN+CY+N ++QCL  T     +F+   +++ +N +SK  +   ++  F+ L   
Sbjct: 495 VGLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVNLNSKLGSKGVLAKYFSQLIHT 554

Query: 737 MYLNGG-----------CSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDEL 785
           M                 +V P  F   C  +    R    QQD QEF   +LD LH++L
Sbjct: 555 MQQQAASASTKQNSGDKTAVQPLHFKVACGSINSLFR-SSSQQDCQEFCQFLLDGLHEDL 613

Query: 786 SNQQEVVNEYPNLLLYDENNLKVQNK---------EYKHWFDKNVIGNGLSPIDHIFSGQ 836
           +         P L    E    ++ K         E++ +   +      S I  +F GQ
Sbjct: 614 NQ----CGGNPALKELSEEAEGIREKLCMRIASSIEWERYLTTD-----FSVIVDLFQGQ 664

Query: 837 MENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGEN 896
             + L C+ CG +S  Y  F VLS+ +P  S        +  + +C   FT  E L  + 
Sbjct: 665 YASQLTCKVCGRTSTTYQPFSVLSVPVPSGS--------KCDIIDCFKEFTKVETLEKDE 716

Query: 897 AWDCPKCGSSASST 910
            W CP+C     ST
Sbjct: 717 QWSCPRCKCKQPST 730

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 70/160 (43%), Gaps = 39/160 (24%)

Query: 969  KNEPWKSK----KLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV--L 1022
            K+E W       K  + K +    LP  LVIHL RF  +L  KNN  ++YP  L++    
Sbjct: 714  KDEQWSCPRCKCKQPSTKKITITRLPRNLVIHLKRF-DNLLHKNNIFVSYPHTLDLTPFW 772

Query: 1023 KNN-------EVAK-----------YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQ 1064
             N+        VA+           Y LY +  H G L  GHYTS V+K         K 
Sbjct: 773  ANDFDGRLPPGVAELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDK-------GDKA 825

Query: 1065 RWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
             W YFDD + ++ ++ G+         +   YVLFY R Y
Sbjct: 826  GWCYFDDTSWRKAKSQGE-------CITLSAYVLFYHRKY 858

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 62/134 (46%), Gaps = 10/134 (7%)

Query: 377 ITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDI 436
           I+  EL S+L         LLIDLR   +F  +HI    ++ I+P+   +S ++T I   
Sbjct: 164 ISPSELQSLLG----AQNALLIDLRPRIKFVESHIKTDKIMCIEPISFKDSYSDTEI--- 216

Query: 437 TTLENLLYEPKAR-KLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNI- 494
            T  +L+  P    +L Q R +F+YIV YTD             +   LLV     K + 
Sbjct: 217 -TRRSLITSPNEEVQLFQERDKFDYIVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKPLQ 275

Query: 495 KSAPTHLLGGYDKW 508
           ++    L GG++ W
Sbjct: 276 RTIILTLQGGFENW 289

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 98.6 bits (244), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 114/250 (45%), Gaps = 35/250 (14%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
            GL N+GN+CYIN ++QCL  T    ++F+++ ++  IN +SK  +   ++  F  L  +
Sbjct: 515 VGLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAKHFARLIHQ 574

Query: 737 MYLNGGC-------SVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQ 789
           M+ +          +V P  F   C  +    R    QQD+QEF   +LD LH++L NQ 
Sbjct: 575 MHQSAAFKKSDKNKAVRPYEFKMACGSINSLFR-ESGQQDSQEFCQFLLDGLHEDL-NQ- 631

Query: 790 EVVNEYPNLLLYDENNLKVQNK---------EYKHWFDKNVIGNGLSPIDHIFSGQMENS 840
                 P L    E   K++ +         E++ +  ++      S I  +F GQ  + 
Sbjct: 632 --CGGNPPLKELSEEAEKMRERLSMRIASSIEWERYLTRD-----FSVIVDLFQGQYASQ 684

Query: 841 LQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDC 900
           L+C+ C ++S  Y  F +L+  +P         +K   L +C   FT  E L  +  W C
Sbjct: 685 LRCKVCNHTSTTYQPFSILAAPVP--------HAKSCYLLDCFKEFTKLEQLEKDEEWLC 736

Query: 901 PKCGSSASST 910
           P C     ST
Sbjct: 737 PYCKKKQPST 746

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 73/154 (47%), Gaps = 36/154 (23%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI----------- 1020
            P+  KK  + K L    LP  L+IHL RF  +L  KNN ++ YP  L++           
Sbjct: 737  PYCKKKQPSTKKLTITRLPRNLIIHLKRFD-NLLNKNNVLVNYPFFLDLTPFWANDFDGR 795

Query: 1021 --------VLKNNEVA--KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFD 1070
                    +    +VA  KY+LY + +HSG+L  GHYT+ V+K  N       + WYYFD
Sbjct: 796  LPPGVTDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGLN-------KGWYYFD 848

Query: 1071 DETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
            D   +  R          +  + + YVLFY R+Y
Sbjct: 849  DTGYRPMRTP-------TECITSNAYVLFYHRVY 875

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 59/113 (52%), Gaps = 8/113 (7%)

Query: 365 IHSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLL 424
           I S + L+    I+A+EL  +L +  +   +LL+D+R    F   HI A N+I I+P+  
Sbjct: 142 ISSDKELKTGGFISAKELEFLLKS--DDRNILLVDVRQRSEFEETHIKASNVICIEPISF 199

Query: 425 WNSKTNTPIYDITTLENLLYEPKAR-KLLQNRTQFEYIVFYTD-NKTYMNTNF 475
            +S T+  +      ++++  P     + + R +F +++ YTD NK   + NF
Sbjct: 200 KSSYTDLELEK----KSMITSPNVEIDIFKRRNEFTFVILYTDGNKENGHHNF 248

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 97.4 bits (241), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 114/245 (46%), Gaps = 22/245 (8%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFK 735
           I GL+N+GN+CY+N ++QCL  T     +F+++ ++  IN +SK  +   ++  F  L  
Sbjct: 558 IVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFARLIH 617

Query: 736 KMYLNGGCS-----VVPTSF---LKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELS- 786
            M+ +         V P  F   + + N L  +      QQD QEF   +LD LH++L+ 
Sbjct: 618 LMHNHANPKLKNNYVRPAQFKMAVGSVNTLFKNC----SQQDCQEFCQFLLDGLHEDLNQ 673

Query: 787 -NQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQR 845
                 + E  +    +   L ++      W  +  +    S I  +F GQ  + LQC+ 
Sbjct: 674 CGSNPPLKELSSAAEKNREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLQCEV 731

Query: 846 CGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGS 905
           C ++S  Y  F VLS+ IP+       +  +V + +C   FT  E+L  +  W CP C  
Sbjct: 732 CKHTSTTYQPFSVLSVPIPR-----VPKGVKVNILDCFKDFTKLELLDTDEQWLCPTCKK 786

Query: 906 SASST 910
              ST
Sbjct: 787 KQRST 791

 Score = 68.9 bits (167), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 71/155 (45%), Gaps = 36/155 (23%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI----------- 1020
            P   KK  + K L    LP  L+IHL RF      KNN  I YP IL++           
Sbjct: 782  PTCKKKQRSTKKLTITRLPRNLIIHLKRFDN-NLNKNNNFIDYPFILDLTQFWVDDFDGK 840

Query: 1021 --------VLKNNEVA--KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFD 1070
                    + K  ++   KY+LYG+ +H G+L  GHYT+ V+K P H        WYYFD
Sbjct: 841  LPPGVRDELPKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGPKHG-------WYYFD 893

Query: 1071 DETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105
            D   +  +N         +  +   Y+LFY RIY+
Sbjct: 894  DTNYRSIKNKN-------EPITSSAYLLFYHRIYD 921

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 68/142 (47%), Gaps = 10/142 (7%)

Query: 371 LQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTN 430
           ++   +I++ +L  +L    + + +LLID+R    FS +HI    +I ++P+   +S ++
Sbjct: 159 MKNGSLISSYQLKQLLYGKNDNTSVLLIDIRPRLEFSKSHIKHEEIICVEPISFKDSYSD 218

Query: 431 TPIYDITTLENLLYEPKAR-KLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSK 489
             +      ++L+  P     L   R +FE+I+ YT++K      ++    F  +L+T  
Sbjct: 219 EEV----AKKSLITSPNEEIDLFNKRNEFEFIILYTNDKE--KAYYNQQMVFLEILLTHS 272

Query: 490 TNKNIKSAPTHLL---GGYDKW 508
             K + S  T +L    G   W
Sbjct: 273 FAKPLDSWKTKVLILENGISSW 294

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/248 (29%), Positives = 107/248 (43%), Gaps = 30/248 (12%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
            GL N+GN+CYIN ++QC+FAT     +F++  +   IN  SK  +   +S++F  L K 
Sbjct: 525 VGLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHINKQSKLGSKGVLSHNFAKLLKD 584

Query: 737 MY-------LNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQ- 788
           MY       +      V T   K        L     QQD  EF   +LD LH++L NQ 
Sbjct: 585 MYEENSSKKIGKKHGAVKTLQFKMACASVNSLFKDASQQDCLEFCQFLLDGLHEDL-NQC 643

Query: 789 ------QEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQ 842
                 +E+  E   +      NL ++      W  +  +    S I  +F GQ  + L+
Sbjct: 644 GANPPLKELSPEAEKM----RENLSLRVASSIEW--ERYLTTDFSIIVDLFQGQYASQLR 697

Query: 843 CQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPK 902
           C+ C  +S  Y  F VLS+ +P          K   L +C   FT  E L  +  W CP 
Sbjct: 698 CKVCNRTSTTYQAFSVLSVPVPS--------GKSCGLLDCFIEFTKTENLEVDEQWFCPS 749

Query: 903 CGSSASST 910
           C     ST
Sbjct: 750 CKKKQPST 757

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 65/153 (42%), Gaps = 36/153 (23%)

Query: 972  PWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIV--LKNNEVAK 1029
            P   KK  + K L    LP  L+IHL RF  ++  KNN  + YP IL++     N+   K
Sbjct: 748  PSCKKKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNIFVRYPQILDLTPFWANDSDGK 806

Query: 1030 -------------------YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFD 1070
                               YRLYG   H G L  GHYTS V+K P       ++ W YFD
Sbjct: 807  LPPGITDEIPARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDKGP-------EKGWIYFD 859

Query: 1071 DETVKEERNHGDMDKGILQVSSRDVYVLFYERI 1103
            D   +  R   +         S   YVLFY RI
Sbjct: 860  DTVYRPVRFQNEF-------ISPSAYVLFYHRI 885

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 52/90 (57%), Gaps = 5/90 (5%)

Query: 377 ITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDI 436
           I+  EL S++   +++  LLLID+R    + ++HI   N+I I+P+    S ++  I   
Sbjct: 190 ISCSELLSLMK--MKEDSLLLIDVRPKLEYDAHHIKTKNIICIEPISFKESYSDQQIEKT 247

Query: 437 TTLENLLYEPKARKLLQNRTQFEYIVFYTD 466
           + + +  +E    +L Q R++F+YI+ YTD
Sbjct: 248 SMIPSPKHE---IQLFQRRSEFQYIILYTD 274

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 111/254 (43%), Gaps = 37/254 (14%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFK 735
           I GL N+ N+CY+N ++QCL +      + +++ F   IN +SK  +   I   F  L +
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQ 487

Query: 736 KMY---LNGGCSV----VPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHD----- 783
            M+   +  G S+    V T   K        +     QQD QEF   +LD LH+     
Sbjct: 488 DMHSQQVKTGRSLFSYPVKTIDFKNACASVSSIYSGSQQQDCQEFCEFLLDGLHEDLNQC 547

Query: 784 -------ELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQ 836
                  EL++Q+E + E           L ++      W  +N + N  S I  +F+GQ
Sbjct: 548 GGNPPARELTDQEERLRE----------GLCMRVASSMAW--ENFLHNNFSLIIDLFAGQ 595

Query: 837 MENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGEN 896
             + L+C  C  +S  Y  F +LS+ +P       SR  R  + +C   FT  E L  + 
Sbjct: 596 YGSQLRCCVCQYTSTTYQPFTLLSVPVPLS-----SRVSRCSIIDCFQEFTKCERLDKDE 650

Query: 897 AWDCPKCGSSASST 910
            W CP+C     ST
Sbjct: 651 EWFCPQCKRKQPST 664

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 74/162 (45%), Gaps = 41/162 (25%)

Query: 969  KNEPW----KSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI---- 1020
            K+E W      +K  + K L    LP  L+IH  RF  ++  KNN  I YP  L++    
Sbjct: 648  KDEEWFCPQCKRKQPSTKQLKITRLPKNLIIHFKRFD-NMMNKNNIFIQYPYELDLTPFW 706

Query: 1021 ----------------VLKNNEVA--KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSK 1062
                            + K  +V   KY+L  +  H G L SGHYT+ VNK P  D+G  
Sbjct: 707  VNDFNGELPLGMTNSLLTKGGQVGPFKYQLNAVACHMGTLGSGHYTAYVNKGP--DVG-- 762

Query: 1063 KQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
               WYYFDD + +       + K   +  + D Y+LFY R+Y
Sbjct: 763  ---WYYFDDSSHR-------IVKIATEYMNPDAYLLFYHRVY 794

 Score = 35.8 bits (81), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 50/94 (53%), Gaps = 11/94 (11%)

Query: 377 ITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDI 436
           +T  +L +ILS+  +K  +LLID+R    F  +HI +  ++ +DP+      +  P Y I
Sbjct: 160 LTVPQLQTILSD--QKISVLLIDVRKRYEFEFSHINSVAVLPLDPI------SFKPTYTI 211

Query: 437 TTLENLLY--EPKAR-KLLQNRTQFEYIVFYTDN 467
             LE + +   P    +L Q R +++ IV YT +
Sbjct: 212 DQLEKISFINSPMHELQLFQKRNEYDVIVLYTKD 245

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 104/215 (48%), Gaps = 24/215 (11%)

Query: 671 LYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNS 729
           L  S  ITGL NLGNTCY+NS LQCL      RD F+   F S IN D+       I+ +
Sbjct: 295 LQPSQGITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINSDNPLGYQGNIAKA 354

Query: 730 FNLLFKKMYLNGGCSVVPTSF--------LKTCNILRPDLRIPDDQQDTQEFLMIILDRL 781
           F+LL K ++     S    +F        +  CN +         QQD+QEFL  +LD L
Sbjct: 355 FSLLVKSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYM----QQDSQEFLAFLLDGL 410

Query: 782 HDELSNQQ-----EVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQ 836
           H++L+        E  +  PN  + D + +K   K  +  +  +++ N  S +  +F   
Sbjct: 411 HEDLNRVHDKPYIEKPSLSPNSDVTDRDTIK---KLAEDTWKMHLLRND-SIVTDLFVAL 466

Query: 837 MENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTF 871
            E++L+C  C N S  +  +  L+L  P P +TT+
Sbjct: 467 YESTLECPECRNVSITFDPYNDLTL--PLPVNTTW 499

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 56/131 (42%), Gaps = 24/131 (18%)

Query: 982  KTLNFIVLPPILVIHLSRF--YYDLTKKNNTVITYP-----LILNIVLKNNEVAKYRLYG 1034
            K +     P +L+IHL RF      + K +  + +P     +  ++V ++   + Y L  
Sbjct: 904  KQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDLIA 963

Query: 1035 IVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRD 1094
            + NH G L  GHYT+ V             +W+YFDD  V E +    +        +  
Sbjct: 964  VDNHFGGLGGGHYTAYV---------KTNDKWFYFDDSRVTETKPESSI--------AGS 1006

Query: 1095 VYVLFYERIYE 1105
             Y+LFY R  E
Sbjct: 1007 AYLLFYLRRTE 1017

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 875 KRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
           + + L +C+ +F+  EVLS  ++W CP C     +T
Sbjct: 868 RAISLHDCLKLFSKKEVLSMNDSWYCPTCKDHRQAT 903

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 82.0 bits (201), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 106/204 (51%), Gaps = 8/204 (3%)

Query: 670 NLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISN 728
           +L  SL ITGL NLGNTCY+NS LQC+    +FR+ F+ S ++  +N D+       ++ 
Sbjct: 313 DLVPSLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVAE 372

Query: 729 SFNLLFKKMY---LNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDEL 785
           +F+ L + ++   L    +  P  F  T       +     QQD+QEFL  +LD LH++L
Sbjct: 373 AFSELIRCLFGDKLVQFSAYAPNHFKATIGHFN-SMFSGYLQQDSQEFLAFLLDSLHEDL 431

Query: 786 SN-QQEVVNEYPNL-LLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQC 843
           +   ++   E P+L    D N+ ++  K     +  +++ N  S I  +F G  +++L+C
Sbjct: 432 NRIDKKPYVEKPSLPSTADLNDFRIVKKLADDTWKAHLLRND-SVITDLFVGLYKSTLEC 490

Query: 844 QRCGNSSYNYSTFYVLSLAIPKPS 867
             C N S  +  +  L+L +P  S
Sbjct: 491 PECQNISITFDPYNDLTLPLPVKS 514

 Score = 39.7 bits (91), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 52/121 (42%), Gaps = 23/121 (19%)

Query: 990  PPILVIHLSRF--YYDLTKKNNTVITYPLI-----LNIVLKNNEVAK-YRLYGIVNHSGN 1041
            P +L+IHL RF      + K + V+ +P+       ++V K++     Y L  + NH G 
Sbjct: 938  PDVLLIHLKRFENQQSFSDKIDDVVQFPITDFDISEHLVYKDDPRGNVYDLIAVDNHYGG 997

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYE 1101
            L  GHYT+           S   +WYYFDD  V E      +            Y+LFY 
Sbjct: 998  LGGGHYTAYAK-------NSTDGKWYYFDDSRVTETVAENSITGA--------AYLLFYL 1042

Query: 1102 R 1102
            R
Sbjct: 1043 R 1043

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 24/38 (63%)

Query: 873 RSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
           ++K + L +C+N+F+  E+LS  ++W CP C     +T
Sbjct: 892 KNKEITLNDCLNLFSKPEILSLNDSWYCPTCKEHRQAT 929

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 99/192 (51%), Gaps = 8/192 (4%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKKM 737
           GL NLGNTCY+NS LQCL      RD F+   F+  IN D+       ++ SF +L + +
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEINLDNPLGYQGHVARSFAILIQNL 402

Query: 738 Y---LNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN-QQEVVN 793
           +   L    S  PT+F  T       +     QQD+QEF+  +LD LH++L+    + V 
Sbjct: 403 FKDELLPSLSYSPTTFKSTVGHFNS-MFSGYLQQDSQEFIAFLLDGLHEDLNRITNKPVV 461

Query: 794 EYPNLLLYDE-NNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYN 852
           E P+L   D+ +N +V  K     ++ +++ N  S I  IF G  +++L C  C N S  
Sbjct: 462 EKPSLKPEDDVSNQEVIKKLADDTWNSHLLRND-SIITDIFVGLYKSTLHCPECDNLSVT 520

Query: 853 YSTFYVLSLAIP 864
           +  +  L+L +P
Sbjct: 521 FDPYNDLTLPLP 532

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 59/133 (44%), Gaps = 31/133 (23%)

Query: 982  KTLNFIVLPPILVIHLSRF--YYDLTKKNNTVITYP---LILNIVLKNNEVAKYRLYGIV 1036
            K L     P IL+IHL RF      + K +  + +P   L L+  + NN+ +K  +Y +V
Sbjct: 943  KQLQLWSTPDILLIHLKRFENQSSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYDLV 1002

Query: 1037 ---NHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDD----ETVKEERNHGDMDKGILQ 1089
               NH G L  GHYT+ V            ++WYYFDD    ETV E    G        
Sbjct: 1003 SVDNHYGGLGGGHYTAYVK-------NFVDKKWYYFDDSRVTETVPERSIAG-------- 1047

Query: 1090 VSSRDVYVLFYER 1102
                  Y+LFY R
Sbjct: 1048 ----SAYLLFYMR 1056

 Score = 39.3 bits (90), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 875 KRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
           K++ L++C+N+F   EVL   ++W CP C     +T
Sbjct: 907 KKITLDDCLNLFAKKEVLGMNDSWYCPTCKEHRQAT 942

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 78.6 bits (192), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 68/209 (32%), Positives = 102/209 (48%), Gaps = 23/209 (11%)

Query: 674 SLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNL 732
           S    GL NLGNTCY+NS LQCL      RD F+ + F+  IN ++       ++ SF+ 
Sbjct: 317 STGTIGLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEINVNNPLGFQGHMARSFHG 376

Query: 733 LFKKMYLNGGCS----VVPTSFLKTC---NILRPDLRIPDDQQDTQEFLMIILDRLHDEL 785
           L + ++ +        V PT F  T    N +    +    QQD+QEFL  +LD LH++L
Sbjct: 377 LIQSLFGDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQ----QQDSQEFLAFLLDSLHEDL 432

Query: 786 SNQQEV-VNEYPNLLLYDENN-----LKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMEN 839
           +   E    E P+L   D+ N      K+ N+ +K    +N      S I  IF G  ++
Sbjct: 433 NRIVEKPYVEKPSLKPGDDINDFDTIKKLANETWKSHLMRND-----SIITDIFVGMYKS 487

Query: 840 SLQCQRCGNSSYNYSTFYVLSLAIPKPSS 868
           +L+C  C N S  +  +  L+L +P  SS
Sbjct: 488 TLECPECSNVSITFDPYNDLTLPLPINSS 516

 Score = 35.8 bits (81), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 875 KRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
           +   L++C+N+F+  EVL   ++W CP C     +T
Sbjct: 891 QETTLKDCLNLFSKKEVLGMSDSWYCPNCKEHRQAT 926

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 53/121 (43%), Gaps = 23/121 (19%)

Query: 990  PPILVIHLSRF--YYDLTKKNNTVITYP-----LILNIVLKNNEVAK-YRLYGIVNHSGN 1041
            P + +IHL RF      + K +  I +P     +   +V K++     Y L  + NH G 
Sbjct: 935  PDVFLIHLKRFENTRSFSDKIDATILFPIEDLDMSEYLVYKDDPRGSVYDLIAVDNHYGG 994

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYE 1101
            +  GHYT+ V    +       Q WYYFDD  V +       +K I    +   Y+LFY 
Sbjct: 995  MGGGHYTAYVKNLTD-------QNWYYFDDSRVSKTS----PEKSI----AGSAYLLFYL 1039

Query: 1102 R 1102
            R
Sbjct: 1040 R 1040

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 78.6 bits (192), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 102/204 (50%), Gaps = 8/204 (3%)

Query: 670 NLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSK-FPNTPKISN 728
           NL  S    GL NLGNTCY+NS LQC+    +FRD F+   FQ  +N+         ++ 
Sbjct: 322 NLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQKEVNEGNPLGYQGYMAR 381

Query: 729 SFNLLFKKMYLNGGCSVV---PTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDEL 785
           +F+ L + ++ +   S     P+ F  T       +     QQD+QEFL  +LD LH++L
Sbjct: 382 AFSDLIQSLFGDNITSTTAYSPSYFKSTLGHFN-SMFSGYLQQDSQEFLAFLLDSLHEDL 440

Query: 786 SN-QQEVVNEYPNL-LLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQC 843
           +   ++   E P+L L  + N+  V  +     +  +++ N  S I  +F    +++L+C
Sbjct: 441 NRIDKKPYVEKPSLPLTANLNDFDVVKRLADDTWKAHLLRND-SVITDLFVAMYKSTLKC 499

Query: 844 QRCGNSSYNYSTFYVLSLAIPKPS 867
             C N+S  +  +  L+L +P  S
Sbjct: 500 PECQNTSVTFDPYNDLTLPLPVAS 523

 Score = 36.2 bits (82), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 22/38 (57%)

Query: 873 RSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
             + + L++C+ +F+  E+LS  ++W CP C     +T
Sbjct: 935 EERHITLDDCLKLFSKPEILSSNDSWYCPHCKEHRQAT 972

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 51/121 (42%), Gaps = 23/121 (19%)

Query: 990  PPILVIHLSRFYYDLTKKNNTVIT-------YPLILNIVLKNNEVAK-YRLYGIVNHSGN 1041
            P IL+IHL RF    +  +  V T       + +  ++V K +     Y L  + NH G 
Sbjct: 981  PDILLIHLKRFENQRSFSDKIVDTVFFPITDFDISEHLVYKEDPRGNVYDLIAVDNHYGG 1040

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYE 1101
            L  GHYT+           +   +WYYFDD  V         +K I    +   Y+LFY 
Sbjct: 1041 LGGGHYTAYAK-------NANDNKWYYFDDSRVSVTA----PEKSI----AGSAYLLFYV 1085

Query: 1102 R 1102
            R
Sbjct: 1086 R 1086

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 78.6 bits (192), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 104/209 (49%), Gaps = 27/209 (12%)

Query: 674 SLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNL 732
           S  ITGL NLGNTCY+NS LQCL      RD F+ + F+  IN ++       ++ +F+ 
Sbjct: 289 SSGITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEINCNNPLGYQGYVARAFSG 348

Query: 733 LFKKMY----LNGGCSVV----PTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDE 784
           L + ++    L+ G ++     PT F  T       +     QQD+QEF+  +LD LH++
Sbjct: 349 LVQNLFGCKTLSSGSTLTPAYSPTGFKSTIGHFN-SMFSGYMQQDSQEFITFLLDGLHED 407

Query: 785 LSNQQEVVN----EYPNLLLYDENN-----LKVQNKEYKHWFDKNVIGNGLSPIDHIFSG 835
           L+    +V+    E P+L   D++N      ++    +K    +N      S I  +F G
Sbjct: 408 LN---RIVDKPYIEKPSLSPEDDSNDFNVIKRLAEDTWKLHLQRND-----SVITDLFVG 459

Query: 836 QMENSLQCQRCGNSSYNYSTFYVLSLAIP 864
             E++LQC  C N S  +  +  L+L +P
Sbjct: 460 LYESTLQCPECNNVSITFDPYNDLTLPLP 488

 Score = 38.9 bits (89), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 55/121 (45%), Gaps = 23/121 (19%)

Query: 990  PPILVIHLSRF--YYDLTKKNNTVITYP---LILNIVLKNNEVAKYRLYGIV---NHSGN 1041
            P +L+IHL RF      + K + V+ +P   L ++  L N    +  +Y +V   NH G 
Sbjct: 922  PDVLLIHLKRFENLRSFSDKIDEVVHFPITGLDMSPYLVNKGDPRGTIYDLVAVDNHYGG 981

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYE 1101
            L  GHYT+               +WYYFDD  V E       ++GI    +   Y+LFY 
Sbjct: 982  LGGGHYTAYAK-------NVDDSKWYYFDDSRVTETT----PERGI----ASSAYLLFYV 1026

Query: 1102 R 1102
            R
Sbjct: 1027 R 1027

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 875 KRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
           K++ L +C+ +F+  EVL   ++W CP C     +T
Sbjct: 878 KKITLHDCLKLFSKREVLGMNDSWYCPSCKEHRQAT 913

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 103/216 (47%), Gaps = 24/216 (11%)

Query: 676 SITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLF 734
            I GL NLGNTCY+NS LQCL      RD F    ++  IN D+       ++ +F  L 
Sbjct: 287 GIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGYNGTVATAFGNLI 346

Query: 735 KKMY-----LNGGCSVVPTSF---LKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELS 786
           + +Y          S  P  F   L   N +         QQD+QEFL  +LD LH++L+
Sbjct: 347 QNLYSYHWNQQQYQSYSPNRFKMTLGQANSMFAGYM----QQDSQEFLAFLLDSLHEDLN 402

Query: 787 N-QQEVVNEYPNL----LLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSL 841
               +   E P L     L DEN +K   K  K W D ++  N  S I+ +F G  +++L
Sbjct: 403 RIHDKPYIEKPTLETSEELADENAVKQLAK--KTW-DAHLARND-SVINDLFVGMYKSTL 458

Query: 842 QCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRV 877
           +C  C N S  +  +  L+L  P P ST +++  ++
Sbjct: 459 KCPTCKNISITFDPYNDLTL--PLPISTVWNKKVKI 492

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 61/129 (47%), Gaps = 27/129 (20%)

Query: 982  KTLNFIVLPPILVIHLSRF--YYDLTKKNNTVITYPL--------ILNIVLKNNEVAKYR 1031
            K L     P IL+IHL RF      + K + V+ +P+        +++ V+++  +  Y 
Sbjct: 879  KQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFPIEGLDMTPYVVDSVVEDGCI--YD 936

Query: 1032 LYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVS 1091
            L+ + NH G L  GHYTS V    ++       RWYYFDD  V    +  D  K +    
Sbjct: 937  LFAVDNHYGGLGGGHYTSYVKNNIDN-------RWYYFDDSRV----SSTDPKKSV---- 981

Query: 1092 SRDVYVLFY 1100
            +   Y+LFY
Sbjct: 982  AGSAYLLFY 990

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 877 VKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
           + L+ C+ +F+  EVL   ++W CPKC     +T
Sbjct: 845 ITLDSCLKLFSKPEVLGINDSWYCPKCKEHRQAT 878

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 107/208 (51%), Gaps = 11/208 (5%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSK-FPNTPKISNSFNLLFKK 736
           TGL NLGNTCY+NS LQCL      RD F+ + ++S IN+         ++ +F+ L +K
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEENPLGYHGYVARAFSDLVQK 423

Query: 737 MYLNGGCSV-----VPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN-QQE 790
           ++ N   S+      P S  K+       +     QQD+QEFL  +LD LH++L+   ++
Sbjct: 424 LFHNKLSSMQRNAAFPPSMFKSTVGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNRIIKK 483

Query: 791 VVNEYPNLLLYDE-NNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNS 849
              E P+L   D+ N+  V  K     ++ ++  N  S I  +F G  +++L C  C N 
Sbjct: 484 AYIEKPSLSPDDDVNDWNVVKKLADDTWEMHLKRN-CSVITDLFVGLYKSTLYCPECKNV 542

Query: 850 SYNYSTFYVLSLAIPKPSSTTFSRSKRV 877
           S  +  +  ++L  P P  T +S++ ++
Sbjct: 543 SITFDPYNDVTL--PLPVDTVWSKTVKI 568

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 54/121 (44%), Gaps = 23/121 (19%)

Query: 990  PPILVIHLSRF--YYDLTKKNNTVITYPLIL-----NIVLKNNEVAK-YRLYGIVNHSGN 1041
            P IL++HL RF      + K +  + +P+       ++V K++     Y LY + NH G 
Sbjct: 1006 PDILLVHLKRFESQRSFSDKIDATVNFPVTALDLSKHVVHKDDPRGSIYDLYAVDNHYGG 1065

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYE 1101
            L  GHYT+ V    +        +WYYFDD  V E      +        S   Y+LFY 
Sbjct: 1066 LGGGHYTAYVKNFAD-------SKWYYFDDSRVTETVPENSI--------SGSAYLLFYI 1110

Query: 1102 R 1102
            R
Sbjct: 1111 R 1111

 Score = 35.4 bits (80), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 49/106 (46%), Gaps = 16/106 (15%)

Query: 817 FDKNVIGNGLSPIDH-IFSGQMENSLQCQ-RCGNSSYNYSTFYVLSLAIPKP------SS 868
            DKN   NGLS I H I S  +++ L C+     S+  +S   + +   P P       +
Sbjct: 896 LDKN--ENGLSSISHEILS--IDDILVCEWEESGSNEAFSNDKIFNWENPAPLPNIELEN 951

Query: 869 TTFSRS----KRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
               RS    + + L++C+ +F+  E+L   ++W CP C     +T
Sbjct: 952 AKLERSNAKERIITLDDCLQLFSKPEILGLNDSWYCPTCKEHRQAT 997

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 111/252 (44%), Gaps = 32/252 (12%)

Query: 669 PNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKF------- 720
           PN      I G++N GN CY+N ++QCL     F + F+ + +   IN +S+        
Sbjct: 335 PNYTSPTVIKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTINVNSRLGHQGLVV 394

Query: 721 PNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDR 780
            N  KI  +F   F+    N   +V  T F +    L P+      Q D  EF + +L+ 
Sbjct: 395 KNWAKIIQAF---FQVSQENIQPAVSITEFREQWANLFPEYG-KYQQHDCSEFCLRLLEE 450

Query: 781 LHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENS 840
           +H++ SN     N          ++  +Q  +Y+  ++    GN    +D  F GQ+++ 
Sbjct: 451 IHED-SNWGRPQN----------SDAAMQVDDYREAWNLYRKGNSSYIVD-TFKGQIKSQ 498

Query: 841 LQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDC 900
           L CQ C   S NY  F +L+L IP  S           + +C+       VL+G++ W C
Sbjct: 499 LTCQVCQTQSNNYEPFSILNLPIPLVS--------MCHIYDCMKELFKVHVLTGDDRWYC 550

Query: 901 PKCGSSASSTIS 912
             C +   ST+ 
Sbjct: 551 STCKTKTHSTLG 562

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 58/118 (49%), Gaps = 20/118 (16%)

Query: 989  LPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAK----YRLYGIVNHSGNLIS 1044
            +P +L+IH +RF  +L  K    + YP +L++   N  + K    Y+L  +  H+G L S
Sbjct: 568  VPEVLIIHFNRFD-NLLNKKECFVKYPYLLDLSQGNGLLGKCDVPYKLVAVACHTGTLFS 626

Query: 1045 GHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYER 1102
            GHYT+   K       + +  WY+FDD   K   N         +  S+  Y+LFY++
Sbjct: 627  GHYTAYCFK-------NSENGWYHFDDTQCKPVSNG--------ECISQSAYLLFYQK 669

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 75.1 bits (183), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 104/208 (50%), Gaps = 10/208 (4%)

Query: 671 LYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNS 729
           L  S    GL NLGNTCY+NS LQCL     F+D F+ + ++  +N ++   +   I+ +
Sbjct: 339 LLSSKGTIGLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWA 398

Query: 730 FNLLFKKMYL---NGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELS 786
           F  + + ++    +   S  P +F  T   L   +     QQD+QEFL  +LD LH++L+
Sbjct: 399 FASMVQALFGKRHSAATSYSPRNFKNTIGHLN-SMFSGYQQQDSQEFLAFLLDGLHEDLN 457

Query: 787 N-QQEVVNEYPNLLLYDEN-NLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQ 844
              ++   E P L   D+    KV  K     + K+ + N  S I  +F G  +++L C 
Sbjct: 458 RIIEKPYVEKPELTSTDDTAEFKVIKKLADDTWGKHKLRND-SVITDLFVGLYKSTLICP 516

Query: 845 RCGNSSYNYSTFYVLSLAIPKPSSTTFS 872
            C  +S  +  +  L+L  P P ++T+S
Sbjct: 517 VCKKTSVTFDPYNDLTL--PLPVNSTWS 542

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 23/39 (58%)

Query: 872 SRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
           S  K++ L +C+ +F++ EVL   ++W CP C     +T
Sbjct: 957 SGEKKITLHDCLTLFSTPEVLGATDSWFCPNCKEHRQAT 995

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 57/132 (43%), Gaps = 24/132 (18%)

Query: 982  KTLNFIVLPPILVIHLSRF--YYDLTKKNNTVITYPLI-LN----IVLKNNEVAK-YRLY 1033
            K +     P IL+IHL RF      + K    + +P+  L+    +V KN +    Y L 
Sbjct: 996  KQIELWNAPDILLIHLKRFENQRSFSDKIADTVHFPITDLDMTPYLVYKNEDKGDIYDLI 1055

Query: 1034 GIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSR 1093
             + NH G L  GHYT+ V    N D      +WYYFDD  V E      +        + 
Sbjct: 1056 AVDNHYGGLGGGHYTAYVK---NID-----GKWYYFDDSRVSETLPERSI--------AG 1099

Query: 1094 DVYVLFYERIYE 1105
              Y+LFY R  E
Sbjct: 1100 SAYLLFYRRRVE 1111

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 97/198 (48%), Gaps = 8/198 (4%)

Query: 676 SITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSK-FPNTPKISNSFNLLF 734
            I GL NLGN+CY+NS LQCL      RD F+   F+  IN S       +I+ +F  L 
Sbjct: 296 GIVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTSNPLGYQGQIAQAFAALV 355

Query: 735 KKMYLNGGCSV---VPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN-QQE 790
           K ++ +   ++    P +F K+       +     QQD+QE L  +LD LH++L+   ++
Sbjct: 356 KSLFDDKASALQAFSPRAF-KSIIGHHNGMFAGFLQQDSQELLAFLLDGLHEDLNRIMKK 414

Query: 791 VVNEYPNLLLYDE-NNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNS 849
              E P L   D+ N++ V        ++K+ + N    +D +F G  +++L C  C   
Sbjct: 415 PFVEKPELASSDDVNDIDVIRNLASLTWEKHKLRNESVIVD-LFVGLYKSTLTCPACDRV 473

Query: 850 SYNYSTFYVLSLAIPKPS 867
           S  +  F  L+L +P  S
Sbjct: 474 SVTFDPFSDLTLPLPVES 491

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 88/214 (41%), Gaps = 26/214 (12%)

Query: 900  CPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKT 959
            C     SAS   SD  ++     +K +NM+   E  +++S+    H      +  F K  
Sbjct: 827  CEWIEESASVVFSDEREIFWSKPAKLRNMALE-EAQKHRSEQEKGHISLTDCLELFSKSE 885

Query: 960  SPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRF--YYDLTKKNNTVITYPLI 1017
               A  S     P   +     K +     P IL IHL RF   +  + K + V+ +P+ 
Sbjct: 886  VLGAADSWYC--PNCKEHRQATKQIQLWNTPDILTIHLKRFENRHSFSDKISDVVDFPIT 943

Query: 1018 L-----NIVLKN-NEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDD 1071
                  ++V  + N+ + Y L  + NH G L  GHYT+ V             +WYYFDD
Sbjct: 944  GLDMSEHLVCHDPNQNSMYDLIAVDNHYGGLGGGHYTAYVK-------NFMDGKWYYFDD 996

Query: 1072 ETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105
              V E     + ++ I    S   Y+LFY R  E
Sbjct: 997  SRVSE----TEAERAI----SGAAYLLFYRRRIE 1022

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 100/210 (47%), Gaps = 17/210 (8%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKKM 737
           GL NLGNTCY+NS LQCL      RD F+ S +++ +N D+       ++ +F+ L + +
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDNLIGYKGYVAKAFSSLVQNL 383

Query: 738 YLN------GGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEV 791
           + +         S  P  F  T       +     QQD+QEFL  +LD LH++L+    +
Sbjct: 384 FGDTITKQGTNSSFGPNHFKSTVGHFNS-MFSGYLQQDSQEFLAFLLDSLHEDLN---RI 439

Query: 792 VN----EYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCG 847
           +N    E P+L   D+ N     K       K  +    S I  +F G  +++L+C  C 
Sbjct: 440 INKPSTEKPSLKEGDDYNDPAVIKSLADETWKMHLLRNDSVITDLFVGMYKSTLECPECT 499

Query: 848 NSSYNYSTFYVLSLAIPKPSSTTFSRSKRV 877
           N S  +  +  L+L  P P  +T+S   R+
Sbjct: 500 NVSITFDPYSDLTL--PLPVDSTWSSKVRI 527

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 57/122 (46%), Gaps = 25/122 (20%)

Query: 990  PPILVIHLSRF--YYDLTKKNNTVITYPLILNIVLKNNEVAK-------YRLYGIVNHSG 1040
            P +L+IHL RF      + K +  + +P I N+ +    V K       Y LY + NH G
Sbjct: 914  PDVLLIHLKRFENQRSFSDKIDATVNFP-IENLDMSPYLVHKDDPRGTVYDLYAVDNHYG 972

Query: 1041 NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFY 1100
             L  GHYT+ V    ++       +WYYFDD  V E     D +K +    S   Y+LFY
Sbjct: 973  GLGGGHYTAYVKNFIDN-------KWYYFDDSRVYE----TDPEKSV----SGSAYLLFY 1017

Query: 1101 ER 1102
             R
Sbjct: 1018 LR 1019

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 875 KRVKLEECINMFTSDEVLSGENAWDCPKC 903
           K + L +C+N+F+  EVL   ++W CP C
Sbjct: 870 KEITLNDCLNLFSKREVLGLNDSWYCPHC 898

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 103/208 (49%), Gaps = 11/208 (5%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSK-FPNTPKISNSFNLLFKK 736
           TGL NLGNTCY+NS LQCL      RD F+   ++  IN+         ++ +F+ L +K
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLGYHGYVARAFSDLVQK 423

Query: 737 MYLNGGC-----SVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN-QQE 790
           ++ N        +  P S  K+       +     QQD+QEFL  +LD LH++L+   ++
Sbjct: 424 LFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNRIIKK 483

Query: 791 VVNEYPNLLLYDE-NNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNS 849
              E P+L   D+ N+  V  K     ++ ++  N  S I  +F G  +++L C  C N 
Sbjct: 484 EYTEKPSLSPGDDVNDWNVVKKLADDTWEMHLKRN-CSVITDLFVGMYKSTLYCPECQNV 542

Query: 850 SYNYSTFYVLSLAIPKPSSTTFSRSKRV 877
           S  +  +  ++L  P P  T + ++ ++
Sbjct: 543 SITFDPYNDVTL--PLPVDTVWDKTIKI 568

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 54/122 (44%), Gaps = 25/122 (20%)

Query: 990  PPILVIHLSRF--YYDLTKKNNTVITYPLILNIVLKNNEVAK-------YRLYGIVNHSG 1040
            P IL+IHL RF      + K +  + +P I ++ L    V K       Y LY + NH G
Sbjct: 1004 PDILLIHLKRFESQRSFSDKIDATVNFP-ITDLDLSRYVVYKDDPRGLIYDLYAVDNHYG 1062

Query: 1041 NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFY 1100
             L  GHYT+ V    ++       +WYYFDD  V E      +        +   Y+LFY
Sbjct: 1063 GLGGGHYTAYVKNFADN-------KWYYFDDSRVTETAPENSI--------AGSAYLLFY 1107

Query: 1101 ER 1102
             R
Sbjct: 1108 IR 1109

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 102/215 (47%), Gaps = 29/215 (13%)

Query: 671 LYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNS 729
           L  S    GL NLGNTCY+NS LQCL     F + F+ + +Q  IN D+       ++N+
Sbjct: 407 LVPSTGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANA 466

Query: 730 FNLLFKKMYLNGGC------------SVVPTSFLKT---CNILRPDLRIPDDQQDTQEFL 774
           F  L  K++                 S  PT+F  T   CN +         QQD+QEFL
Sbjct: 467 FGKLIHKLFEERIIDNESEKSSFSINSFSPTNFKSTVGYCNSMFSGYL----QQDSQEFL 522

Query: 775 MIILDRLHDELSN-QQEVVNEYPNLLLYDEN----NLKVQNKEYKHWFDKNVIGNGLSPI 829
             ILD LH++L+   ++   E P+L    EN    + KV  K     ++ ++  N  S +
Sbjct: 523 AFILDGLHEDLNRILKKPFVEKPSL---PENSNYKDYKVIKKLADDTWEAHLKRND-SIV 578

Query: 830 DHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIP 864
             +F G  +++LQC  C N S  +  +  L+L +P
Sbjct: 579 TDLFVGMYKSTLQCPDCHNVSVTFDPYNDLTLPLP 613

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 56/121 (46%), Gaps = 23/121 (19%)

Query: 990  PPILVIHLSRF--YYDLTKKNNTVITYP-----LILNIVLKNNEVAK-YRLYGIVNHSGN 1041
            P IL+IHL RF      + K + V+ +P     L  +IV  + E +  Y L  + NH G 
Sbjct: 1112 PDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYDLIAVDNHYGG 1171

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYE 1101
            L  GHYT+ V            Q+WYYFDD  V    +  D  + I    S   Y+LFY 
Sbjct: 1172 LGGGHYTAYVK-------NFVDQKWYYFDDSRV----SLADPQRSI----SGSAYLLFYV 1216

Query: 1102 R 1102
            R
Sbjct: 1217 R 1217

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 25/46 (54%)

Query: 865  KPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
            K     F + K + L++C+ +F+  E+L  +++W CP C     +T
Sbjct: 1058 KREEQIFEKEKTILLDDCLRLFSKPEILGLQDSWYCPTCKDHRQAT 1103

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 98/200 (49%), Gaps = 8/200 (4%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
            GL NLGNTCY+NS LQCL      RD F    +++ IN D+       I+N+F+ L + 
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDNPLGFQGNIANAFSALVQN 457

Query: 737 MYLNG---GCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN-QQEVV 792
           +Y N      S  P+ F  T       +     QQD+QEFL  +LD LH++L+  + +  
Sbjct: 458 LYKNQFIPSASYAPSQFKLTIGHYN-QMFSGYFQQDSQEFLAFLLDGLHEDLNRIKDKPY 516

Query: 793 NEYPNLL-LYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSY 851
            E P+L    D N+  +  +      + ++  N    ID +F G  +++L+C  C + S 
Sbjct: 517 VEKPSLADGSDVNDYNIIARLAADTLEAHLKRNDSIIID-LFVGLYKSTLKCPVCNHVSI 575

Query: 852 NYSTFYVLSLAIPKPSSTTF 871
            +  +  L+L IP  S   F
Sbjct: 576 TFDPYCDLTLPIPVESVWNF 595

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 85/242 (35%), Gaps = 102/242 (42%)

Query: 873  RSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHN 932
              K + LE+ +N+F   EVL   ++W CPKC                             
Sbjct: 958  EEKNITLEDSLNLFERAEVLGINDSWYCPKC----------------------------- 988

Query: 933  EHHRYKSKFFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPI 992
            +HHR  SK   L                            W +              P I
Sbjct: 989  KHHRQASKQIQL----------------------------WST--------------PDI 1006

Query: 993  LVIHLSRFYYD--LTKKNNTVITYP-----LILNIVLKN-NEVAKYRLYGIVNHSGNLIS 1044
            L IHL RF      + K + V+ +P     L  +I+ K+ +++  Y L  + NH G L  
Sbjct: 1007 LTIHLKRFETQGSFSDKIDDVVDFPINGLDLSKHILDKSTSQLNIYDLIAVDNHYGGLGG 1066

Query: 1045 GHYTSLVNKEPNHDLGSKKQRWYYFDD----ETVKEERNHGDMDKGILQVSSRDVYVLFY 1100
            GHYT+ +    ++       +WYYFDD    ETV E    G              Y+LFY
Sbjct: 1067 GHYTAYIKNLIDN-------KWYYFDDSRVSETVPERSVAG------------SAYLLFY 1107

Query: 1101 ER 1102
             R
Sbjct: 1108 MR 1109

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 72.0 bits (175), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 106/209 (50%), Gaps = 13/209 (6%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSK-FPNTPKISNSFNLLFKK 736
           TGL NLGNTCY+NS LQCL      RD F+   +++ IN+         ++ +F+ L +K
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEENPLGYHGYVARAFSDLIQK 423

Query: 737 MYLNGGC-----SVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN--QQ 789
           ++ N           P S  K+       +     QQD+QEFL  +LD LH++L+   ++
Sbjct: 424 IFQNRLSVMQRNGAFPPSMFKSTVGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNRIIKK 483

Query: 790 EVVNEYPNLLLYDE-NNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGN 848
           E + E P+L   D+ ++  V  K     ++ ++  N  S I  +F G  +++L C  C N
Sbjct: 484 EYI-EKPSLSPGDDVDDWNVVKKLADDTWEMHLKRN-CSVITDLFVGMYKSTLYCPECKN 541

Query: 849 SSYNYSTFYVLSLAIPKPSSTTFSRSKRV 877
            S  +  +  ++L  P P  T ++++ ++
Sbjct: 542 VSITFDPYNDVTL--PLPVDTVWNKTVKI 568

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 55/121 (45%), Gaps = 23/121 (19%)

Query: 990  PPILVIHLSRF--YYDLTKKNNTVITYP-----LILNIVLKNNEVAK-YRLYGIVNHSGN 1041
            P IL+IHL RF      + K +  + +P     L  N+V K++     Y LY + NH G 
Sbjct: 1000 PDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSKNVVYKDDPRGSIYDLYAVDNHYGG 1059

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYE 1101
            L  GHYT+ V    N+       +WYYFDD  V E      +        +   Y+LFY 
Sbjct: 1060 LGGGHYTAYVKNFANN-------KWYYFDDSRVTETVPENSI--------AGSAYLLFYI 1104

Query: 1102 R 1102
            R
Sbjct: 1105 R 1105

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 71.6 bits (174), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 105/209 (50%), Gaps = 13/209 (6%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSK-FPNTPKISNSFNLLFKK 736
           TGL NLGNTCY+NS LQCL      RD F+ + ++  IN+         ++ +F+ L +K
Sbjct: 361 TGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENPLGYHGYVARAFSDLIQK 420

Query: 737 MYLNG------GCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN-QQ 789
           ++ N         +  PT F  T       +     QQD+QEFL  +LD LH++L+   +
Sbjct: 421 LFQNKLNIMQRNGAFPPTMFKSTIGHFNS-MFSGYMQQDSQEFLAFLLDSLHEDLNRIIK 479

Query: 790 EVVNEYPNLLLYDE-NNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGN 848
           +   E P+L   D+ N+  V  K     ++ ++  N  S I  +F G  +++L C  C +
Sbjct: 480 KAYIEKPSLSPDDDVNDWNVIKKLADDTWELHLKRNR-SVITDLFVGMYKSTLYCPECKD 538

Query: 849 SSYNYSTFYVLSLAIPKPSSTTFSRSKRV 877
            S  +  +  ++L  P P  T +S++ ++
Sbjct: 539 VSTTFDPYNDVTL--PLPVDTVWSKTVKI 565

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 55/122 (45%), Gaps = 25/122 (20%)

Query: 990  PPILVIHLSRF--YYDLTKKNNTVITYPLILNIVLKNNEVAK-------YRLYGIVNHSG 1040
            P IL+IHL RF      + K +  + +P I ++ L  + V K       Y LY + NH G
Sbjct: 1003 PDILLIHLKRFESQRSFSDKIDDTVNFP-ITDLDLSEHVVYKDDPRGSIYDLYAVDNHYG 1061

Query: 1041 NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFY 1100
             L  GHYT+ V    ++       +WYYFDD  V E      +        +   Y+LFY
Sbjct: 1062 GLGGGHYTAYVKNFMDN-------KWYYFDDSRVTETVPENSV--------AGSAYLLFY 1106

Query: 1101 ER 1102
             R
Sbjct: 1107 IR 1108

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 10/39 (25%), Positives = 22/39 (56%)

Query: 872 SRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
           ++ + + L +C+ +F+  E+L   ++W CP C     +T
Sbjct: 956 AKERTITLNDCLQLFSKPEILGLNDSWYCPTCKEHRQAT 994

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 100/193 (51%), Gaps = 8/193 (4%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPK--ISNSFNLLFK 735
           TGL NLGN+CY+NS LQCL      +D F+   ++  +N ++ P   K  ++ +F  L K
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVN-TQNPLGYKGLVAQAFAALIK 392

Query: 736 KMYLNGGCSVVPTSFLKTCNIL--RPDLRIPDDQQDTQEFLMIILDRLHDELSN-QQEVV 792
            ++     S    S  +  +I+  +  +     QQD+QEFL  +LD LH++L+   ++  
Sbjct: 393 SLFDERSSSAFAFSPREFKSIIGQQNSMFAGFLQQDSQEFLAFLLDGLHEDLNRIIEKPF 452

Query: 793 NEYPNLLL-YDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSY 851
            E P L    D NN +V ++     +DK+ + N  S I  +F G  +++L C  C  +S 
Sbjct: 453 VEKPELSPDEDVNNREVIHRLASKTWDKHKLRND-SVILDLFVGLYKSTLTCPVCDKTSV 511

Query: 852 NYSTFYVLSLAIP 864
            +  +  L+L +P
Sbjct: 512 TFDPYSDLTLPLP 524

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 85/239 (35%), Gaps = 94/239 (39%)

Query: 875  KRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEH 934
            +R+ L +C+ +F+  EVLS  ++W CP C                               
Sbjct: 901  RRISLFDCLKLFSKPEVLSAADSWYCPTC-----------------------------RE 931

Query: 935  HRYKSKFFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILV 994
            HR  +K   L                            W S  ++TI             
Sbjct: 932  HRQATKQIQL----------------------------WNSPDILTI------------- 950

Query: 995  IHLSRF--YYDLTKKNNTVITYPLI-LN----IVLKNNEVAK-YRLYGIVNHSGNLISGH 1046
             HL RF   +  + K + V+ +P+  LN    +V ++ E    Y L  + NH G L  GH
Sbjct: 951  -HLKRFESRHSFSDKISDVVDFPICGLNMSDHLVCEDAEQNNLYDLVAVDNHYGGLGGGH 1009

Query: 1047 YTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105
            YT+   K P         +WYYFDD  V E     D +  +    S   Y+LFY R  E
Sbjct: 1010 YTAFA-KNP------VDGKWYYFDDSRVSE----TDPETSV----SGAAYLLFYRRRVE 1053

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 68.6 bits (166), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 97/202 (48%), Gaps = 18/202 (8%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFNLLFKK 736
            GL NLGNTCY+NS LQCL     F+D F+ + ++  IN D+   +   I+ +F  L + 
Sbjct: 349 VGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEINVDNPLGHKGHIAWAFGTLIQS 408

Query: 737 MYL---NGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVN 793
           ++    N   S  P  F  T   L   +     QQD+QEFL  +LD LH++L+    +V+
Sbjct: 409 LFGKRNNLISSYSPRHFKTTIGHLN-SMFAGYQQQDSQEFLAFLLDGLHEDLN---RIVD 464

Query: 794 ----EYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGL---SPIDHIFSGQMENSLQCQRC 846
               E P L   D+     + +  K   D   + + L   S I  +F G  +++L C  C
Sbjct: 465 KPYVEKPELNPTDD---VTEFETIKKLADDTWLKHKLRNDSVILDLFVGLYKSTLICPTC 521

Query: 847 GNSSYNYSTFYVLSLAIPKPSS 868
              S  +  +  L+L +P  S+
Sbjct: 522 KKVSTTFDPYNDLTLPLPVDST 543

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 58/128 (45%), Gaps = 31/128 (24%)

Query: 990  PPILVIHLSRF--YYDLTKKNNTVITYPLI-LN----IVLKNNEVAK-YRLYGIVNHSGN 1041
            P IL+IHL RF      + K   ++ +P+  L+    +V K+++    Y L  + NH G 
Sbjct: 979  PDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKDDKKGTIYDLIAVDNHYGG 1038

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDD----ETVKEERNHGDMDKGILQVSSRDVYV 1097
            L  GHYT+ V    ++       +WYYFDD    ETV E    G              Y+
Sbjct: 1039 LGGGHYTAYVKNFLDN-------KWYYFDDSRVNETVPERSIAG------------SAYL 1079

Query: 1098 LFYERIYE 1105
            LFY R  E
Sbjct: 1080 LFYRRRTE 1087

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 22/36 (61%)

Query: 875 KRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST 910
           K++ L +C+ +F++ EVL   ++W CP C     +T
Sbjct: 935 KKITLHDCLTLFSTPEVLGATDSWYCPSCKEHRQAT 970

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 97/201 (48%), Gaps = 20/201 (9%)

Query: 676 SITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN-DSKFPNTPKISNSFN-LL 733
            I GL NLGNTCY+NS LQCL       + F+   ++  IN ++   +   ++++F  LL
Sbjct: 337 GIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDVAHAFGHLL 396

Query: 734 FKKMYLNGGCSV--VPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN--QQ 789
           +     + G S    P +F  T       L     QQD+QEFL  +LD LH++L+   ++
Sbjct: 397 YSLFAPSYGQSTFYAPRNFKNTIGHYN-SLFAGYGQQDSQEFLAFLLDGLHEDLNRVIEK 455

Query: 790 EVVN--EYPNLLLYDENN----LKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQC 843
             VN  E+PN    D+ +    L     +Y    + +VI +       +F G  +++L C
Sbjct: 456 PYVNKPEFPNDGQIDDTDQIVLLAANMWDYIKKRNDSVIMD-------LFVGLYKSTLVC 508

Query: 844 QRCGNSSYNYSTFYVLSLAIP 864
             C + S  +  +  L+L +P
Sbjct: 509 PNCNHVSITFDPYNDLTLPLP 529

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 52/121 (42%), Gaps = 23/121 (19%)

Query: 990  PPILVIHLSRF--YYDLTKKNNTVITYP---LILNIVL---KNNEVAKYRLYGIVNHSGN 1041
            P IL+IHL RF      + K +  + +P   L ++  L   K  E   Y L  + NH G 
Sbjct: 944  PDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDVYDLIAVDNHYGG 1003

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYE 1101
            L  GHYT+      N   G    +WYYFDD  V E      +        +   Y+LFY 
Sbjct: 1004 LGGGHYTAYCR---NFIDG----KWYYFDDSRVNEVSPENSI--------AGSAYLLFYR 1048

Query: 1102 R 1102
            R
Sbjct: 1049 R 1049

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 877 VKLEECINMFTSDEVLSGENAWDCPKC 903
           + L+ C+ +F+  E+L   ++W CP C
Sbjct: 902 ITLDSCLRLFSQPEILGSADSWYCPNC 928

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 62.0 bits (149), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 90/207 (43%), Gaps = 22/207 (10%)

Query: 674 SLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIND-SKFPNTPKISNSFNL 732
           S    GL NLG+TC+INS+LQCL      RD F+ + F + +N  +      +++ +F  
Sbjct: 347 SSGTMGLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELNTRNSLGYGGRVAGAFAE 406

Query: 733 LFKKMYLNGGCSVVPT----SFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDEL--- 785
           + + ++ +   +  PT    +F  T    RP L  P  QQD+ E +  +L  LH++L   
Sbjct: 407 VVQALFGD-KIAQFPTYAASNFRATIGYFRPALG-PYVQQDSHEVVAFLLGALHEDLNRA 464

Query: 786 --------SNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQM 837
                   + +   V           N  + +      W    +  +  S I  +F+G +
Sbjct: 465 PEGPRVGQAGESTGVGASVGASAGTRNRGRGERLAADTWSRYKLQND--SVITDLFAGML 522

Query: 838 ENSLQCQRCGNSSYNYSTFYVLSLAIP 864
           +++L C  C  SS  +       LA+P
Sbjct: 523 KSTLTCLTCRRSSVTFDP--CTELAVP 547

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 53/130 (40%), Gaps = 32/130 (24%)

Query: 990  PPILVIHLSRF--YYDLTKKNNTVITYPLI---------------LNIVLKNNEVAKYRL 1032
            P IL++HL RF  +Y  T K N  + +PL                            Y L
Sbjct: 975  PEILLVHLKRFESHYSSTGKLNNTVHFPLTGLDMSPHLPCRDGDGDGDGDDGGRENVYDL 1034

Query: 1033 YGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSS 1092
              + NH G L SGHYT+ V K P  D      +WY FDD  V+E             V+S
Sbjct: 1035 IAVDNHFGGLGSGHYTAYV-KNPVDD------KWYLFDDSEVREVDAE--------SVAS 1079

Query: 1093 RDVYVLFYER 1102
               Y+LFY R
Sbjct: 1080 SFGYLLFYRR 1089

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 4/35 (11%)

Query: 873 RSKRVK----LEECINMFTSDEVLSGENAWDCPKC 903
           R+ R K    LE+C+++FT+ EVL+  ++W CP C
Sbjct: 925 RAGRQKQETTLEDCLDLFTAPEVLNTADSWYCPAC 959

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 68/139 (48%), Gaps = 22/139 (15%)

Query: 974  KSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTV-----ITYPLILNIVLK-NNEV 1027
            ++++L+ +K L     P  L +HL RF Y   K+N  +     I YPL LN+    N+EV
Sbjct: 548  EAERLVGLKQL-----PDTLALHLKRFKYS-EKQNCNIKLFNNIRYPLTLNVCSSINSEV 601

Query: 1028 A-KYRLYGIVNH-SGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDK 1085
              KY+L GIV H  G    GHY SL   E        K  W  FDDETV+  +    ++ 
Sbjct: 602  CQKYQLAGIVVHMGGGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEF 653

Query: 1086 GILQVSSRDVYVLFYERIY 1104
                 +    YVLFY+ ++
Sbjct: 654  TGESPNMATAYVLFYKAMH 672

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRD 704
           + G  N GNTCY NS+LQCL+     R+
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSLRE 167

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
            YBL067C (REAL)
          Length = 745

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 66/138 (47%), Gaps = 22/138 (15%)

Query: 974  KSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTV-----ITYPLILNIVLK-NNEV 1027
            ++++L+ +K L     P  L +HL RF Y   K+N  +     I YPL LN+    N+EV
Sbjct: 545  EAERLVGLKQL-----PDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSEV 598

Query: 1028 A-KYRLYGIVNH-SGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDK 1085
              KY L GIV H  G    GHY SL   +        K  W  FDDETV+  +    ++ 
Sbjct: 599  CQKYELAGIVVHMGGGPQHGHYVSLCKHQ--------KFGWLLFDDETVEAVKEETVLEF 650

Query: 1086 GILQVSSRDVYVLFYERI 1103
                 +    YVLFY+ +
Sbjct: 651  TGESANMATAYVLFYKAV 668

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRD 704
           + G  N GNTCY NS+LQCL+     R+
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLRE 166

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
            YPL072W
          Length = 494

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 91/394 (23%), Positives = 157/394 (39%), Gaps = 99/394 (25%)

Query: 678  TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFN--LLFK 735
            TGL N GN C+INS +Q L          +++   + + D K  +T  + N     LL  
Sbjct: 76   TGLVNPGNDCFINSSIQALVPLDK-----LTTYLSATLEDEKTASTLPLHNGLATMLLEL 130

Query: 736  KMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEY 795
            +   +   SV    F++    +    +I   Q D  EF  +IL+RL++E           
Sbjct: 131  QQLRSDPKSVSSKRFIQQLETIFGG-KISRQQNDAHEFTQLILERLNEE----------- 178

Query: 796  PNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSY-NYS 854
             NL L D  +L V                        F G + N L C +CG +S+ N  
Sbjct: 179  -NLTL-DHADLTVP-----------------------FKGIVGNHLVCLQCGRTSHVNEQ 213

Query: 855  TFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSA------- 907
             FY+  L +P+  S        VKL + +N    +++ + EN + C  C + A       
Sbjct: 214  PFYIYELTLPQQGS--------VKLSDLVN---GEQMETIEN-YSCMYCKTVAMLTNERE 261

Query: 908  -SSTISDSEKLLNVTSSKKKNMSS---HNEHHRYKSKFFTLHTRSHRSISPFRKKTSPAA 963
              S +S ++  LN+    K  +S+   + E   + + +   + + + + S  +       
Sbjct: 262  EKSNVSRTDAELNILKFLKGKLSTLLINEELPEHITHYINSYNKGYCNTSEIKS------ 315

Query: 964  VPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLT--KKNNTVITYP---LIL 1018
                           + ++   F   P I +IHLSR  ++     +N   + +    L+ 
Sbjct: 316  ---------------VIVRKSTFAEFPEIFLIHLSRSVFNGMNYSRNPCQVEFEEEILLP 360

Query: 1019 NIVLKNN-----EVAKYRLYGIVNHSGNLISGHY 1047
              +LK++     E  KY+L  IV H+G+   GHY
Sbjct: 361  RQILKDHQCVGFETVKYKLKSIVKHTGSHYQGHY 394

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 65/139 (46%), Gaps = 22/139 (15%)

Query: 974  KSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTV-----ITYPLILNIV--LKNNE 1026
            ++++L+ +K L     P  L +HL RF Y   K+N  +     I YPL LN+   + +  
Sbjct: 545  EAERLVGLKQL-----PDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSKV 598

Query: 1027 VAKYRLYGIVNH-SGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDK 1085
              KY L GIV H  G    GHY SL   E        K  W  FDDETV+  +    ++ 
Sbjct: 599  CQKYELAGIVVHMGGGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEF 650

Query: 1086 GILQVSSRDVYVLFYERIY 1104
                 +    YVLFY+ +Y
Sbjct: 651  TGESPNMATAYVLFYKAMY 669

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRD 704
           + G  N GNTCY NS+LQCL+     R+
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLRE 166

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 58/129 (44%), Gaps = 15/129 (11%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTKKNN----TVITYPLILNIV--LKNNEVAKYRLYGI 1035
            +++    LP  L +HL RF Y  TK +N      + YPL L++     N+   KY L GI
Sbjct: 604  RSVGLKQLPHTLALHLKRFKYSETKNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSGI 663

Query: 1036 VNH-SGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRD 1094
            V H  G    GHY SL     N + G     W  FDDETV+       +D      +   
Sbjct: 664  VVHMGGGPQHGHYVSLCK---NDNFG-----WLLFDDETVESVSEKTVLDFVGDSSTLTT 715

Query: 1095 VYVLFYERI 1103
             YVLFY  +
Sbjct: 716  AYVLFYREL 724

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFR 703
           + G  N GNTCY NS+LQCL+    FR
Sbjct: 130 VFGFENFGNTCYCNSVLQCLYNMTEFR 156

 Score = 35.8 bits (81), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 49/136 (36%), Gaps = 34/136 (25%)

Query: 768 QDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLS 827
           QD  EFL  +L+ L D                 Y  N  K    + +H          L+
Sbjct: 495 QDAHEFLNFLLNELSD-----------------YLNNGAKSGKDDEEH---------SLN 528

Query: 828 PIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFT 887
            I  IF G + N ++C  C N +     F    + +P  S T         ++  +  F 
Sbjct: 529 FIKDIFQGTLTNRVKCFTCDNITSRDEPFLDFPIEVPDDSET--------DIQALLQNFD 580

Query: 888 SDEVLSGENAWDCPKC 903
             E+LSG N + C  C
Sbjct: 581 QREMLSGPNKFYCNVC 596

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 113/270 (41%), Gaps = 57/270 (21%)

Query: 657 SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
           S + SIPT+ ++  L       GL N+G+TCY++S+LQCL    LF DL +     ++  
Sbjct: 122 SNETSIPTLTQAHGL------KGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNY-- 173

Query: 717 DSKFPNTPK-ISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDD-----QQDT 770
             K  +  K +S + + +  + Y  G     P   L   +IL    R+  +     QQD 
Sbjct: 174 -CKIQDPMKCMSCAIDNIISETY--GNKKTTPNEGLV--DILNCSWRVNKNLAGYTQQDA 228

Query: 771 QEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPID 830
            EFL  IL+++H++                Y  N +   NK+  +  D   + NG S  +
Sbjct: 229 HEFLQFILNQMHND----------------YKLNEIHDTNKQEMNGTDFKTMVNGNSSKE 272

Query: 831 H----------IFSGQMENSLQCQRC-GNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKL 879
           H          IF G +++ + C  C   S      +  LSL +   S+          L
Sbjct: 273 HLHLCNCLPHTIFQGFLKSIISCSECKAQSQTTIDPYMDLSLDVKGKST----------L 322

Query: 880 EECINMFTSDEVLSGENAWDCPKCGSSASS 909
            EC+  F   E L  +  ++C KC  S  +
Sbjct: 323 YECLESFHRTERLH-DFTYNCKKCNKSQDA 351

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 54/141 (38%), Gaps = 38/141 (26%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTK---KNNTVITYPLILNI------------------ 1020
            + L+ + L PI+VI L RF + +T    K N  + +PL LN+                  
Sbjct: 353  RQLSILKLAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPTPDTDPTNLNE 412

Query: 1021 -VLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERN 1079
               K+     Y L GIV H G +  GHY +           +    WY F+D  V     
Sbjct: 413  KTNKSTPDMIYELTGIVTHRGTVNEGHYITYTK--------TADGVWYQFNDSVV----- 459

Query: 1080 HGDMDKGILQVSSRDVYVLFY 1100
               M   + Q+     Y+L Y
Sbjct: 460  ---MKVPLEQMLKEQAYLLIY 477

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 66/137 (48%), Gaps = 20/137 (14%)

Query: 974  KSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNT----VITYPLILNIVLK-NNEVA 1028
            ++++L+ +K+L     P  L +HL RF Y   K  N      I YPLILN     ++ V+
Sbjct: 554  EAERLVGLKSL-----PKTLSLHLKRFKYSEEKNANVKLFNKIHYPLILNASSTFDSSVS 608

Query: 1029 K-YRLYGIVNHSGNLI-SGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKG 1086
            K YRL G+V H GN    GHY SL + E     G     W  FDDETV+       +D  
Sbjct: 609  KSYRLQGVVVHMGNGPHHGHYVSLCHTEL---FG-----WLLFDDETVESVDESYVLDFV 660

Query: 1087 ILQVSSRDVYVLFYERI 1103
                S    YVLFY  I
Sbjct: 661  GSHESPTTAYVLFYSEI 677

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFR 703
           + G  N GNTCY NS+LQCL+    FR
Sbjct: 160 VFGYENFGNTCYCNSVLQCLYHLPEFR 186

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
            YBL067C (REAL)
          Length = 748

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 67/139 (48%), Gaps = 22/139 (15%)

Query: 974  KSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTV-----ITYPLILNIVLK-NNEV 1027
            ++++L+ +K L     P  L +HL RF Y   K+N  +     I YPL LN+    N+EV
Sbjct: 547  EAERLVGLKQL-----PDTLALHLKRFKYS-EKQNCNIKLFNDIHYPLTLNVCSSINSEV 600

Query: 1028 A-KYRLYGIVNH-SGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDK 1085
              KY L GIV H  G    GHY SL      H++      W  FDDETV+  +    ++ 
Sbjct: 601  CQKYELSGIVVHMGGGPQHGHYVSLC----KHEIFG----WLLFDDETVEAVKEEAVLEF 652

Query: 1086 GILQVSSRDVYVLFYERIY 1104
                 +    YVLFY+  Y
Sbjct: 653  TGESPNMATAYVLFYKTKY 671

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRD 704
           + G  N GNTCY NS+LQCL+     R+
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSVRE 167

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 85/227 (37%), Gaps = 55/227 (24%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            G RN G TCY+NS+LQ  F T+ FR L           + + PN     +S  L  ++ 
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVY-----GIPTNGENPN-----DSVPLALQRA 253

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPN 797
           +     S  P   L+       D      Q D QE   I++DRL                
Sbjct: 254 FYQLQVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDRL---------------- 297

Query: 798 LLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFY 857
                EN +K  N E K              ++ IF G+M++ ++C+     S     F+
Sbjct: 298 -----ENRMKGTNVEGK--------------LNEIFVGKMKSYIRCKNVDYESSRVEDFW 338

Query: 858 VLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCG 904
            + L +    S          L+E    +   E+++GEN +  P  G
Sbjct: 339 DIQLNVKNFKS----------LQESFENYIEVELMNGENQYAAPDFG 375

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 52/105 (49%), Gaps = 19/105 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYD-----LTKKNN------TVITYPLILNIVLKNNEVAK- 1029
            K + F   P +L + L RF YD     L K N+       +   P +   +LK     K 
Sbjct: 381  KGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKN 440

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y+L+G++ H+G++ +GHY +++         + + +WY FDDE V
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKP-------TLEDQWYRFDDEKV 478

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
            Anc_8.540 YPL072W
          Length = 482

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 93/397 (23%), Positives = 155/397 (39%), Gaps = 92/397 (23%)

Query: 678  TGLRNLGNTCYINSMLQCLFATRLFRDLFISS-KFQSFINDSKFPNTPKISNSFNLLFKK 736
            TGL N GN C+INS LQ L  ++ F     S  +   F+N+    N  +  N + L   +
Sbjct: 69   TGLINKGNDCFINSSLQGLAGSQRFNHYLNSVLRCLKFLNE----NPKQEGNRYALPLHQ 124

Query: 737  MYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYP 796
            +       +   +FL T              + + + ++ +      ++S +Q    E+ 
Sbjct: 125  VMAEFIYDLQAPTFLNTV-------------ESSDKIIVTMESIFKQKMSRRQNDAQEFT 171

Query: 797  NLLLYDENNLKVQNKEYKHWFD-KNVIGNGLSPIDHIFSGQMENSLQCQRCG-NSSYNYS 854
             LL      L+V + EY+      N I N L    + F G+  + L C +CG NS     
Sbjct: 172  QLL------LEVLHNEYQELIRLMNFITNNLDIPTYPFEGKYCHELTCLKCGRNSEVKMF 225

Query: 855  TFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGEN-----AWDCPKCGSSASS 909
             F +L+L +P   S +                  DE++SG N      + C  C  SA  
Sbjct: 226  DFDILTLNLPAQPSISL-----------------DELISGSNSDVIEGFSCTVCKVSA-- 266

Query: 910  TISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTSPAAVPSSTK 969
                   +L  T +   N  S                +S + I P  K  +    P ++ 
Sbjct: 267  -------ILGGTGTHNPNTRS--------------LIKSLKEIFPELKINTELDEPLNSF 305

Query: 970  NEPWKSKKLIT-------IKTLNFIVLPPILVIHLSRFYYDLTK--KNNTVITY------ 1014
             + +    +IT       +K   F+ +P IL+IHL+R  ++     +N   I Y      
Sbjct: 306  VDSYSHDGVITRNIKSTIVKKTVFVEVPDILLIHLTRSMFNGMSYTRNACKIAYDEKLLL 365

Query: 1015 --PLILN--IVLKNNEVAKYRLYGIVNHSGNLISGHY 1047
               L+++   V++NN   +Y L   + HSG+   GHY
Sbjct: 366  EHQLVMDGVSVMRNN--IQYTLSSAIKHSGSHSMGHY 400

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 75/196 (38%), Gaps = 53/196 (27%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            GL NLGN+CY+NS+LQCLF   + +   +    Q F  D  +P     +N+F     K 
Sbjct: 323 CGLINLGNSCYLNSVLQCLFNGGV-KGWSLKGLGQDFPQDVLYP-----TNNFKCQLIK- 375

Query: 738 YLNGGCSVVPTSF--------LKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQ 789
            LN    V P ++         K C     +      QQD+ EFL  ++D L        
Sbjct: 376 -LNNAMKVEPQNYPEGIRPKSFKKCVGQSHEEFSSGRQQDSMEFLGYLVDVL-------- 426

Query: 790 EVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNS 849
                                       DK +  NG +P D +    ME+ LQC  CG  
Sbjct: 427 ----------------------------DKKIFKNGSNPND-LMKFTMEDRLQCTNCGKV 457

Query: 850 SYNYSTFYVLSLAIPK 865
            Y+      L L +P+
Sbjct: 458 KYSSEAAESLQLPMPE 473

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 1028 AKYRLYGIVNHSGNLI-SGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            A Y L GIV H GN + SGHY + + +     +   +++W  ++DE +
Sbjct: 711  APYELTGIVCHKGNSVHSGHYVAFIRQ-----IVENEKKWVLYNDEKI 753

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 59/122 (48%), Gaps = 15/122 (12%)

Query: 989  LPPILVIHLSRFYYDLTKKNN----TVITYPLIL--NIVLKNNEVAKYRLYGIVNHSGNL 1042
            LP  L++HL RF Y   + +N    + + YPLIL  N   K  +  KY L GIV H G+ 
Sbjct: 518  LPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGIVIHVGDG 577

Query: 1043 IS-GHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYE 1101
               GHY +L   E        K  W ++DDETV+       +     + +    YVLFY+
Sbjct: 578  PQMGHYVALCKTE--------KYGWLFYDDETVESVSEETVLKFIGDEKTQSTAYVLFYK 629

Query: 1102 RI 1103
            ++
Sbjct: 630  KL 631

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 35/77 (45%), Gaps = 8/77 (10%)

Query: 829 IDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTS 888
           I+ IF G + N ++C  C N +     F  L + + +   T   R         +  ++ 
Sbjct: 437 INEIFQGTLTNKVRCLTCDNVTSREEAFLDLPIEVKENGDTDIQR--------VLKYYSQ 488

Query: 889 DEVLSGENAWDCPKCGS 905
            E+L+G N ++C +C +
Sbjct: 489 REMLNGSNKFNCSQCCA 505

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFR 703
           + G  N GNTCY NS+LQCL+    FR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNLPEFR 151

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 89/230 (38%), Gaps = 61/230 (26%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLF--ISSKFQSFINDSKFPNTPKISNSFNLLFK 735
            G RN G TCY+NS+LQ  F T+ FR L   I ++ +S       PN     NS  L  +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHES-------PN-----NSVPLALQ 252

Query: 736 KMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEY 795
           + +     S +P   L+       D      Q D QE   I++DRL              
Sbjct: 253 RAFYQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRL-------------- 298

Query: 796 PNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYST 855
                  ENN+K    E K              ++ IF G+M++ ++C      S     
Sbjct: 299 -------ENNMKGTPVEGK--------------LNEIFVGKMKSYIKCINVDYESARVED 337

Query: 856 FYVLSLAIPKPSSTTFSRSKRVK-LEECINMFTSDEVLSGENAWDCPKCG 904
           F+ L L +           K  K L+E  + +   E+++GEN +     G
Sbjct: 338 FWDLQLNV-----------KNFKNLQESFDNYIEMELMNGENQYAAQDYG 376

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 26/112 (23%)

Query: 982  KTLNFIVLPPILVIHLSRFYYD-----LTKKNN------TVITYPLILNIVLKNNEVAK- 1029
            K + F   PP+L + L RF YD     + K N+      T+   P +   VLK    ++ 
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSEN 441

Query: 1030 -------YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
                   Y L+G++ HSG++ +GHY +L+        G + Q WY FDDE V
Sbjct: 442  KDKNPYVYNLHGVLVHSGDISTGHYYTLIKP------GVEDQ-WYRFDDERV 486

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 57/124 (45%), Gaps = 15/124 (12%)

Query: 989  LPPILVIHLSRFYYDLTKKNN----TVITYPLILNIVLKNNEVA--KYRLYGIVNH-SGN 1041
            LP IL +HL RF Y   +  N      ITYPL L +  K +     KY L G+V H  G 
Sbjct: 548  LPRILALHLKRFKYSEAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGGG 607

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYE 1101
               GHY S+   +   + G     W +FDDETV+       ++      +S   YVLFY+
Sbjct: 608  PQHGHYVSVCKTD---NFG-----WLFFDDETVETLDEPQVLNFTGDTTTSTTAYVLFYK 659

Query: 1102 RIYE 1105
               E
Sbjct: 660  ETDE 663

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 19/28 (67%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRD 704
           I G  N GNTCY NS+LQCLF    FR+
Sbjct: 113 IFGYENFGNTCYCNSILQCLFNLTEFRN 140

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 88/230 (38%), Gaps = 61/230 (26%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLF--ISSKFQSFINDSKFPNTPKISNSFNLLFK 735
            G RN G TCY+NS+LQ  F T+ FR L   I ++ +S       PN     NS  L  +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHES-------PN-----NSVPLALQ 252

Query: 736 KMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEY 795
           + +     S +P   ++       D      Q D QE   I++DRL              
Sbjct: 253 RAFYQLQVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRL-------------- 298

Query: 796 PNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYST 855
                  ENN+K    E K              +  IF G+M++ ++C      S     
Sbjct: 299 -------ENNMKGTPVEGK--------------LSEIFVGKMKSYIKCVNVDYESARVED 337

Query: 856 FYVLSLAIPKPSSTTFSRSKRVK-LEECINMFTSDEVLSGENAWDCPKCG 904
           F+ L L +           K  K L+E  + +   E+++GEN +     G
Sbjct: 338 FWDLQLNV-----------KNFKNLQESFDNYIEMELMNGENQYAAQDYG 376

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 26/112 (23%)

Query: 982  KTLNFIVLPPILVIHLSRFYYD-----LTKKNN------TVITYPLILNIVLKNNEVAK- 1029
            K + F   PP+L + L RF YD     + K N+      T+   P +   VLK +  +  
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGD 441

Query: 1030 -------YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
                   Y L+G++ HSG++ +GHY +L+        G + Q WY FDDE V
Sbjct: 442  KSRNPYVYNLHGVLVHSGDISTGHYYTLIKP------GVEDQ-WYRFDDERV 486

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 89/230 (38%), Gaps = 61/230 (26%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLF--ISSKFQSFINDSKFPNTPKISNSFNLLFK 735
            G RN G TCY+NS+LQ  F T+ FR L   I ++ +S       PN     NS  L  +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHES-------PN-----NSVPLALQ 252

Query: 736 KMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEY 795
           + +     S +P   L+       D      Q D QE   I++DRL              
Sbjct: 253 RAFYQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRL-------------- 298

Query: 796 PNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYST 855
                  ENN+K    E K              ++ IF G+M++ ++C      S     
Sbjct: 299 -------ENNMKGTPVEGK--------------LNEIFVGRMKSYIKCINVDYESSRVED 337

Query: 856 FYVLSLAIPKPSSTTFSRSKRVK-LEECINMFTSDEVLSGENAWDCPKCG 904
           F+ L + +           K  K L+E  + +   E+++GEN +     G
Sbjct: 338 FWDLQMNV-----------KNFKNLQESFDNYIEMELMNGENQYAAQDYG 376

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 53/111 (47%), Gaps = 25/111 (22%)

Query: 982  KTLNFIVLPPILVIHLSRFYYD-----LTKKNN------TVITYPLILNIVLK------- 1023
            K + F   PP+L + L RF YD     + K N+      T+   P +   VLK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGD 441

Query: 1024 NNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            N     Y L+G++ HSG++ +GHY +L+        G + Q WY FDDE V
Sbjct: 442  NGNPYIYNLHGVLVHSGDISTGHYYTLIKP------GVEDQ-WYRFDDERV 485

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
            (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 92/393 (23%), Positives = 158/393 (40%), Gaps = 69/393 (17%)

Query: 678  TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPK-ISNSFNLLFKK 736
            TGL N    CY NS +Q L +   F  ++++     F  + K     K    +F+    K
Sbjct: 66   TGLVNTSTECYANSSVQVLASLSNF-TIYLNKVISIFELELKIEKVEKDAKEAFDTYLYK 124

Query: 737  MYLNGGCSVVPTSFLKTCNILRPDLRIPDD---QQDTQEFLMIILDRLHDELSNQQEVVN 793
                    V+P  +   C +L  DL+   D   ++    F+ I+   +H  ++  Q+  N
Sbjct: 125  --------VIPVHY-ALCQLL-ADLQELIDRPRERSVSNFIRILEASIHKRITGGQQDAN 174

Query: 794  EYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSY-N 852
            E   ++L    N     K+Y +  + ++           F G++ + L C  CG +S  N
Sbjct: 175  ELTQIVLEVLQNELESLKKYVNRMELSI-----EVPRFPFEGKLASYLSCLNCGQTSIPN 229

Query: 853  YSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTIS 912
             STF +L +  P+  S         +LEE I     D++      + C  C ++A   I 
Sbjct: 230  ISTFNILPIQTPQEYSA--------ELEEIIYGNQIDQITD----YSCLVCQTNA---IL 274

Query: 913  DSEKLLNVTSSKKKNMSSHNEHHRYKSKFF-------TLHTRSHRSISPFRKKTSPAAVP 965
             +EK    T+  K N +  +E  +Y             L +++   I  + K    +   
Sbjct: 275  KNEK----TNGHKGNTTDEHEIVKYLEDVLPVLRINEELDSKTLNYIKYYNKYGMKSGNI 330

Query: 966  SSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYD--LTKKNNTVITYPLILNIVLK 1023
             ST            IK  + I  P IL+IHLSR  Y+  +  +N+  + +   ++I  +
Sbjct: 331  KST-----------IIKKNSIIETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSIERQ 379

Query: 1024 NN---------EVAKYRLYGIVNHSGNLISGHY 1047
                       E+  Y+L  I+ H+G   SGHY
Sbjct: 380  TTDEKNENLKIELVDYQLQSIIKHTGTHNSGHY 412

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 96/242 (39%), Gaps = 63/242 (26%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRL--FRDLFISSKFQSFINDSKFPNTP------KISNS 729
            G  NLGN+CY+NS+LQCLF   +  +  L  +     F  D  +P T       KI N+
Sbjct: 333 CGFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYPTTNLKCQLIKILNA 392

Query: 730 FNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQ 789
           F  L  + Y  G   + P SF         + +  ++QQD  EFL  +L++L   L  + 
Sbjct: 393 FK-LNPENYPEG---IKPQSFKNYVGQSNKEFK-SNNQQDATEFLTFLLEQLEKTLFKK- 446

Query: 790 EVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNS 849
              +  PN                                 +I    ME+ +QCQ CGN 
Sbjct: 447 ---DNNPN---------------------------------NIMKFIMEDKIQCQSCGNV 470

Query: 850 SYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENA-WDCPKCGSSAS 908
            Y+Y     + L +        + + +  +E   N F      +GEN  +DCP C  +  
Sbjct: 471 KYSYEPTEYIQLPLDG------TNNPQNLVETLTNFF------NGENIDFDCPTCKKTVV 518

Query: 909 ST 910
           +T
Sbjct: 519 AT 520

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 14/84 (16%)

Query: 1020 IVLKNNEVAKYRLYGIVNHSGNLI-SGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEER 1078
            I+  N +   YRL  +V H GN   SGHY + + K  + +L     +W  ++DE +    
Sbjct: 724  IIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDEL-----KWVLYNDEKIVVSD 778

Query: 1079 NHGDMDKGILQVSSRDVYVLFYER 1102
            N  ++ K        D Y+ FY R
Sbjct: 779  NIDEIKK--------DGYIYFYSR 794

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 65/143 (45%), Gaps = 24/143 (16%)

Query: 970  NEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNN----TVITYPLILNI--VLK 1023
            NE  ++++LI IK L     P  LV+HL RF Y   K  N      + YP  LNI  V  
Sbjct: 526  NEYQEAERLIGIKEL-----PKHLVVHLKRFKYCEEKNCNIKLFNKVNYPFTLNISSVFD 580

Query: 1024 NNEVAKYRLYGIVNHSGNLIS-GHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGD 1082
            ++   KY L  IV H G     GHY +L           K   W  +DDETV+   +  +
Sbjct: 581  DSISKKYELNSIVVHIGESPQLGHYVTLCKH--------KSYGWLIYDDETVQAVSD--E 630

Query: 1083 MDKGILQVSSRD--VYVLFYERI 1103
            +   IL    R    Y+LFYE +
Sbjct: 631  LVSRILNNEQRSATAYLLFYEEV 653

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 21/39 (53%)

Query: 670 NLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFIS 708
           N  V   + G +N G TCY NS+LQ LF    FRD  I 
Sbjct: 98  NYDVGERVFGFQNFGYTCYCNSILQALFNIGSFRDGIIG 136

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 19/105 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTK----KNNTVITYPLILNI--------VLKNNEVAK 1029
            K + F   PPIL + L RF YD       K N    +P  +++        + +N E  K
Sbjct: 384  KGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCK 443

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y L+G++ H+G++ +GHY +++      DL   + +WY FDDE V
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKP----DL---QDQWYRFDDEKV 481

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 91/240 (37%), Gaps = 63/240 (26%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            G RN G TCY+NS+LQ  F T+ FR L           +++ PN     +S  L  ++ 
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLVY-----QIPTENESPN-----DSVPLALQRA 256

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPN 797
           +     S +P   L+       D      Q D QE   I++DRL                
Sbjct: 257 FYQLQVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRL---------------- 300

Query: 798 LLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFY 857
                EN +K    E K              ++ +F G+M++ ++C      S     F+
Sbjct: 301 -----ENRMKGTPVEGK--------------LNELFVGKMKSYIKCINVDYESSRVEDFW 341

Query: 858 VLSLAIPKPSSTTFSRSKRVK-LEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEK 916
            L L +           K +K LEE    +   E+++GEN +     G      + D+EK
Sbjct: 342 DLQLNV-----------KNLKGLEESFKNYIEIELMNGENQYAAQDFG------LQDAEK 384

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 94/393 (23%), Positives = 164/393 (41%), Gaps = 98/393 (24%)

Query: 677  ITGLRNLGNTCYINSMLQCLFATR---LFRDLFISSKFQSFINDSKFPNTPKISNSFNLL 733
            I GL N GNTC++NS+LQ L +++    F D  I +  ++   D KF  T +      L+
Sbjct: 57   IAGLVNDGNTCFMNSVLQSLASSKELAAFLDNVIENGSENN-GDIKFTETLR---ELLLI 112

Query: 734  FKKMYLNGGCSVVPTSFLKT-CNILRPDLRIPDDQQDTQEFLMIILDRLH---------- 782
              K Y            LKT  N    ++ +  DQ+D QEF   IL  L           
Sbjct: 113  LNKKYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLEKNIKKPSTEK 172

Query: 783  -DELSNQQEVVNEYPNLLLYDENNLKVQNKEY---KHWFDKNVIGNG----------LSP 828
             +E +N +E  ++ P+  L  +++L      Y   +     +V+ N           ++P
Sbjct: 173  KEERNNIKE--SDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVLENPDQKLYSPFKLITP 230

Query: 829  IDHIFSGQMENSLQCQRCG-NSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFT 887
            +D I + +    + C  CG N    YS F  LSL +P   S + ++S  +KL E +N + 
Sbjct: 231  LDGITAER----IGCLTCGENGGIRYSVFSGLSLNLP---SESLNQST-LKLSELLNEWV 282

Query: 888  SDEVLSGENAWDCPKCGSSASST----------------ISDSEKLLNVTSSKKKNMSSH 931
              E++ G    +C +C  +A  +                I+ +++L  +T    K +   
Sbjct: 283  KPEIIEG---VECNRCSLNAVRSHLQDQIQNDTIPEKLKIAINQRLNLLTEILSKPVIEE 339

Query: 932  NEHHRYKSKFFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPP 991
            +++ +Y       HT +        +K S             KSK+++  +       PP
Sbjct: 340  DDYKKY-------HTEN------MVRKCS-------------KSKQILISRP------PP 367

Query: 992  ILVIHLSRFYYD----LTKKNNTVITYPLILNI 1020
             L IH++R  +D    + +KNN  + +   LN+
Sbjct: 368  FLSIHINRSVFDPRTYMIRKNNARVLFKTRLNL 400

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 63/131 (48%), Gaps = 27/131 (20%)

Query: 981  IKTLNFIVLPPILVIHLSRFYYDLTKKN---NTVITYPLILNI--VLKNNE------VAK 1029
            IK      LPP+LV+ L RF + ++  N   N  I +P IL++   LK+N+         
Sbjct: 341  IKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSIL 400

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQ 1089
            Y L GI++H+G++  GHY +    E           W+ F+D  V +      ++K +L+
Sbjct: 401  YELIGIISHTGSVNEGHYVAFCKIENG--------EWFKFNDSMVTKI-----LEKDVLK 447

Query: 1090 VSSRDVYVLFY 1100
                  Y+LFY
Sbjct: 448  ---EQAYLLFY 455

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 25/36 (69%), Gaps = 6/36 (16%)

Query: 661 SIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCL 696
           ++PT+++   +       GL N+G+TCY++S++QC+
Sbjct: 126 NVPTVDQIDGM------AGLVNMGSTCYMSSIMQCI 155

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 87/229 (37%), Gaps = 59/229 (25%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLF--ISSKFQSFINDSKFPNTPKISNSFNLLFK 735
            G RN G TCY+NS+LQ  F T+ FR L   I ++ +S       PN     NS  L  +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHES-------PN-----NSVPLALQ 252

Query: 736 KMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEY 795
           + +     S +P   ++       D      Q D QE   I++DRL              
Sbjct: 253 RAFYQLQVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRL-------------- 298

Query: 796 PNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYST 855
                  ENN+K    E K              ++ IF G+M++ ++C      S     
Sbjct: 299 -------ENNMKGTPVEGK--------------LNEIFVGKMKSYIKCINVDYESARVED 337

Query: 856 FYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCG 904
           F+ L L +    +          L+   + +   E+++GEN +     G
Sbjct: 338 FWDLQLNVKNFEN----------LQGSFDNYIEMELMNGENQYAAQDYG 376

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 53/112 (47%), Gaps = 26/112 (23%)

Query: 982  KTLNFIVLPPILVIHLSRFYYD-----LTKKNN------TVITYPLILNIVL-------- 1022
            K + F   PP+L + L RF YD     + K N+      T+   P +   VL        
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGD 441

Query: 1023 KNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            K+     Y L+G++ HSG++ +GHY +L+        G + Q WY FDDE V
Sbjct: 442  KDKNPYIYNLHGVLVHSGDISTGHYYTLIKP------GVEDQ-WYRFDDERV 486

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 58/125 (46%), Gaps = 25/125 (20%)

Query: 989  LPPILVIHLSRFYYDLTKKNN----TVITYPLILNI--VLKNNEVAKYRLYGIVNHSGNL 1042
            LP IL +HL RF Y   +K+N      I YPL L++      +   KY L G+V H G+ 
Sbjct: 552  LPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSG 611

Query: 1043 IS-GHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSR-----DVY 1096
               GHY  +   E        K  W  +DDETV+  R     ++ +LQ +         Y
Sbjct: 612  PQHGHYVCICKNE--------KFGWLLYDDETVESIR-----EETVLQFTGHPGDQTTAY 658

Query: 1097 VLFYE 1101
            VLFY+
Sbjct: 659  VLFYK 663

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFR 703
           + G  N GNTCY NS+LQCL+    FR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 112/278 (40%), Gaps = 70/278 (25%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKI--SNSFNLLF 734
           + GL N GNTC++NS+LQ L ++R        + F   I +   PN  ++  S +F  L 
Sbjct: 65  VAGLVNDGNTCFMNSVLQSLASSREL------AHFLDDIIEESEPNKNELNFSVAFKTLL 118

Query: 735 KKMYLNGGCS---VVPTSFLKTC------NILRPDLRIPDDQQDTQEFLMIILDRLHDEL 785
            K+    G +     P + LKT       NIL     +  DQ+D QEF   I+ +L  +L
Sbjct: 119 DKLNAKYGRNRKYYRPNALLKTMESGPNKNIL-----LGYDQEDAQEFFQQIISQLEKDL 173

Query: 786 SNQ--------QEVV-------------NEYPNLLLYDENNLKVQNKEY--KHWFDKN-V 821
             +        +E V             ++ P   L ++ NL+     Y      + N  
Sbjct: 174 KKEDTDGDFKKEESVQPSSEDDKTPILESDLPADALLNQENLEKVGTVYIPTEQVEPNFA 233

Query: 822 IGNG-----------LSPIDHIFSGQMENSLQCQRCG-NSSYNYSTFYVLSLAIPKPSST 869
           +G G           L+P+D I +      + C  CG N    YS    LSL +P  +  
Sbjct: 234 LGKGEHESFYTPYKLLTPLDGIIA----ERIGCLNCGENGGIRYSVSSGLSLNLPNENI- 288

Query: 870 TFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSA 907
                  +KL E ++ +   E++ G    DC +C   A
Sbjct: 289 ----GATLKLSELLDKWVEPEIIEG---VDCNRCALEA 319

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 58/129 (44%), Gaps = 25/129 (19%)

Query: 989  LPPILVIHLSRFYYDLTKKNN----TVITYPLILNIV--LKNNEVAKYRLYGIVNH-SGN 1041
            LP  L +HL RF Y   +  N      + YPL L++     ++   KY L G+V H  G+
Sbjct: 541  LPHTLALHLKRFKYSEEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTGVVIHMGGS 600

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRD-----VY 1096
               GHY SL     N   G     W  FDDETV+        +K +L+ +         Y
Sbjct: 601  PQHGHYVSLCK---NDKFG-----WLLFDDETVE-----SVTEKTVLEFTGDSSNQATAY 647

Query: 1097 VLFYERIYE 1105
            VLFY+ + E
Sbjct: 648  VLFYKELDE 656

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 12/54 (22%)

Query: 656 RSRKFSIPTIE-KSPNLYVSLS-----------ITGLRNLGNTCYINSMLQCLF 697
           RS   S P +E +SP L+  ++           + G  N GNTCY NS+LQCL+
Sbjct: 103 RSSIISDPIVEMESPILFTPMNQLLPYGDGSNKVFGYENFGNTCYCNSVLQCLY 156

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 56/122 (45%), Gaps = 15/122 (12%)

Query: 989  LPPILVIHLSRFYYDLTKKNN----TVITYPLILNIVLK-NNEVAK-YRLYGIVNHSGNL 1042
            LP IL +HL RF Y   K  N      + YPL LN+    ++ + K Y L G+V H G+ 
Sbjct: 645  LPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSS 704

Query: 1043 IS-GHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYE 1101
               GHY SL   +        K  W  FDDETV+       ++      +    YVLFY+
Sbjct: 705  PQHGHYVSLCKND--------KFGWLLFDDETVESVSESTVLEFTGDPNNQATAYVLFYK 756

Query: 1102 RI 1103
             I
Sbjct: 757  EI 758

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFR 703
           + G  N GNTCY NS+LQCL+    FR
Sbjct: 171 VFGYENFGNTCYCNSVLQCLYNLYEFR 197

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 82/227 (36%), Gaps = 55/227 (24%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            G RN G TCY+NS+LQ  F T+ FR L           D + PN     +S  L  ++ 
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLVY-----EIPTDEEKPN-----DSVPLALQRA 258

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPN 797
           +     S +P   L+       D      Q D QE   I++DRL   +            
Sbjct: 259 FYQLQVSNLPLDTLELTRSFGWDSADAFTQHDVQELNRILMDRLETRMKGT--------- 309

Query: 798 LLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFY 857
                    KV+ K                 +  +F G+M++ ++C+     S     F+
Sbjct: 310 ---------KVEGK-----------------LSELFVGKMKSYIKCKNVDYESSRVEEFW 343

Query: 858 VLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCG 904
            + L +    +          L++    +   E++ GEN +  P  G
Sbjct: 344 DIQLNVKDLKN----------LQQSFENYIEVELMDGENQYAAPDFG 380

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 21/107 (19%)

Query: 982  KTLNFIVLPPILVIHLSRFYYD-----LTKKNN------TVITYPLILNIVLKNN---EV 1027
            K + F   P +L + L RF YD     L K N+      ++   P +   VLKN    E 
Sbjct: 386  KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETES 445

Query: 1028 AKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
              Y+L+G++ H+G++ +GHY +++      DLG    +WY FDDE V
Sbjct: 446  HIYKLHGVLVHTGDISTGHYYTMIKP----DLGD---QWYRFDDERV 485

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 61/131 (46%), Gaps = 26/131 (19%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDL---TKKNNTVITYPLILNI--VLKNNEVAK----- 1029
             I+ L    LPP+LV+ L RF + +   + K N  I +P  L++    + ++V +     
Sbjct: 334  AIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVGETPAIV 393

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQ 1089
            Y L G+++H G++  GHYTS+  K P         +W+ F+D  V             + 
Sbjct: 394  YELIGLISHQGSVNQGHYTSIC-KIPG-------GQWFKFNDSMVTAVAE--------ID 437

Query: 1090 VSSRDVYVLFY 1100
            V     Y+LFY
Sbjct: 438  VLKEQAYLLFY 448

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 99/255 (38%), Gaps = 55/255 (21%)

Query: 657 SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
           S K SIP++EK   L       GL N+G+TC+++S++Q L        +   S  Q    
Sbjct: 121 STKSSIPSVEKRNGL------AGLVNMGSTCFMSSIIQTLIHNPY---ILKHSMDQLHST 171

Query: 717 DSKFPNTPK-ISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDD-----QQDT 770
                N+   +S + + +    Y         T+     N+L    R   +     QQD 
Sbjct: 172 TCDLQNSSSCMSCAVDQIISDFYGASKSETSETNQQGFVNLLSCSWRKNKNLAGYSQQDA 231

Query: 771 QEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPID 830
            EF   +L++LH++                    +L+  N+       K  + N  + I 
Sbjct: 232 HEFWQFLLNQLHND--------------------HLRATNQ-------KASLKNDCNCIS 264

Query: 831 H-IFSGQMENSLQCQRCGNSSYNYSTFYV-LSLAIPKPSSTTFSRSKRVKLEECINMFTS 888
           H  F G +++S+ C  C N         + LSL I   S+          L EC++ F  
Sbjct: 265 HRSFQGFLKSSIVCPECQNDRKTTIDLMMDLSLDIKNKST----------LHECLDNFHK 314

Query: 889 DEVLSGENAWDCPKC 903
            E L+  N + C KC
Sbjct: 315 KEQLTDFN-YHCEKC 328

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 72/153 (47%), Gaps = 26/153 (16%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTP---KISNSFNLLFK 735
           GL+NLGNTCY+N+ LQCLF     R++ ++ K  S ++ +   +     ++ N F+ L K
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYKQSSSVSPADEVHQKIVLELRNCFDSLDK 169

Query: 736 KMYLNGGCSVVPTSFLKTCNILRPDLRIPD------DQQDTQEFL--------MIILDRL 781
           K +     +V+P   L       P     D       QQD +E          +I+ D+ 
Sbjct: 170 KKF----QAVMPLMLLNVLRKAYPQFAERDPQGGFYKQQDAEELFTQLFHSLSVILGDKF 225

Query: 782 HDELSNQ-----QEVVNEYPNLLLYDENNLKVQ 809
            D  + +     +++ NE    +  DEN+LK+Q
Sbjct: 226 SDLFTIRYRTTIKDINNEEDVTVKEDENDLKLQ 258

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 59/135 (43%), Gaps = 27/135 (20%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTKKNN----TVITYPLILNI--VLKNNEVAKYRLYGI 1035
            +T+    LP  L +HL RF Y      N      I YPL LN+     ++   KY+L GI
Sbjct: 618  RTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGI 677

Query: 1036 VNHSGNL-ISGHYTSLVNKEPNHDLGSKKQRWYYFDDET---VKEERNH---GDMDKGIL 1088
            V H G+    GHY ++          + K  W  FDDET   + EE      GD      
Sbjct: 678  VVHMGSSPQQGHYVAICK--------TDKYGWLLFDDETASWINEEEVLSFIGD------ 723

Query: 1089 QVSSRDVYVLFYERI 1103
            + S    YVLFYE +
Sbjct: 724  EKSQNTAYVLFYEEV 738

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFR 703
           I G  N GNTCY NS+LQCL+    F+
Sbjct: 154 IFGYENFGNTCYCNSVLQCLYHLDDFK 180

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 58/125 (46%), Gaps = 25/125 (20%)

Query: 989  LPPILVIHLSRFYYDLTKKNN----TVITYPLILNI--VLKNNEVAKYRLYGIVNHSGNL 1042
            LP IL +HL RF Y   +K+N      I YPL L++      +   KY L G+V H G+ 
Sbjct: 554  LPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGVVIHMGSG 613

Query: 1043 IS-GHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSR-----DVY 1096
               GHY  +   E        K  W  +DDETV+  +     ++ +LQ +         Y
Sbjct: 614  PQHGHYVCICRNE--------KFGWLLYDDETVESIK-----EETVLQFTGHPGDQTTAY 660

Query: 1097 VLFYE 1101
            VLFY+
Sbjct: 661  VLFYK 665

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFR 703
           + G  N GNTCY NS+LQCL+    FR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 99/459 (21%), Positives = 178/459 (38%), Gaps = 112/459 (24%)

Query: 674  SLSITGLRNLGNTCYINSMLQCLF---ATRLFRDLFISSKFQSFINDSKFPNTPKISNSF 730
            SL   GL N G TCY N+ +Q +    A + +    +  K+   I+ +   +T     S 
Sbjct: 329  SLKPRGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDILRGKYSDTISPTSV-STVLAETSR 387

Query: 731  NLLFKKMYLNG--GCSVVPTSFLKTCNILRPDLRIPD-DQQDTQEFLMIILDRLHDELSN 787
             + F    L    G  + P   +  C +   +  + +  Q+D+ E+ M ++ RL ++   
Sbjct: 388  RMWFPNEILKKKIGTYIDPNKLI--CRLDDINCMMSEWQQEDSHEYFMSLMSRLQEDSVP 445

Query: 788  QQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCG 847
            +   + E    ++YD                             IF G ++ ++ C+ CG
Sbjct: 446  KGHKMTES---IIYD-----------------------------IFGGLLKQAVTCKSCG 473

Query: 848  NSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSA 907
            + S     FY LSL +   + +  + +         N  T+ +  + EN       G +A
Sbjct: 474  SISKTEQPFYDLSLHLKGKNKSDLNINSEANTSNGGN--TTQDSSTTENGSLEVGNGKAA 531

Query: 908  SSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTSPAAVPSS 967
            +  +S   K L V                  ++ F++     +SI  F    +P  +   
Sbjct: 532  TQQVSAQAKQLAV------------------NRKFSI----EKSIKDF---FNPELIRVD 566

Query: 968  TKNEPW---KSKKLITIKTLNFIV-LPPILVIHLSRFYYDLT--KKNNTVITYPLILNIV 1021
             + + +   K  K       N I+  P  L++HL +F ++ T   K    ++YP+ L++ 
Sbjct: 567  NEQKGYVCEKCHKTTNAAKRNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLT 626

Query: 1022 L--------KNNEV--AKYRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFD 1070
                     K  +V   KY+L  +V H G +L SGHY +   K+P+   GS    W  +D
Sbjct: 627  KYCDKEATPKGQDVLPVKYQLISVVVHEGRSLSSGHYIAHC-KQPD---GS----WSTYD 678

Query: 1071 DETVKEERNHGDMDKGILQVSSRDV------YVLFYERI 1103
            DE +              +++ RDV      Y L Y R+
Sbjct: 679  DEYIN-------------KITERDVLRESNAYYLVYTRL 704

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 52/112 (46%), Gaps = 5/112 (4%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            GL N+GN+CY+NS+LQCLF    +      +  + F  D  FP+   +      L++ M
Sbjct: 320 CGLINMGNSCYLNSVLQCLFQDETWTGKLQMAVGEEFPTDVVFPSN-NLRCQLIKLYRAM 378

Query: 738 YLNGGC---SVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELS 786
            L        + P SF K C     +      QQD  EFL  ++D L  +LS
Sbjct: 379 KLEPELYPQGIKPQSF-KKCFSAGHEEFASQRQQDAMEFLTYMIDNLDKKLS 429

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 99/232 (42%), Gaps = 56/232 (24%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTP------KISNSFN 731
            GL NLGN+CYINS+LQCL    + +   +S+  +SF  D  +P+T       K++N+  
Sbjct: 322 CGLINLGNSCYINSVLQCLLNGGV-KTYSLSALGESFPLDVLYPSTNMKCQLIKLNNAIK 380

Query: 732 LLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEV 791
           L   ++Y +G   + P SF K       +    + QQD  EFL    D L  ++ ++ E 
Sbjct: 381 LE-PELYPSG---IRPRSFKKCIGQAHEEFS-SERQQDALEFLSFFNDTLDKKIFSRSE- 434

Query: 792 VNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSY 851
            N   +L+ Y                                   +EN LQC +CG    
Sbjct: 435 -NNPSDLMRY----------------------------------IIENRLQCTKCG--KV 457

Query: 852 NYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
            Y+T    S+ +P   ++    S+ + L+  +  F  +E+      + CP+C
Sbjct: 458 KYTTDINESMLVPLEENSDSQHSQSL-LDRLVEYFHGEEL-----DFKCPQC 503

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar to
            uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13 or
            uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
            ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 58/125 (46%), Gaps = 25/125 (20%)

Query: 989  LPPILVIHLSRFYYDLTKKNNT----VITYPLILNIVLK-NNEVAK-YRLYGIVNH-SGN 1041
            LP  L +HL RF Y   + +N      ++YPL L +    N  ++K Y L GIV H  G 
Sbjct: 566  LPKTLALHLKRFKYSEQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSGIVVHMGGG 625

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQ-VSSRD----VY 1096
               GHY SL   E        K  W  FDDETV+        ++ +LQ    +D     Y
Sbjct: 626  PQHGHYISLCKNE--------KFGWLLFDDETVE-----AISEQAVLQYTGDKDTMTTAY 672

Query: 1097 VLFYE 1101
            VLFY+
Sbjct: 673  VLFYQ 677

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 73/177 (41%), Gaps = 32/177 (18%)

Query: 730 FNLLFKKMYLNGGCSVVPTSF---LKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELS 786
           F  + +  YL G   V P++F   LK  N+L   +      QD  EFL+ +L+ + D L 
Sbjct: 404 FECITEHSYLTG--VVTPSAFIEMLKRENVLFSSMM----HQDAHEFLIFLLNEISDFLD 457

Query: 787 NQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRC 846
            Q +      N  +YD +  +  +   K++            +  IF G + N ++C  C
Sbjct: 458 KQNK---NALNSKIYDSSQGRRNSGTVKNF------------VSDIFQGTLTNRIKCLTC 502

Query: 847 GNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
            N++     F    + +          +  + ++E +  F   E+L G N + C +C
Sbjct: 503 DNTTARDEPFLDFPIEV--------QENVDIDIQEILESFHQKEMLHGPNKFYCDEC 551

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRD 704
           I G  N GNTCY NS+LQCL+    FR+
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFRN 176

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 19/105 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYD-----LTKKNN------TVITYPLILNIVLKNNEVAK- 1029
            K + F   PP+L + L RF YD     L K N+      ++   P + +  L+ N   K 
Sbjct: 380  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKI 439

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y+L+G++ H+G++ +GHY +L+         S K  WY FDD+ V
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKP-------STKDEWYRFDDDRV 477

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 79/213 (37%), Gaps = 47/213 (22%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            G RN G TCY+NS+LQ  + T+ FR L           + + PN     +S  L  ++ 
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLVY-----QIPTEGENPN-----DSVTLALQRA 252

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPN 797
           +     S  P   ++       D      Q D QE   I++DRL                
Sbjct: 253 FYQLQVSQFPLDTMELTRSFGWDNAEAFTQHDVQELNRILMDRL---------------- 296

Query: 798 LLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFY 857
                E  +K  + E K              I+ +F G+M++ ++C      S     F+
Sbjct: 297 -----ETRMKGTSVEGK--------------INELFVGKMKSYIRCINVDYQSVRTEDFW 337

Query: 858 VLSLAIP--KPSSTTFSRSKRVKLEECINMFTS 888
            + L +   +   T+F     V+L +  N + +
Sbjct: 338 DIQLNVKNMRDLQTSFENYIEVELMDGENQYAA 370

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
            similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 49/101 (48%), Gaps = 15/101 (14%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTKKNN----TVITYPLILNIVLKNNEVA--KYRLYGI 1035
            +T+    LP IL +HL RF Y    ++N      I YPL L +  K++ +    Y L GI
Sbjct: 583  RTVGLKQLPKILSLHLKRFKYSEKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELNGI 642

Query: 1036 VNH-SGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVK 1075
            V H  G    GHY ++      HD+      W  +DDETV+
Sbjct: 643  VIHMGGGPQHGHYVAIC----KHDMFG----WLLYDDETVE 675

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 18/24 (75%)

Query: 674 SLSITGLRNLGNTCYINSMLQCLF 697
           S  + GL N GNTCY NS+LQCLF
Sbjct: 129 STKVFGLENFGNTCYCNSVLQCLF 152

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 46/99 (46%), Gaps = 13/99 (13%)

Query: 982  KTLNFIVLPPILVIHLSRFYYD--LTKKNNTVITYPLILNI--VLKNNEVAKYRLYGIVN 1037
            KT+ F  LP  L +HL RF  D  +  K    I YPL L +     N+    Y L G+V 
Sbjct: 531  KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 1038 HSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVK 1075
            H G +   GHY S+   E        K  W  +DDET++
Sbjct: 591  HVGASPTHGHYVSICKHE--------KYGWLMYDDETIE 621

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFR 703
           + G  N G+TCY NS+LQC++    FR
Sbjct: 120 VFGYENFGHTCYCNSVLQCIYNLPEFR 146

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 61/169 (36%), Gaps = 38/169 (22%)

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPN 797
           YL+G   V P  F+K      P L     QQD  EFL  +L+ + D              
Sbjct: 390 YLSG--VVSPAEFVKLLKRQNP-LFNSTMQQDAHEFLNFLLNNISDFAGK---------- 436

Query: 798 LLLYDENNLKVQNKE---YKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYS 854
              Y  N LK  N+E     H F K+            F G + N ++C  C   S N  
Sbjct: 437 ---YKSNYLKSSNEEECEISHDFVKDQ-----------FEGVLLNRIKCLTCDCVSANEE 482

Query: 855 TFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
            F    + I           + + +++    F   E+L G N + C +C
Sbjct: 483 PFLDFPIEI--------QNDEAINIQDTFRSFYQREILCGPNKFYCNEC 523

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 88/239 (36%), Gaps = 61/239 (25%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            G RN G TCY+NS+LQ  F T+ FR L           +++ PN     NS  L  ++ 
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVY-----QIPTENESPN-----NSVPLALQRS 252

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPN 797
           +     S  P   L+       D      Q D QE   I++DRL                
Sbjct: 253 FYQLQVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRL---------------- 296

Query: 798 LLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFY 857
                EN +K  + E                ++ IF G+M++ ++C      S     F+
Sbjct: 297 -----ENRMKGTSVE--------------GMLNEIFVGKMKSYIKCIDVDYESSRVEDFW 337

Query: 858 VLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEK 916
            L L +               L+E  + +   E+L+GEN +     G      + D+EK
Sbjct: 338 DLQLNVKNMKG----------LKESFDNYIEIELLNGENQYQAQDYG------LQDAEK 380

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 18/104 (17%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTK----KNNTVITYPLILNI--VLKNNEVAK-----Y 1030
            K + F   PP+L + L RF YD       K N    +P  +++   L++++  K     Y
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVY 439

Query: 1031 RLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
             L+G++ H+G++ +GHY +L+           + +WY FDDE V
Sbjct: 440  NLHGVLVHAGDISTGHYYTLIKP-------GLEDQWYRFDDERV 476

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
            Anc_7.390 YBL067C
          Length = 715

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 46/93 (49%), Gaps = 15/93 (16%)

Query: 989  LPPILVIHLSRFYYDLTKKNN----TVITYPLILNI-VLKNNEVAK-YRLYGIVNH-SGN 1041
            LP  L++HL RF Y   + +N      I YPL+L +    N++++K Y L GIV H  G 
Sbjct: 520  LPETLILHLKRFKYSEEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTGIVLHLGGG 579

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
               GHY S+   E        K  W  FDDE V
Sbjct: 580  PQHGHYVSICKNE--------KYGWLLFDDEVV 604

 Score = 39.7 bits (91), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKF 720
           + G  N GNTCY NS+LQCL+     RD  I  K+    N+ KF
Sbjct: 111 VFGYENFGNTCYCNSVLQCLYNIPELRDNVI--KYPMVPNEQKF 152

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 85/230 (36%), Gaps = 61/230 (26%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            GL+N G TCY+NS+LQ  + T+ FR L      +          TP  +NS +L  ++ 
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLVYQIPTEG--------ETP--ANSVSLALQRA 239

Query: 738 YLNGGCSVVPTSFLKTCNILRP---DLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNE 794
           +     S  P   L TC + R    D      Q D QE   I++DRL             
Sbjct: 240 FFQLQRSSEP---LDTCELTRSFGWDTGDAFTQHDVQELNRILMDRL------------- 283

Query: 795 YPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYS 854
                   EN +K    E K              ++ +F G+M++ ++C      S    
Sbjct: 284 --------ENKMKGTEVEGK--------------LNGLFVGKMKSYIKCVNVDYESSRVE 321

Query: 855 TFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCG 904
            F+ + L +               L++    +   E++ GEN +     G
Sbjct: 322 DFWDIQLNVKGLKG----------LQQSFENYIEVEMMDGENQYAAQGHG 361

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 19/105 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTK----KNNTVITYPLILNI-------VLKNNEV-AK 1029
            K + F   PP+L + L RF YD       K N    +P  +++       V +++   AK
Sbjct: 367  KGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVQEDSPANAK 426

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y L+G++ H+G++ +GHY +++           +  WY FDD+ V
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIKP-------GLEDAWYRFDDDKV 464

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
            Anc_2.69 YNL186W
          Length = 746

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 91/435 (20%), Positives = 169/435 (38%), Gaps = 102/435 (23%)

Query: 674  SLSITGLRNLGNTCYINSMLQCLFATRLFR----DLFISSKFQSFINDSKFPNTPKISNS 729
             L   GL N G TCY N+ +Q +      +    D+  ++K   +I D   PN+  +S  
Sbjct: 299  GLKPCGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDILRNNK--DYITDIIKPNS--VSYI 354

Query: 730  FNLLFKKMYLNGGCSVVPTSF-----------LKTCNILRPDLRIPDDQQDTQEFLMIIL 778
             +   KKM+         TS            L+  N +  + +    Q+D+ E+ M ++
Sbjct: 355  LSQTSKKMWWKDSKKTSKTSANYIDPKKLIAALEQINCMMSEWQ----QEDSHEYFMSLM 410

Query: 779  DRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQME 838
             RL ++   + + + E    ++YD                             IF G ++
Sbjct: 411  SRLQEDSVPKGKKMTES---IIYD-----------------------------IFGGLLK 438

Query: 839  NSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAW 898
              + C+ CG  S     FY LSL +    +   + S         +  T++      N  
Sbjct: 439  QEVTCKSCGEISKTEQPFYDLSLHLKGKHNRHQTNS--------TDSATTNYPAGNSNKI 490

Query: 899  DCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKK 958
            +       A+ +++++   LN  +  +   +S           F++     +SI  F   
Sbjct: 491  EESSTKEGAADSVNNANNQLNPENGIQDASTSR----------FSI----EKSIGDF--- 533

Query: 959  TSPAAVPSSTKNEPW---KSKKLITIKTLNFIV-LPPILVIHLSRFYYD--LTKKNNTVI 1012
             +P  +    + + +   K KK       N I+  P  L++HL +F ++   + K    +
Sbjct: 534  FNPELIKMDKEKKGYVCEKCKKTTNAVKRNTILRAPETLLVHLKKFRFNGQSSSKMKQAV 593

Query: 1013 TYPLILNIV-----LKNNEVAKYRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRW 1066
            +YP+ L++       K+  +  Y+L  +V H G +L SGHY +   K+P+         W
Sbjct: 594  SYPMFLDLTSYCDKTKSKLLVMYQLISVVVHEGRSLSSGHYIAHC-KQPDG-------TW 645

Query: 1067 YYFDDE--TVKEERN 1079
              +DDE   +  ERN
Sbjct: 646  ATYDDEYTNIISERN 660

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 81/229 (35%), Gaps = 55/229 (24%)

Query: 676 SITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFK 735
              GL+N G TCY+NS+LQ  + T+ FR L           D + P     SNS  L  +
Sbjct: 197 GFVGLKNQGATCYLNSLLQSYYFTKYFRKLVY-----HIPTDGETP-----SNSVPLALQ 246

Query: 736 KMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEY 795
           + +     S  P    +       D      Q D QE   I++DRL              
Sbjct: 247 RAFYKLQRSSEPLDTFELTRSFGWDTGDAFTQHDVQELNRILMDRL-------------- 292

Query: 796 PNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYST 855
                  EN +K    E K              ++ IF G+M++ ++C      S     
Sbjct: 293 -------ENKMKATEVEGK--------------LNEIFVGKMKSYIKCVNVEYESSRVED 331

Query: 856 FYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCG 904
           F+ + L +   +           L +    +   E++ GEN +   + G
Sbjct: 332 FWDIQLNVKGLNG----------LNQAFENYIEVEMMDGENQYAAQRYG 370

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 19/105 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTK----KNNTVITYPLILNIV-LKNNEVAK------- 1029
            K + F   PP+L + L RF YD       K N    +P  +++    + EV K       
Sbjct: 376  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMM 435

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y L+G++ H+G++ +GHY +++  +P  D      +WY FDD+ V
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMI--KPGLD-----DKWYRFDDDKV 473

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 20/106 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTK----KNNTVITYPLILNIV---------LKNNEVA 1028
            K + F   PP+L + L RF YD       K N    +P  +++          L N E  
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEAC 439

Query: 1029 KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
             Y L+G++ H+G++ +GHY +++              WY FDD+ V
Sbjct: 440  IYNLHGVLVHAGDISTGHYYTMIRP-------GVSDEWYRFDDDKV 478

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 89/240 (37%), Gaps = 63/240 (26%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            G +N G TCY+NS+LQ  F T+ FR L           D   PN     NS  L  ++ 
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLVY-----EIPTDMDSPN-----NSVPLALQRA 252

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPN 797
           +     S  P   L+       D      Q D QE   I++DRL                
Sbjct: 253 FYQLQVSNEPLDTLELTRSFGWDNGDAFTQHDVQELNRILMDRL---------------- 296

Query: 798 LLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFY 857
                EN +K    E K              ++ +F G+M++ ++C      S     F+
Sbjct: 297 -----ENRMKETPVEGK--------------LNELFVGKMKSYIKCINVDYESSRVEDFW 337

Query: 858 VLSLAIPKPSSTTFSRSKRVK-LEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEK 916
            L L +           K +K LEE  + +   E+++GEN +     G      + D+EK
Sbjct: 338 DLQLNV-----------KNLKGLEESFSNYIEIELMNGENQYAAQDYG------LQDAEK 380

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 58/131 (44%), Gaps = 30/131 (22%)

Query: 981  IKTLNFIVLPPILVIHLSRFYYDLTKKN---NTVITYPLILNI-----VLKNNEVAKYRL 1032
            IK L    LPP+LV+ L RF +    +N   N  I +P  LN+       +NN    Y L
Sbjct: 323  IKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYEL 382

Query: 1033 YGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDE---TVKEERNHGDMDKGILQ 1089
             G+++H G +  GHY + +  + N         W+ F+D    ++ EE           +
Sbjct: 383  NGVISHIGTVNEGHYIATLKLDSN--------NWFKFNDSMVTSISEE-----------E 423

Query: 1090 VSSRDVYVLFY 1100
            V     Y+LFY
Sbjct: 424  VLKDQAYLLFY 434

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 98/410 (23%), Positives = 156/410 (38%), Gaps = 107/410 (26%)

Query: 677  ITGLRNLGNTCYINSMLQCLFATR---LFRDLFISSKFQS---------FINDSKFPNTP 724
            + GL N GNTC++NS+LQ L +++    F D  I  KFQ            N+ +     
Sbjct: 90   VGGLVNDGNTCFMNSVLQSLASSKELNAFLDDSIIKKFQEQEEKIQNEEDPNEKEEEEEK 149

Query: 725  KISNSFNLLFKKM-------YLNGGCSVVPTSFLKT-CNILRPDLRIPDDQQDTQEFLMI 776
             +   F++ FK++       Y            LKT  N    ++ +  DQ+D QEF   
Sbjct: 150  DVDVRFSVAFKELLDKLNSKYYRDKPYFRTNKLLKTMSNAPNKNMLLGYDQEDAQEFFQN 209

Query: 777  ILDRLH--------DELSNQQEVVNEYPNLLLYDENNLKVQNKEY--KHWFDKNVIGNG- 825
            IL  L          +  N     NE P+  +  + NL      +      + N + N  
Sbjct: 210  ILSELEKNVKSLDPKKFDNTPIPENELPDDAIIGQANLGDVGTVFLPTEQIEPNSVLNND 269

Query: 826  ------------LSPIDHIFSGQMENSLQCQRCG-NSSYNYSTFYVLSLAIPKPSSTTFS 872
                        ++P+D I + +    + C +CG N    YS F  LSL +P  +  +  
Sbjct: 270  ENDTKFYTPFKLITPLDGISAER----IGCLQCGENGGIRYSVFSGLSLNLPGENIGS-- 323

Query: 873  RSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSA-------------SSTISDSEKLLN 919
                +KL   +  +   E++ G    +C +CG  A              S     EKLL 
Sbjct: 324  ---TLKLTGLLKEWIKPEIIEG---VECYRCGLEAIRSHLLEQLEQYRESNSGIPEKLLV 377

Query: 920  VTSSKKKNMSS-----HNEHHRYKSKFFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWK 974
              S + K + S       E   YK     LHT +        +K S             K
Sbjct: 378  AVSDRIKVLESILAKPVIEDEDYKK----LHTEN------MVRKCS-------------K 414

Query: 975  SKKLITIKTLNFIVLPPILVIHLSRFYYD----LTKKNNTVITYPLILNI 1020
            SK++I  +       PP+L IH++R  +D      +KNN+ + +   LN+
Sbjct: 415  SKQIIISRP------PPLLSIHINRSVFDPRTYQIRKNNSRVLFKSRLNL 458

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa] {ON}
            Anc_8.202 YER151C
          Length = 1080

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 74/161 (45%), Gaps = 37/161 (22%)

Query: 972  PWKSK--KLITIKTLNFI-VLPPILVIHLSRF-YYDLTKKNNTVITY------------- 1014
            P+KS   K +  K   FI  LP +L+I L RF +     K+N +  Y             
Sbjct: 925  PFKSSSGKDVEAKKQTFIDKLPQVLLIQLKRFSFVSNIGKDNGMTNYNSYNGRIEKIRKK 984

Query: 1015 ---------PL--ILNIVLKNNEVA-KYRLYGIVNHSGNLI-SGHYTSLVNKEPNHDLGS 1061
                     P+  + + +LKNNE + KY+L  +V H G+    GHYT+ +    N DL  
Sbjct: 985  INYNHELLVPVESVSSAILKNNESSRKYKLRAVVYHHGSSPDGGHYTADIY---NKDL-- 1039

Query: 1062 KKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYER 1102
              ++W+  DD  + E  +   ++ G   + +R  Y+L YE+
Sbjct: 1040 --KKWFMIDDVNITELEDADVVNGGDNGLDTRTAYILMYEK 1078

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 60/128 (46%), Gaps = 25/128 (19%)

Query: 989  LPPILVIHLSRFYYDLTKKNN----TVITYPLILNI--VLKNNEVAKYRLYGIVNHSGNL 1042
            LP IL +HL RF Y   +++N      I YPL L++     ++   KY L G+V H G+ 
Sbjct: 546  LPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGSG 605

Query: 1043 IS-GHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSR-----DVY 1096
               GHY  +   E        K  W  +DDETV+  R     ++ +L+ +         Y
Sbjct: 606  PQHGHYVCICKNE--------KFGWLLYDDETVESIR-----EETVLKFTGHPGDQTTAY 652

Query: 1097 VLFYERIY 1104
            VLFY+  +
Sbjct: 653  VLFYKETH 660

 Score = 39.3 bits (90), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFR 703
           + G  N GNTCY NS+LQCL+    FR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNISEFR 151

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 80/227 (35%), Gaps = 55/227 (24%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            G +N G TCY+NS+LQ  F T+ FR L           D + PN     NS  L  ++ 
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLVY-----QIPTDKESPN-----NSVPLALQRA 255

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPN 797
           +     S  P   L+       D      Q D QE   I++DRL                
Sbjct: 256 FFQLQKSNEPLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRL---------------- 299

Query: 798 LLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFY 857
                EN +K  + + K              ++ +F G+M + ++C      S     F+
Sbjct: 300 -----ENKMKGTDVDGK--------------LNEVFVGKMRSYIKCVNVDYESSRVEDFW 340

Query: 858 VLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCG 904
            + L +               L+E    +   E++ GEN +     G
Sbjct: 341 DIQLNVKNLRG----------LQESFKNYIEVEMMDGENQYAAQGYG 377

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 19/105 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTK----KNNTVITYPLILN--------IVLKNNEVAK 1029
            K + F   PP+L + L RF YD       K N    +P  ++        I   N +   
Sbjct: 383  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADSYI 442

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y L+G++ H+G++ +GHY +++         S + +WY FDD+ V
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKP-------SIEDQWYRFDDDKV 480

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
            YPL072W
          Length = 471

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 65/149 (43%), Gaps = 41/149 (27%)

Query: 990  PPILVIHLSRFYYDLTK--KNNTVITYPLILNIVLKNN------EVAKYRLYGIVNHSGN 1041
            P IL +HLSR  ++     +N   + YP  L IVL+ +      E   YRL  ++ H+G 
Sbjct: 328  PSILSLHLSRSMFNGASFTRNPCRVEYPETL-IVLQRDVENGTAERITYRLRSMIKHTGT 386

Query: 1042 LISGHYTS---------------LVNKEPN---------HDLGSKK--QRW-YYFDDETV 1074
              SGHY                  VN+ P            + + K  +RW Y+F  + V
Sbjct: 387  HYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKSVRRWPYWFISDAV 446

Query: 1075 KEERNHGDMDKGILQVSSRDVYVLFYERI 1103
              E N G M +      S+ VY+LFYER+
Sbjct: 447  VRESNAGKMLR-----ESKYVYMLFYERV 470

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 57/128 (44%), Gaps = 23/128 (17%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDL---TKKNNTVITYPLILNI--VLKNNEVAK--YRL 1032
             IK L    LP +LV+ L RF + L   + K N ++ +PL LN+      ++V    + L
Sbjct: 348  AIKRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDDVPDIIFEL 407

Query: 1033 YGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSS 1092
             GI+ H G +  GHY +       H        W+ F+D  V         ++ +LQ   
Sbjct: 408  IGIIAHRGTVNEGHYIAFTKVTTGH--------WFKFNDSMVSSIT-----EEELLQ--- 451

Query: 1093 RDVYVLFY 1100
               Y+LFY
Sbjct: 452  EQAYLLFY 459

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 6/38 (15%)

Query: 659 KFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCL 696
           K  IP +E+   L       GL N+G+TC+++S++QCL
Sbjct: 124 KTQIPKLERRDGL------QGLLNMGSTCFMSSIVQCL 155

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 60/133 (45%), Gaps = 32/133 (24%)

Query: 981  IKTLNFIVLPPILVIHLSRFYYDLTKKN---NTVITYPLILNIV-LKNNEVAK------Y 1030
            IK +    LPP+LV+ L RF + +   N   N  ITYP  LN+    ++  A+      Y
Sbjct: 334  IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 1031 RLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDE---TVKEERNHGDMDKGI 1087
             L  +++  G++  GHYT +  K P         +W+ F+D    ++ EE          
Sbjct: 394  ELVAVISQEGSVNQGHYTCMC-KVPG-------GQWFRFNDTMIVSITEE---------- 435

Query: 1088 LQVSSRDVYVLFY 1100
              V  +  Y+LFY
Sbjct: 436  -DVLRQQAYLLFY 447

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 105/263 (39%), Gaps = 55/263 (20%)

Query: 657 SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
           S K  +P +E+   L      +GL N+G+TC+++S+LQCL     F    +S   QS  N
Sbjct: 122 STKTVVPIMERRDGL------SGLINMGSTCFMSSILQCLIHNPYFIKHSMS---QSHFN 172

Query: 717 DSKFPNTPKI-SNSFNLLFKKMYLNGGCSVVPTS-----------FLKTCNILRPDLRIP 764
             K  +     S + + +  ++Y        P+S           +L TC          
Sbjct: 173 KCKVRSPDNCFSCALDKIVHELYGVLNTDQPPSSSSATNRQAGFIYLLTCAWKINQNLAG 232

Query: 765 DDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGN 824
             QQD  EF   I++++H      Q  V   P+    D+ N+K  +              
Sbjct: 233 YSQQDAHEFWQFIINQIH------QNYVLSLPSTKESDKENIKHCD-------------- 272

Query: 825 GLSPIDHIFSGQMENSLQCQRC-GNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECI 883
               +  +F G +E+S+ C  C  NS      F  LSL I            + KL EC+
Sbjct: 273 --CIVHTVFEGSLESSIVCPSCQNNSKTTIDPFMDLSLDIK----------DKKKLYECL 320

Query: 884 NMFTSDEVLSGENAWDCPKCGSS 906
           + F   E+L   N + C +C S+
Sbjct: 321 DSFHKKELLKDFN-YHCGECNST 342

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 98/261 (37%), Gaps = 65/261 (24%)

Query: 857  YVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEK 916
            YVLSL      ST  S  + +K  +CI     +  L  E++  CP C +++ +TI     
Sbjct: 253  YVLSLP-----STKESDKENIKHCDCIVHTVFEGSL--ESSIVCPSCQNNSKTTIDPFMD 305

Query: 917  L-LNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWKS 975
            L L++   KK      + H +   K F  H                    +ST++     
Sbjct: 306  LSLDIKDKKKLYECLDSFHKKELLKDFNYH----------------CGECNSTQD----- 344

Query: 976  KKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTV---ITYPLILNIV----------- 1021
                 IK L    LP +LV+ L RF + L   N  +   I +P  LN+            
Sbjct: 345  ----AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKH 400

Query: 1022 LKNNEVAK--YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERN 1079
            + N +V    Y L GIV+H G +  GHY +               +W+ F+D  V     
Sbjct: 401  IGNKKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGG--------QWFKFNDSMVSSISQ 452

Query: 1080 HGDMDKGILQVSSRDVYVLFY 1100
                     +V     Y+LFY
Sbjct: 453  E--------EVLKEQAYLLFY 465

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 47/108 (43%), Gaps = 10/108 (9%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            G RN G TCY+NS+LQ  F T+ FRDL     +Q    D   PN     +S  L  ++ 
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLV----YQIPTADEN-PN-----DSVALALQRA 308

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDEL 785
           +     S  P   L+       D      Q D QE   I++DRL   +
Sbjct: 309 FYQLQVSNYPLDTLELTRSFGWDTAEAFTQHDVQELNRILMDRLESRM 356

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 19/105 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYD-----LTKKNN------TVITYPLILNIVLKNNEVAK- 1029
            K + F   P +L + L RF YD     L K N+      T+   P +   VLK  +    
Sbjct: 436  KGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNN 495

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y L+G++ H+G++ +GHY +++  +P  D      +WY FDDE V
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMI--KPTTD-----DKWYRFDDEKV 533

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 32/133 (24%)

Query: 981  IKTLNFIVLPPILVIHLSRFYYDL---TKKNNTVITYPLILNIVLKNNEVAK-------Y 1030
            IK +    LPP+LV+ L RF + +   + K N  I YP  LN+    ++          Y
Sbjct: 335  IKQMTIAKLPPVLVLQLKRFEHLMNGNSVKLNEKIAYPTYLNMAPFCHQSESRPVPDMMY 394

Query: 1031 RLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDE---TVKEERNHGDMDKGI 1087
             L  +++H G++  GHYTS+  K P         +W+ F+D    ++ EE          
Sbjct: 395  ELVAVISHEGSVNQGHYTSMC-KIPG-------GQWFRFNDSMIVSISEE---------- 436

Query: 1088 LQVSSRDVYVLFY 1100
             +   +  Y+LFY
Sbjct: 437  -EALRQQAYLLFY 448

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 48/108 (44%), Gaps = 10/108 (9%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            G RN G TCY+NS+LQ  F T+ FR L           +S+ PN+     S  L  ++ 
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLVY-----KIPTESETPNS-----SVPLALQRA 250

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDEL 785
           +     S +P   L+       D      Q D QE   I++DRL + +
Sbjct: 251 FYQLQVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM 298

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 50/105 (47%), Gaps = 19/105 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLT----KKNNTVITYPLILNIV--------LKNNEVAK 1029
            K + F   PPIL + L RF YD       K N    +P   +            NNE   
Sbjct: 378  KGVIFESFPPILHLQLKRFEYDFNFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCI 437

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y L+G++ H+G++ +GHY +++      DL   + +WY FDDE V
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKP----DL---EDQWYRFDDEKV 475

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 95/239 (39%), Gaps = 57/239 (23%)

Query: 676 SITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFK 735
            + GL N+G+TC+++S++Q +     F +  +S K  +  N      T  +S + + +  
Sbjct: 131 GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCN--NCDIKSGTKCVSCALDEIAC 188

Query: 736 KMYLNGGCSVVPTSFLKT-CNILRPDLRI-----PDDQQDTQEFLMIILDRLHDELSNQQ 789
             Y NG  +   +S  K   N+L     I        QQD  E+   +L++LH +     
Sbjct: 189 DFYGNGPGTGKSSSVSKGFVNLLSASWHINHHLVGSSQQDAHEYWQFLLNQLHTD----- 243

Query: 790 EVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSP----IDH-IFSGQMENSLQCQ 844
                                          V G+  +P    I H IF G ++N+LQC 
Sbjct: 244 ----------------------------HARVFGSSKAPDCQCITHRIFQGYLKNTLQCS 275

Query: 845 RCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
           +CG S         LSL I              KLE+C++ F  +E L+ +  ++C  C
Sbjct: 276 QCGFSKTTIDPIMDLSLEIKNNP----------KLEDCLDHFQREETLT-DFHYECQSC 323

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 55/131 (41%), Gaps = 26/131 (19%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDL---TKKNNTVITYPLILNIVLKNNEVA-------K 1029
             +K L     P +LVI L RF + L   + K N  + +PL LN+     ++         
Sbjct: 329  VVKQLTLHKAPNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIA 388

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQ 1089
            Y L  +V+H G +  GHYT++   E          +W+ F+D  V              Q
Sbjct: 389  YDLLNVVSHQGTVDQGHYTTVSKTEDG--------QWFKFNDSVVTSVTEE--------Q 432

Query: 1090 VSSRDVYVLFY 1100
            V  +  Y+LFY
Sbjct: 433  VLEQQAYLLFY 443

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
            YER151C (REAL)
          Length = 909

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 73/167 (43%), Gaps = 42/167 (25%)

Query: 972  PWKSKKL--ITIKTLNFI-VLPPILVIHLSRF-YYDLTKKNNTVITY------------- 1014
            P+KS     +  K   FI  LP +L+I L RF + +   K+N +  Y             
Sbjct: 751  PFKSSSGNDVEAKKQTFIDKLPQVLLIQLKRFSFINNVNKDNAMTNYNAYNGRIEKIRKK 810

Query: 1015 -----PLIL------NIVLKNNEVA----KYRLYGIVNHSG-NLISGHYTSLV-NKEPNH 1057
                  LI+      +I LKN+       +Y+L G++ H G +   GHYT+ V +KE N 
Sbjct: 811  IKYDHELIIPEESMSSITLKNHTSGVDDRRYKLTGVIYHHGVSSDGGHYTADVYHKEHN- 869

Query: 1058 DLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
                   +WY  DD  + E  +   +  G     SR  Y+L Y+++Y
Sbjct: 870  -------KWYRIDDVNITELEDDDVLKGGEEASDSRTAYILMYQKVY 909

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
            Anc_7.390 YBL067C
          Length = 765

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 57/128 (44%), Gaps = 23/128 (17%)

Query: 989  LPPILVIHLSRFYYDLTKKNN----TVITYPLILN--IVLKNNEVAKYRLYGIVNH-SGN 1041
            LP  L +HL RF Y   +  N      I YPL L+      ++   KY L GIV H  G 
Sbjct: 568  LPHTLALHLKRFKYSEEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGIVVHMGGG 627

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRD----VYV 1097
               GHY SL     N + G     W  FDDETV E  +   + K I     RD     YV
Sbjct: 628  PQHGHYVSLCK---NDNFG-----WLLFDDETV-EAVHESTVSKFI---GDRDSLTTAYV 675

Query: 1098 LFYERIYE 1105
            LFY+ I +
Sbjct: 676  LFYKEIAQ 683

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFI 707
           + G  N GNTCY NS+LQCL+    FR L +
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLLL 153

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 77/193 (39%), Gaps = 47/193 (24%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRL--FRDLFISSKFQSFINDSKFPNTPKISNSFNLLFK 735
            GL NLGN+CY+NS++Q L    +  +   F+ S+F     D  +P          LL  
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGVPSWSLDFLGSEFPL---DVVYPANNLKCQWIKLLNA 379

Query: 736 -----KMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQE 790
                K+Y NG   + PT+F K C     +    + QQD  EFL  +LD L         
Sbjct: 380 MKHEPKLYANG---IKPTTF-KKCIGKNHEEFSSNRQQDAMEFLTFLLDSLD-------- 427

Query: 791 VVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSS 850
                                  +++F  N  G   +P D +    ME+ LQC +CG   
Sbjct: 428 -----------------------RNFFSDNSAG-ASNPND-LMRFMMEDRLQCNKCGKVK 462

Query: 851 YNYSTFYVLSLAI 863
           Y+Y     + L +
Sbjct: 463 YSYEPAEAIQLPL 475

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 93/417 (22%), Positives = 151/417 (36%), Gaps = 128/417 (30%)

Query: 675  LSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPK-ISNSFNLL 733
            L   GL N G TCY N+ +Q +      +       F     D K   +P+ ++      
Sbjct: 359  LKPKGLLNHGVTCYTNAAVQAMLHIPSIQHYL----FDVLRGDHKTTISPQSVTQVLAET 414

Query: 734  FKKMYL---NGGCSVVPTSF---LKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN 787
             K+M+    N    + P      L   N +  + +    Q+D+ E+ M ++ RL ++   
Sbjct: 415  SKRMWSPEPNKNTYINPKKLIGRLDDINCMMSEWQ----QEDSHEYFMSLMSRLQEDSVP 470

Query: 788  QQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCG 847
            +   + E    ++YD                             IF G +   + C+ CG
Sbjct: 471  RGHKLTES---IIYD-----------------------------IFGGLLHQKVTCKSCG 498

Query: 848  NSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSA 907
              S     FY LSL +         + K+           SDE +  EN  D P+   S 
Sbjct: 499  GVSKTEQPFYDLSLHL---------KGKK----------KSDETVP-ENQEDVPQRRYSI 538

Query: 908  SSTISD--SEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTSPAAVP 965
              +ISD  + +L+ V   KK        H                       KT+ A   
Sbjct: 539  EKSISDFFNPELIKV--DKKDGYVCEKCH-----------------------KTTNA--- 570

Query: 966  SSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTK--KNNTVITYPLILNIV-- 1021
                           IK  + +  P  L+IHL +F ++ T   K    ++YP+ L++   
Sbjct: 571  ---------------IKRNSILRAPETLLIHLKKFRFNGTSSSKMKQAVSYPMFLDMSEY 615

Query: 1022 ---LKNNEVAKYRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
                +     KY+L  +V H G +L SGHY +   K+P+   GS    W  +DDE +
Sbjct: 616  CEDQQKTLPVKYQLISVVVHEGRSLSSGHYIAHC-KQPD---GS----WATYDDEYI 664

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) [1488
            bp, 495 aa] {ON} similar to uniprot|P43593 Saccharomyces
            cerevisiae YFR010W UBP6 Ubiquitin-specific protease
            situated in the base subcomplex of the 26S proteasome
            releases free ubiquitin from branched polyubiquitin
            chains deletion causes hypersensitivity to cycloheximide
            and other toxic compounds
          Length = 495

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 97/426 (22%), Positives = 154/426 (36%), Gaps = 95/426 (22%)

Query: 678  TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
             GL+NLGNTCY+NS LQ L+  R  R+  ++  FQ    +       ++       F+++
Sbjct: 106  VGLKNLGNTCYMNSTLQALYQIRPLREEILN--FQPPKENRSGEQHIQLVAELKRCFQQL 163

Query: 738  YLNGGCSVVPTSFLKTCNILRPDLRIPDD------QQDTQEFLMIILDRLHDELSNQQEV 791
                  S  P   L T     P     D       QQD +E    I   L          
Sbjct: 164  RDRPQESTTPILLLATLRKCYPQFAERDQESGFYKQQDAEELFTQIFHSLSVVFGQ---- 219

Query: 792  VNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSY 851
                 NL+   + N +   K+  +  D  V  +     DH      +  LQC   G +++
Sbjct: 220  -----NLVQKFQINFQTTIKDNANEQDVTVKDD-----DH------DMKLQCHISGTTNF 263

Query: 852  NYSTFY-VLSLAIPKPSSTT-----FSRSKRV-KLEEC-----INMFTSDEVLSGENAWD 899
              +     L+ +I K SS T     FS  K++ KL E      +  F      +G+ +  
Sbjct: 264  MKNGLQESLNESIEKRSSITGVNSVFSVQKKITKLPEFLTVQYVRFFWKKS--TGKKSKI 321

Query: 900  CPKCGSSASSTISD------SEKLLNVTSS----KKKNMSSHNEHHRYKSKFFTLHTRSH 949
              K        +SD      ++K + V       +K+ +    E  + K+    +   S 
Sbjct: 322  LRKVVFPFQLDVSDLLTSEYAQKKIKVRDDLREVEKEKIEDERELKKRKTNGGPVSGDSE 381

Query: 950  RSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNN 1009
             S++P     +  A+  ST+ E W                   L  +  RF  DL+   N
Sbjct: 382  ASMTPREIAETEKALEESTR-ERW-------------------LQEYKKRFPSDLSPGEN 421

Query: 1010 TVITYPLILNIVLKNNEVAKYRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYY 1068
                Y LI                G++ H G N  SGHY S +  E + +      +WY 
Sbjct: 422  PSCVYNLI----------------GVITHQGANSESGHYQSFIRDEADEN------KWYR 459

Query: 1069 FDDETV 1074
            F+D+ V
Sbjct: 460  FNDDKV 465

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 51/113 (45%), Gaps = 13/113 (11%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFI---NDSKFPNTPKISNSFNLLFK 735
           GL N+GNTCY+NS LQ L+     RD+ +  K Q+ +   ++  +    ++   F  L K
Sbjct: 110 GLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKEQANVQPGDELHYKLISELKRCFENLQK 169

Query: 736 KMYLNGGCSVVPTSFLKTCNILRPDLRIPDD------QQDTQEFLMIILDRLH 782
           K Y     SV+P  FL       P     D+      QQD +E    +   L+
Sbjct: 170 KSYE----SVMPVVFLNLLRKCYPQFAEVDNANGIFKQQDAEELFTQLFSSLN 218

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 108/264 (40%), Gaps = 57/264 (21%)

Query: 657 SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
           S K ++P +E+   L      +GL N+G+TC+++S+LQCL     F      S  Q   N
Sbjct: 122 STKTTVPIMERRDGL------SGLINMGSTCFMSSILQCLIHNPYF---IRHSMSQIHSN 172

Query: 717 DSKFPNTPKI-SNSFNLLFKKMY--LNGGCSVVPTS----------FLKTCNILRPDLRI 763
             K  +  K  S + + + +++Y  LN      P+S          +L TC         
Sbjct: 173 KCKVGSPDKCFSCALDKIIQELYGVLNTD-QPSPSSSATNRQTGFIYLLTCAWKINQNLA 231

Query: 764 PDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIG 823
              QQD  EF   I++++H      Q   ++ PN    D    +V NK  +         
Sbjct: 232 GYSQQDAHEFWQFIINQIH------QSYTHDSPNAKEID----RVNNKRCE--------- 272

Query: 824 NGLSPIDHIFSGQMENSLQCQRC-GNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEEC 882
                +  +F G +E+S+ C  C  NS      F  LSL I            + KL EC
Sbjct: 273 ---CIVHSVFEGSLESSIVCPGCQKNSKTTIDPFMDLSLDIK----------DKKKLYEC 319

Query: 883 INMFTSDEVLSGENAWDCPKCGSS 906
           ++ F   E L   N + C +C S+
Sbjct: 320 LDSFHKKEQLKDFN-YHCGECNST 342

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 54/137 (39%), Gaps = 32/137 (23%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDLTKKNNTV---ITYPLILNI--VLKNNEVAK----- 1029
             IK L    LP +LV+ L RF + L   N  +   I +P  LN+       E  K     
Sbjct: 345  AIKQLGIHRLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEKHTGNG 404

Query: 1030 ------YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDM 1083
                  Y L GIV+H G +  GHY +               +W+ F+D  V        +
Sbjct: 405  KVPDIIYELIGIVSHRGTVNEGHYIAFCKISGG--------QWFKFNDSVVTS------I 450

Query: 1084 DKGILQVSSRDVYVLFY 1100
             +G  +V     Y+LFY
Sbjct: 451  AQG--EVLKEQAYLLFY 465

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 92/228 (40%), Gaps = 51/228 (22%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            GL NLGN+CY+NS LQCLF          +   + +  D    N+P    S N+++   
Sbjct: 331 CGLINLGNSCYLNSTLQCLF----------NGGVKGWDTDM-LGNSP----SLNVVYPAN 375

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN--QQEVVNEY 795
            L    + + T+  +   I +  +R        + F   I    H+E S+  QQ+ +  +
Sbjct: 376 NLKSQLTKLRTALKEEPTIYKQGIR-------PKSFKKCIGGS-HEEFSSGRQQDALEFF 427

Query: 796 PNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYST 855
              +  DE              DK +  N     + +    ME+ LQCQ C    Y+  T
Sbjct: 428 TYFV--DE-------------LDKKLFKNSDYNPNDLMKFMMEDRLQCQECHGVKYSTET 472

Query: 856 FYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
             V+ L + + +           LEE IN + S EV+     + CP C
Sbjct: 473 SNVIQLPLQESNDAQ-------DLEERINAYFSGEVIE----FKCPNC 509

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 20/106 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTK----KNNTVITYPLILNIVLKNNEVAK-------- 1029
            K + F   PP+L + L RF YD       K N    +P  +++    +++          
Sbjct: 370  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPC 429

Query: 1030 -YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
             Y+L+G++ H+G++ +GHY +++         S + +WY FDDE V
Sbjct: 430  IYKLHGVLVHAGDISTGHYYAMIKP-------STEDQWYRFDDEKV 468

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 90/240 (37%), Gaps = 63/240 (26%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            G +N G TCY+NS+LQ  F T+ FR L      +   NDS  PN     NS  L  ++ 
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYQIPTE---NDS--PN-----NSVPLALQRA 242

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPN 797
           +     S  P   L+       D      Q D QE   I++DRL                
Sbjct: 243 FYQLQVSDEPLDTLELTRSFGWDSGDAFTQHDVQELNRILMDRL---------------- 286

Query: 798 LLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFY 857
                EN +K    E K              ++ IF G+M++ ++C      S     F+
Sbjct: 287 -----ENKMKGTPVEDK--------------LNEIFVGRMKSYIKCINVDYESSRVEEFW 327

Query: 858 VLSLAIPKPSSTTFSRSKRVK-LEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEK 916
            L + +           K +K L+     +   E+++GEN +     G      + D+EK
Sbjct: 328 DLQMNV-----------KNLKDLKSSFENYIEIELMNGENQYAAQDYG------LQDAEK 370

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
            (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 62/129 (48%), Gaps = 29/129 (22%)

Query: 989  LPPILVIHLSRFYYDLTKKNNT------VITYPLILNI--VLKNNEVAKYRLYGIVNHSG 1040
            LP IL +HL RF Y  +++NN        ITYP  L++      +   KY L GI+ H G
Sbjct: 549  LPKILSLHLKRFKY--SEENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLG 606

Query: 1041 -NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQ--VSSRDV-- 1095
                 GHY ++   E        K  W  +DDETV+       ++K +L+    S D+  
Sbjct: 607  AGPQHGHYVAMCKTE--------KFGWLLYDDETVE-----AVLEKDVLRHVGDSNDLAT 653

Query: 1096 -YVLFYERI 1103
             Y+LFY+ I
Sbjct: 654  AYILFYKTI 662

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%)

Query: 674 SLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISN 728
           S  + G  N GNTCY NS+LQCL+     RD  I    ++  +  +F N+  I N
Sbjct: 123 STKVFGFENFGNTCYCNSVLQCLYNFSELRDNLILYPEEAKFDPEQFDNSISIKN 177

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 50/126 (39%), Gaps = 18/126 (14%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFI----SSKFQSFINDSKFPNTPKISNSFNLLF 734
           G +N+GNTCY+NS LQ L+  +  R+L +    S    S   DS   +  KI       F
Sbjct: 109 GFQNMGNTCYLNSTLQALYRIKPLRELILSYNGSETATSSAADSTVESHKKIVLELQRCF 168

Query: 735 KKMYLNGGCSVVPTSFLKTCNILRPDLRIPDD------QQDTQEFL--------MIILDR 780
           + +      SV+P   L       P     D       QQD +E          ++  D+
Sbjct: 169 QNLKNKSFKSVMPMVLLTALRKCYPQFAERDSQMGFYKQQDAEELFTQLFHSLSVVFGDK 228

Query: 781 LHDELS 786
             DE S
Sbjct: 229 FEDEFS 234

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 67/155 (43%), Gaps = 28/155 (18%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFI----SSKFQSFINDS-KFPNTPKISNSFNLL 733
           GL+N+GNTCY+N+ LQ LF     +DL +    S    S  ND   +    ++  +F  L
Sbjct: 110 GLQNMGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHYKIVLELKRTFETL 169

Query: 734 FKKMYLNGGCSVVPTSFLKTCNILRPDLRIPD------DQQDTQEFLMIILDRL----HD 783
            K+ +     SV+P   L T     P     D       QQD +E    +   L     D
Sbjct: 170 KKRSF----KSVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFHTLTVVFGD 225

Query: 784 ELSNQ---------QEVVNEYPNLLLYDENNLKVQ 809
           + +NQ         ++  NE    +  DE+++K+Q
Sbjct: 226 KFANQFQINFRATIKDTANEDDVTVREDESDMKLQ 260

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 1019 NIVLKNNEVAKYRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            N+    N  + Y L G++ H G N  SGHY + +  E      S + +WY F+D+ V
Sbjct: 415  NLAAGENPSSVYDLIGVITHQGANSESGHYQAFIRDE------SDENKWYKFNDDKV 465

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 16/102 (15%)

Query: 981  IKTLNFIVLPPILVIHLSRFYYDLTKKN---NTVITYPLILNI--VLKNNEVAK---YRL 1032
            IK L    L P LV+ L RF +  + +N   N  + +PL L++       E      YRL
Sbjct: 339  IKQLTIERLAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRL 398

Query: 1033 YGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
             G+V+HSG +  GHYT+++              W+ F+D  +
Sbjct: 399  SGVVSHSGTVNEGHYTAVLQLNSG--------EWFKFNDSMI 432

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 113/259 (43%), Gaps = 54/259 (20%)

Query: 657 SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKF--QSF 714
           S++ S+PT  +   LY      GL NLG+TC+++S+LQ L      +  F++S    +  
Sbjct: 122 SKQVSLPTSLRRDGLY------GLLNLGSTCFMSSILQSLIHNTYIQYWFLNSGHARRCA 175

Query: 715 INDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDD-----QQD 769
           + D   P++  IS + + +  + Y +         FL   ++L    +I  +     QQD
Sbjct: 176 LRD---PSSC-ISCALDRIISECYGSLSERNDHAGFL---SLLTCSWKINQNFAGYSQQD 228

Query: 770 TQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDEN-NLKVQNKEYKHWFDKNVIGNGLSP 828
             EFL  +L++LH +   +++V          DE+  ++  + +  H             
Sbjct: 229 AHEFLQFLLNQLHCDYKRERQV----------DEDKEVRSSSSQLCHCI----------- 267

Query: 829 IDHIFSGQMENSLQCQRCGNSSYNY-STFYVLSLAIPKPSSTTFSRSKRVKLEECINMFT 887
           +   F G + +S+ C  C + S      F  LSL I         + +R  L +C++ F 
Sbjct: 268 VHSSFQGTLRSSIVCPECQDDSKTMLDPFLDLSLDI---------KGQRT-LYDCLDSFH 317

Query: 888 SDEVLSGENAWDCPKCGSS 906
             E L  +  + CP+C +S
Sbjct: 318 RREQLH-DFDYHCPRCQTS 335

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 17/99 (17%)

Query: 986  FIVLPPILVIHLSRFYYD-----LTKKNNTV-----ITYPLILNIVLKNNEVAKYRLYGI 1035
            F   PP+L + L RF YD     L K N+       I     L+     +  A Y L+G+
Sbjct: 377  FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTPADYILHGV 436

Query: 1036 VNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            + HSG++ +GHY +++  + +   GS    WY FDD+ V
Sbjct: 437  LVHSGDISTGHYYAMIQPDAH---GS----WYRFDDDRV 468

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 90/243 (37%), Gaps = 61/243 (25%)

Query: 676 SITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFK 735
              G +N G TCY+NS+LQ    T+LFR L     +Q    D      P  +NS  L  +
Sbjct: 195 GFVGFKNQGATCYLNSLLQSYHFTKLFRKLV----YQIPTEDE----NP--TNSVALALQ 244

Query: 736 KMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEY 795
           + +     S  P    +       D      Q D QE   I++DRL              
Sbjct: 245 RAFYLLQTSKEPLDTTELTKSFGWDTGDAFTQHDVQELNRILMDRL-------------- 290

Query: 796 PNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYST 855
                  E+ +K  + E K              I+ +F G+M++ ++C      S     
Sbjct: 291 -------EHRMKGTSVEGK--------------INELFVGKMKSCIKCINVDYESSRVED 329

Query: 856 FYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSE 915
           F+ + L +    +          L+E    +   E+++GEN +     G      + D++
Sbjct: 330 FWDIQLNVKDMKN----------LQESFEQYIEVELMNGENQYAAQDHG------LQDAQ 373

Query: 916 KLL 918
           K++
Sbjct: 374 KVV 376

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 57/110 (51%), Gaps = 17/110 (15%)

Query: 974  KSKKLI-TIKTLNFIVLPPILVIHLSRFYYDLT--KKNNTVITYPLILNIVLKNNEV--- 1027
            K KK+   +K+   I  P  LV+HL +F ++ T   K    ++YP+ L++    +E    
Sbjct: 575  KCKKVTNALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCHESISS 634

Query: 1028 --AKYRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
               +Y+L  +V H G +L SGHY +   K+P+   GS    W  +DDE +
Sbjct: 635  LPVRYQLISVVVHEGRSLSSGHYIAHC-KQPD---GS----WATYDDEYI 676

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 57/130 (43%), Gaps = 26/130 (20%)

Query: 981  IKTLNFIVLPPILVIHLSRFYYDLTKKN---NTVITYPLILNIVL-----KNNEVAK--Y 1030
            IK      LPP+LV+ L RF + +   N   N  + YPL LN+        N E     Y
Sbjct: 347  IKQFTINKLPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDIIY 406

Query: 1031 RLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQV 1090
             L GI++H G++  GHY  +        L     RW+ F+D  +   +     D+ + Q 
Sbjct: 407  ELTGILSHIGSINEGHYVVV--------LKINDGRWFKFNDSMISVIKE----DEALKQ- 453

Query: 1091 SSRDVYVLFY 1100
                 Y+LFY
Sbjct: 454  ---QAYLLFY 460

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 109/273 (39%), Gaps = 75/273 (27%)

Query: 657 SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
           S K +IP+ E+   L+      GL N+G+TC+++S+LQ L       +  +S     F+N
Sbjct: 123 STKTTIPSQERRDGLF------GLVNMGSTCFMSSILQALIHNPYIVNYSMSQT--HFVN 174

Query: 717 DSKFPNTPKISNSFNLLFKKMYLNGGCSVVPT----------------SFLKTCNILRPD 760
            S   ++  +S + + +  + Y  G   + P                 +F+   ++L   
Sbjct: 175 CSIKNSSLCMSCALDAMIIEFY--GQSKLQPISSSSSSSSSSSSSSPSAFI---SLLTCS 229

Query: 761 LRIPDD-----QQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKH 815
           L+I ++     QQD  EFL   L++LH                            ++YK 
Sbjct: 230 LKINENFAGYSQQDAHEFLQYFLNQLH----------------------------QDYKR 261

Query: 816 WFDKNVIGNGLSPIDH-IFSGQMENSLQCQRCGNSSYN-YSTFYVLSLAIPKPSSTTFSR 873
               N   N    + H IF G++++S+ C  C N S      F  LSL I          
Sbjct: 262 DSSHNEQENNCPCVAHSIFQGELKSSIVCPECQNDSKTIIDPFMDLSLDIK--------- 312

Query: 874 SKRVKLEECINMFTSDEVLSGENAWDCPKCGSS 906
             +  L +C++ F   E L   N + C +C +S
Sbjct: 313 -DKTDLYQCLDSFHKKEKLHDFN-YHCSRCNTS 343

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 53/123 (43%), Gaps = 15/123 (12%)

Query: 989  LPPILVIHLSRFYYDLTKKNN----TVITYPLILNI--VLKNNEVAKYRLYGIVNHSGNL 1042
            +P IL +HL RF Y   + +N      I YPL L++      +   +Y L G+V H G+ 
Sbjct: 557  VPYILSLHLKRFKYSEEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSGVVIHMGSG 616

Query: 1043 IS-GHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYE 1101
               GHY  +   E        K  W  +DDETV+       +            YVLFY+
Sbjct: 617  PQHGHYVCICKNE--------KFGWLLYDDETVESVSEETVLKFTGHSGDQTTAYVLFYK 668

Query: 1102 RIY 1104
             I+
Sbjct: 669  EIH 671

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFR 703
           + G  N GNTCY NS+LQCL+    FR
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFR 161

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 96/234 (41%), Gaps = 52/234 (22%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRL--FRDLFISSKFQSFINDSKFPNTP------KISNS 729
            GL NLGN+CY+NS++QCL    +  + D   +     F  D  +P         K+ N+
Sbjct: 342 CGLINLGNSCYLNSVMQCLLNGGVPNWSDKLGNIIGHDFPKDVIYPTGNLRCQMIKLLNA 401

Query: 730 FNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQ 789
           F  L  + Y  G   + P SF +       + +  ++QQD+ EFL  + + L   L    
Sbjct: 402 FK-LNPEDYEEG---IRPRSFKECVGKHNAEFKT-NNQQDSMEFLTFVTEELEKGL---- 452

Query: 790 EVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNS 849
                +P          K+Q+               ++P +++    ME+ LQC  C N 
Sbjct: 453 -----FP----------KIQDA-------------SINP-NNLLKFIMEDKLQCVECKNV 483

Query: 850 SYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
            Y Y     + L + + +    + ++ + +E   + F  +E+      + CP C
Sbjct: 484 KYTYQPNECIQLPLKEGNDLVGTTTQNL-MELITDYFQGEEI-----EFSCPTC 531

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
            YPL072W
          Length = 498

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 104/434 (23%), Positives = 167/434 (38%), Gaps = 103/434 (23%)

Query: 651  SLMLTRSRKFSIPTIEKSPNLYVS-LSI----------TGLRNLGNTCYINSMLQCL--- 696
             L+LT S    +P++ ++ N+    LSI          TGL N  N C++NS LQ L   
Sbjct: 37   GLLLTASLYVLLPSVSRAFNVKKGPLSIEESKRLDRFTTGLLNARNDCFLNSSLQALVPI 96

Query: 697  -----FATRLFRDLFISSKFQSFINDSKFP---NTPKISNSFNLLFKKMYLNGGCSVVPT 748
                 +  +    L    + Q F  +   P   N  K+ +    L  K       ++V T
Sbjct: 97   ESLTTYLNQFVEALHSVDEGQVFELERLAPLHANLIKLLHELQSLIVKPQTVSAKNIVKT 156

Query: 749  SFLKTCNILRPDLR--IPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNL 806
                    L   LR  +  DQ D  EF  I+L+ LH          +EY  L    ++N+
Sbjct: 157  --------LEDTLRRKMSSDQNDAHEFTQILLETLH----------SEYIKL----QSNI 194

Query: 807  KVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYN-YSTFYVLSLAIPK 865
            ++                G  P    F G   N L C +C   S   +S F +L +A+P 
Sbjct: 195  EI----------------GSFP----FEGVSSNYLMCLQCNKYSQTIHSPFLMLEVAVPG 234

Query: 866  PSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKK 925
              S         KL + I + + DE++ G   + C  C     + I  +EK LN      
Sbjct: 235  NYSE--------KLTDLI-LHSQDEIIEG---YSCLYC---KVNMILKNEKYLNQLPEYS 279

Query: 926  KNMSSHNEHHRYKSKFFTLHTRSH--RSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKT 983
            +   S     R  ++  TL+        +S +    S     ++     +KS     IK 
Sbjct: 280  QEEQSILNFLR--NQILTLYINDDLPADVSFYVDHYSKNGCVTAN----FKSN---IIKK 330

Query: 984  LNFIVLPPILVIHLSRFYYD---LTKKNNTV-------ITYPLILNIVLKNNEVAKYRLY 1033
               I  P  L++HLSR  ++   +T+    V       +   +++N   +  E  KY L 
Sbjct: 331  NAVIKEPASLIVHLSRSIFNGATITRSACRVEYEQSLNLQRQVMINDAFERTEPIKYELK 390

Query: 1034 GIVNHSGNLISGHY 1047
             +V H+G+ + GHY
Sbjct: 391  SVVKHTGSHVQGHY 404

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 86/231 (37%), Gaps = 54/231 (23%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRL--FRDLFISSKFQSFINDSKFPNTPKISNSFNLLFK 735
            GL NLGN+CY+NS+LQ LFA  +  + D+ + +  + F  D  +P+   +      L  
Sbjct: 319 CGLINLGNSCYLNSILQALFAQDVSQWADVLMDTIGKDFPVDVVYPSN-NVKCQLIKLLN 377

Query: 736 KMYLNGGC---SVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVV 792
            M +N       + P SF K C          + QQD  EFL   ++ L           
Sbjct: 378 AMKINPSRYPEGIKPRSF-KNCIGQNNKEFTSNKQQDALEFLSYFVNEL----------- 425

Query: 793 NEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYN 852
                                    DK +    L+    +    ME+ LQC RC +  Y+
Sbjct: 426 -------------------------DKKLFKKELTNPGDLMRCYMEDRLQCLRCKHVKYS 460

Query: 853 YSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
           Y     + L +   +     R +       ++ F   EV+     ++CP C
Sbjct: 461 YQANESIQLPLKDNNEPQDIRER-------LDAFFKGEVIE----FNCPHC 500

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 70/162 (43%), Gaps = 38/162 (23%)

Query: 972  PWKSKKL--ITIKTLNFI-VLPPILVIHLSRF-YYDLTKKNNTVITYPLILNIVLK---- 1023
            P+KS     +  K   FI  LP +L+IHL RF + + T K+N++  Y      + K    
Sbjct: 866  PFKSSSGADVEAKKQTFIDKLPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKK 925

Query: 1024 ---NNEVA-----------------KYRLYGIVNHSG-NLISGHYTS-LVNKEPNHDLGS 1061
               N+E+                   Y L G+V H G +   GHYT+ + +KE +     
Sbjct: 926  ISYNHELVIPAETITNGKQLAPENRTYELTGVVYHHGLSSDGGHYTADIYHKEVD----- 980

Query: 1062 KKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERI 1103
               +WY  DD TV E      +  G     SR  Y+L Y+++
Sbjct: 981  ---KWYRIDDVTVTELEKDDVLKGGENSTDSRTAYILMYQKL 1019

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 18/110 (16%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDLTK--KNNTVITYPLILNIVLKNNEVAK-----YRL 1032
             IK    +  P  L++HL +F ++ T   K    ++YPL +++     E AK     Y+L
Sbjct: 581  AIKRNMILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPLFMDLTEYCVEAAKCLPVKYQL 640

Query: 1033 YGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKE--ERN 1079
              +V H G +L SGHY +   K+P+         W  +DDE + +  ERN
Sbjct: 641  ISVVVHEGRSLSSGHYIAHC-KQPDG-------TWATYDDEYINKITERN 682

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar to
            uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
            ubiquitin-specific proteinase
          Length = 816

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 60/153 (39%), Gaps = 34/153 (22%)

Query: 979  ITIKTLNFI-VLPPILVIHLSRF-----------------YYDLTKKNNTVITYPLILNI 1020
            +  K   FI  LP IL+I L RF                 Y    +K    I+Y   L I
Sbjct: 670  VEAKKQTFIDKLPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKISYGHTLEI 729

Query: 1021 --------VLKNNEVAKYRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDD 1071
                     L+NN    Y L G++ H G +   GHYT+ V          + + WY  DD
Sbjct: 730  PDETLASSALRNNSSKTYELSGVIYHHGMSPDGGHYTADV-------FHKQTKTWYRIDD 782

Query: 1072 ETVKEERNHGDMDKGILQVSSRDVYVLFYERIY 1104
              + +  +   +  G   + SR  Y+L Y+ ++
Sbjct: 783  VNITKLEDDDVLKGGEDNMDSRTAYILMYQNVH 815

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 51/105 (48%), Gaps = 19/105 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYD-----LTKKNN------TVITYPLILNIVLKNNEV-AK 1029
            K + F   P +L + L RF YD     L K N+      T+   P +   VLK N     
Sbjct: 379  KGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCV 438

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y L+G++ HSG +  GHY +++      D+G +   W+ FDD+ V
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKP----DVGDQ---WFRFDDDKV 476

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 88/235 (37%), Gaps = 67/235 (28%)

Query: 676 SITGLRNLGNTCYINSMLQCLFATRLFRDLF--ISSKFQSFINDSKFPNTPKISNSFNLL 733
              GL+N G TCY+NS+LQ  F T+LFR +   I S+ +S  NDS       +  SF LL
Sbjct: 200 GFIGLKNQGATCYLNSLLQSYFFTKLFRKIVYKIPSENES-PNDSVL---LALQRSFYLL 255

Query: 734 FKKMYLNGGCSVVPTSFLKTCNILRP---DLRIPDDQQDTQEFLMIILDRLHDELSNQQE 790
            K               L T  + R    D      Q D QE   I++DRL         
Sbjct: 256 QKS-----------NETLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRL--------- 295

Query: 791 VVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSS 850
                       E  +K    E                ++ +F G+M++ ++C      S
Sbjct: 296 ------------ETRMKGTEVE--------------GALNELFVGKMKSYIRCINVDYES 329

Query: 851 YNYSTFYVLSLAIPKPSSTTFSRSKRVK-LEECINMFTSDEVLSGENAWDCPKCG 904
                F+ + L +           K +K ++E  + +   E++ GEN +     G
Sbjct: 330 SRVEDFWDIQLNV-----------KNLKGVQESFDNYVEVEIMDGENQYAAQDYG 373

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
            complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 62/140 (44%), Gaps = 20/140 (14%)

Query: 971  EPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNT----VITYPLILNIVLKNNE 1026
            E  ++++L+ +K L     P  L IHL RF Y      N      I YP+ L +    +E
Sbjct: 514  ELQEAERLLGLKEL-----PKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDE 568

Query: 1027 -VAK-YRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDM 1083
             V+K Y L G+V H G     GHY S+       D G     W  FDDETV+       +
Sbjct: 569  SVSKDYELGGLVVHIGIGPQHGHYISVCK---TSDYG-----WLLFDDETVECISEDTVL 620

Query: 1084 DKGILQVSSRDVYVLFYERI 1103
                   S+   YVLFY+ I
Sbjct: 621  SFVGDSNSAGTAYVLFYKEI 640

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 29/45 (64%), Gaps = 4/45 (8%)

Query: 663 PTIEKSPNLYVSLSIT---GLRNLGNTCYINSMLQCLFATRLFRD 704
           PT E++ NL + + I    GL N GNTCY NS+LQCL+    FR+
Sbjct: 114 PTNEEN-NLDIDIDIHKVYGLENFGNTCYCNSILQCLYNMNEFRE 157

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/306 (22%), Positives = 123/306 (40%), Gaps = 56/306 (18%)

Query: 750  FLKTCNILRPDLRIPD-------DQQDTQEFLMIILDRLHDE---LSNQQEVVN------ 793
            + +T N+L+   + P+       +Q+D QEF   IL  L      L + +E ++      
Sbjct: 149  YYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYELEKNIKFLDSDREKLDKKPIPE 208

Query: 794  -EYPNLLLYDENNLKVQNKEY--------KHWFDKNVIGNGLSPIDHI--FSGQMENSLQ 842
             + P+  L  +NNL      Y            DK+   N  +P   +    G +   + 
Sbjct: 209  SDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPSTNYFTPFRLVTPLDGIVAERIG 268

Query: 843  CQRCGNSS-YNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCP 901
            C  CG +    YS    LSL +P  +         +KL + +N +   E++ G N + C 
Sbjct: 269  CLNCGETGGIRYSVSSGLSLNLPSENI-----GDTLKLSQLLNEWCKPEIIEGVNCYRC- 322

Query: 902  KCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSI---SPFRKK 958
                S ++ +   E  L   S K K           K++   L+    + +     ++K 
Sbjct: 323  ----SLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPVIDDEEYKKM 378

Query: 959  TSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYD----LTKKNNTVITY 1014
             +   V  S+K     SK++I  +       PP+L IH++R  +D    + KKNN+ + +
Sbjct: 379  HTDNMVRKSSK-----SKQIILARP------PPLLSIHINRSVFDTRTFMIKKNNSRLAF 427

Query: 1015 PLILNI 1020
               LN+
Sbjct: 428  KARLNL 433

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 55/99 (55%), Gaps = 17/99 (17%)

Query: 985  NFIV-LPPILVIHLSRFYYDLTK--KNNTVITYPLILNIV--LKNNEVA---KYRLYGIV 1036
            NF++  P  L++HL +F ++ T   K    ++YP+ L++    +N+  A   KY+L  +V
Sbjct: 342  NFLLRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDLTEYCENSATALPVKYQLISVV 401

Query: 1037 NHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
             H G +L SGHY +   K+P+   GS    W  +DDE +
Sbjct: 402  VHEGRSLSSGHYIAHC-KQPD---GS----WSTYDDEYI 432

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%)

Query: 656 RSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSK 710
           + R+F     E +   ++S +  GL+NLGNTCY+NS LQ L+  +  RD  ++ K
Sbjct: 38  KERRFIEDLDEGAQMQHLSQTPVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYK 92

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 1019 NIVLKNNEVAKYRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            N+    N    Y L G++ H G N  SGHY S +  E + +      +WY F+D+ V
Sbjct: 369  NLAQGENPSCVYNLIGVITHQGANSESGHYQSFIRDEVDEN------KWYRFNDDKV 419

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (48%), Gaps = 19/105 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYD-----LTKKNNT------VITYPLILNIVLKNNEVAK- 1029
            K + F   P +L + L RF YD     L K N+       +   P +   VL+ N   + 
Sbjct: 380  KGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRW 439

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y L+G++ H+G++ +GHY +L+           + +WY FDDE V
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKP-------GLEDQWYRFDDERV 477

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 83/228 (36%), Gaps = 57/228 (25%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
            G RN G TCY+NS+LQ  F T+ FR L         I  S+    PK  +S  L  ++ 
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQ------IPTSQ--ENPK--DSVVLALQRA 252

Query: 738 YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPN 797
           +     S  P   ++       D      Q D QE   I++DRL   +            
Sbjct: 253 FYQLQVSQYPLDTMELTRSFGWDNVEAFTQHDVQELNRILMDRLETRMKGT--------- 303

Query: 798 LLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFY 857
                     V+NK                 ++ IF G+M++ ++C      S     F+
Sbjct: 304 ---------TVENK-----------------LNEIFVGKMKSFIKCINVDYESARTEDFW 337

Query: 858 VLSLAIPKPSSTTFSRSKRVK-LEECINMFTSDEVLSGENAWDCPKCG 904
            + + +           K +K L++    +   E++ GEN +     G
Sbjct: 338 DIQMNV-----------KNLKGLKDSFENYIEVELMDGENQYAAQDYG 374

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
            {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186w UBP10
          Length = 771

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 64/132 (48%), Gaps = 23/132 (17%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDLTK--KNNTVITYPLILNIVLKNNEV-----AKYRL 1032
             +K  + +  P  L++HL +F ++ T   K    ++YP+ L++     E       KY L
Sbjct: 605  ALKRNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDMTEYCEESKKMLPVKYEL 664

Query: 1033 YGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVS 1091
              +V H G +L SGHY +   K+P+   GS    W  +DDE +     +   ++ +L+  
Sbjct: 665  LSVVVHEGRSLSSGHYIAHC-KQPD---GS----WATYDDEYI-----NKITEREVLK-- 709

Query: 1092 SRDVYVLFYERI 1103
             R+ Y + Y R+
Sbjct: 710  ERNAYYVLYTRL 721

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 82/204 (40%), Gaps = 59/204 (28%)

Query: 672 YVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIND---SKFPNTPKISN 728
           Y  L   GL N G TCY N+ +Q L        L I +  Q ++ND    K+ +T   ++
Sbjct: 379 YSKLKPKGLLNHGVTCYTNAAVQAL--------LHIPA-MQHYLNDILAGKYSSTISSNS 429

Query: 729 SFNLLF---KKMYLNGGCSVVPTSFLKTCNILRPDLRIPD--------DQQDTQEFLMII 777
             ++L    ++M+ N G      S++    ++    R+ D         Q+D+ E+ M I
Sbjct: 430 VSHVLAETSRRMWHNDG-KKSGNSYINPKKLI---ARLDDINCMMSEWQQEDSHEYFMSI 485

Query: 778 LDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQM 837
           + RL ++   +   + E    ++YD                             IF G +
Sbjct: 486 MSRLQEDSVPKGHKMTES---IIYD-----------------------------IFGGSL 513

Query: 838 ENSLQCQRCGNSSYNYSTFYVLSL 861
           + ++ C+ CG  S     FY LSL
Sbjct: 514 KQTVTCKSCGEVSTTEQPFYDLSL 537

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 1030 YRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGIL 1088
            YRL G+V H G +   GHYT+ V       L   + +WY  DD  V E R      +G  
Sbjct: 723  YRLTGVVYHHGLSPSGGHYTADV-------LHQTQDKWYRIDDNNVTEIRQEDVFKRGDE 775

Query: 1089 QVSSRDVYVLFYER 1102
               S+  Y+L Y+R
Sbjct: 776  ASDSKTAYILIYQR 789

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
            YER151C
          Length = 795

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 67/152 (44%), Gaps = 36/152 (23%)

Query: 979  ITIKTLNFI-VLPPILVIHLSRF-YYDLTKKNNTVITY---------------------- 1014
            +  K   FI  LP +L+I L RF + + T K+N++I Y                      
Sbjct: 651  VEAKKQTFIDKLPQVLLIQLKRFQFINNTDKDNSMINYNAYNGRIEKIRKKINYEHELMI 710

Query: 1015 PL--ILNIVLKNNEVAKYRLYGIVNHSG-NLISGHYTSLV-NKEPNHDLGSKKQRWYYFD 1070
            P+  I +     +E  +Y L G++ H G +   GHYT+ V +KE +        +WY  D
Sbjct: 711  PIESISSTNALRDEDRQYSLSGVIYHHGLSSDGGHYTADVYHKETD--------KWYRID 762

Query: 1071 DETVKEERNHGDMDKGILQVSSRDVYVLFYER 1102
            D  + E +    +  G   V SR  Y+L Y++
Sbjct: 763  DINITEVQKDSVLKGGEDGVDSRTAYILMYQK 794

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 67/154 (43%), Gaps = 29/154 (18%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKMY 738
           GL+N+GNTCY+N+ LQ LF     RDL ++       + +K     ++ +   L  K+ +
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLILN------YDPAKASPQDEMHHKIVLEMKRCF 161

Query: 739 LN----GGCSVVPTSFLKTCNILRPDLRIPD------DQQDTQE--------FLMIILDR 780
            N       SV+P   L       P     D       QQD +E        F ++  D+
Sbjct: 162 ENLENKSYKSVMPLMLLNVLRKCYPQFAERDAQGGFYKQQDAEELFTQLFHTFDIVFGDK 221

Query: 781 LHDELSNQ-----QEVVNEYPNLLLYDENNLKVQ 809
             D+ + Q     ++  NE    +  +EN+LK+Q
Sbjct: 222 FSDDFTVQFRTTIKDTNNEEDVTIKENENDLKLQ 255

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
            UBP3Ubiquitin-specific protease involved in transport and
            osmotic response; interacts with Bre5p to co-regulate
            anterograde and retrograde transport between the ER and
            Golgi; involved in transcription elongation in response
            to osmostress through phosphorylation at Ser695 by Hog1p;
            inhibitor of gene silencing; cleaves ubiquitin fusions
            but not polyubiquitin; also has mRNA binding activity
          Length = 912

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 68/164 (41%), Gaps = 40/164 (24%)

Query: 972  PWKSKKL--ITIKTLNFI-VLPPILVIHLSRF-YYDLTKKNNTVITY------------- 1014
            P+KS     +  K   FI  LP +L+I   RF + +   K+N +  Y             
Sbjct: 754  PFKSSSGNDVEAKKQTFIDKLPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKK 813

Query: 1015 -----PLIL------NIVLKNNEVA----KYRLYGIVNHSG-NLISGHYTSLVNKEPNHD 1058
                  LI+      +I LKNN       +Y+L G++ H G +   GHYT+ V       
Sbjct: 814  IKYGHELIIPEESMSSITLKNNTSGIDDRRYKLTGVIYHHGVSSDGGHYTADV------- 866

Query: 1059 LGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYER 1102
              S+  +WY  DD  + E  +   +  G     SR  Y+L Y++
Sbjct: 867  YHSEHNKWYRIDDVNITELEDDDVLKGGEEASDSRTAYILMYQK 910

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 754

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 57/128 (44%), Gaps = 27/128 (21%)

Query: 989  LPPILVIHLSRFYYDLTKKNN----TVITYPLILNIV--LKNNEVAKYRLYGI-VNHSGN 1041
            LP IL +HL RF Y  T+  N      I YPL L +     ++   +Y L GI V+  G 
Sbjct: 558  LPHILALHLKRFKYSETQNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTGIVVHMGGG 617

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDV------ 1095
               GHY SL   E        K  W  FDDETV+       +D+  +     D+      
Sbjct: 618  PHHGHYVSLCKNE--------KFGWLLFDDETVES------VDESSVMKFCGDLHDLTTA 663

Query: 1096 YVLFYERI 1103
            YVLFY+ I
Sbjct: 664  YVLFYKEI 671

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 60/162 (37%), Gaps = 42/162 (25%)

Query: 745 VVPTSF---LKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLY 801
           V PTSF   LK  N+L   +      QD  EFL  +L+ L D L  Q             
Sbjct: 421 VSPTSFVEILKRENVLFSTMM----HQDAHEFLNFLLNELSDSLQRQIS----------- 465

Query: 802 DENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSL 861
                           D ++I    + ID +F G M N  +C  C N +     F    +
Sbjct: 466 ----------------DDSIITPNDNFIDRLFKGTMTNQTKCLTCDNITSRDEPFLDFPI 509

Query: 862 AIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
            +     T         ++E ++ F   E+L+G N + C KC
Sbjct: 510 EVNGNCET--------DIQEMLSDFHQKEMLNGSNKFYCDKC 543

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFR 703
           + G  N GNTCY NS+LQCL+    FR
Sbjct: 145 VFGYENFGNTCYCNSVLQCLYNLTEFR 171

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 100/261 (38%), Gaps = 65/261 (24%)

Query: 857  YVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEK 916
            YVL L    P++   SR+   K  ECI     +  L  E++  CP C +++ +TI     
Sbjct: 253  YVLDL----PNAKEVSRANN-KQCECIVHTVFEGSL--ESSIVCPGCQNNSKTTIDPFLD 305

Query: 917  L-LNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWKS 975
            L L++   KK      + H + + K F  H                    +ST++     
Sbjct: 306  LSLDIKDKKKLYECLDSFHKKEQLKDFNYH----------------CGECNSTQD----- 344

Query: 976  KKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTV---ITYPLILNIV--------LKN 1024
                 IK L    LP +LV+ L RF + L   N  +   I +P  LN+          K+
Sbjct: 345  ----AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKH 400

Query: 1025 NEVAK-----YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERN 1079
            +E  K     Y L GIV+H G +  GHY +               +W+ F+D  V     
Sbjct: 401  SENGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGG--------QWFKFNDSMVSSISQ 452

Query: 1080 HGDMDKGILQVSSRDVYVLFY 1100
                     +V     Y+LFY
Sbjct: 453  E--------EVLKEQAYLLFY 465

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 105/263 (39%), Gaps = 59/263 (22%)

Query: 659 KFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDS 718
           K  +P++E+   L      +GL N+G+TC+++S+LQCL     F    +S   Q   N+ 
Sbjct: 124 KTMVPSMERRDGL------SGLINMGSTCFMSSILQCLIHNPYFIRHSMS---QIHSNNC 174

Query: 719 KFPNTPKI-SNSFNLLFKKMYLNGGCSVVPTS-------------FLKTCNILRPDLRIP 764
           K  +  K  S + + +  ++Y  G  +    S             +L TC          
Sbjct: 175 KVRSPDKCFSCALDKIVHELY--GALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAG 232

Query: 765 DDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGN 824
             QQD  EF   I++++H      Q  V + PN       N    NK+ +          
Sbjct: 233 YSQQDAHEFWQFIINQIH------QSYVLDLPNAKEVSRAN----NKQCE---------- 272

Query: 825 GLSPIDHIFSGQMENSLQCQRC-GNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECI 883
               +  +F G +E+S+ C  C  NS      F  LSL I            + KL EC+
Sbjct: 273 --CIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIK----------DKKKLYECL 320

Query: 884 NMFTSDEVLSGENAWDCPKCGSS 906
           + F   E L   N + C +C S+
Sbjct: 321 DSFHKKEQLKDFN-YHCGECNST 342

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 64/152 (42%), Gaps = 36/152 (23%)

Query: 979  ITIKTLNFI-VLPPILVIHLSRFYYDLTKKNNTV------------------------IT 1013
            +  K   FI  LP +L+I L RF + +T  N                           +T
Sbjct: 772  VEAKKQTFIDKLPRVLLIQLKRFAF-VTNSNKDSNMSNYNAYSGRIEKIRKKIIYGHDLT 830

Query: 1014 YPL--ILNIVLKNNEVAKYRLYGIVNHSGNLI-SGHYTSLVNKEPNHDLGSKKQRWYYFD 1070
             P+  + +  L+++   +Y+L G++ H G+    GHYT+ V          +  +WY  D
Sbjct: 831  IPIESVSSTSLRDDANREYKLTGVIYHHGSSPDGGHYTADV-------FHQQTNKWYRID 883

Query: 1071 DETVKEERNHGDMDKGILQVSSRDVYVLFYER 1102
            D  + E +N   +D     + +R  Y+L YE+
Sbjct: 884  DVNISELKNDHVLDADDNDMGTRTAYILIYEK 915

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 702

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 50/102 (49%), Gaps = 15/102 (14%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDLTK--KNNTVITYPLILNI---VLKNNEVA-KYRLY 1033
             IK  + +  P  L++HL +F ++ T   K    ++YP+ L++    ++  E+  KY+L 
Sbjct: 531  AIKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTDYCVEGKELPLKYQLI 590

Query: 1034 GIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
             +V H G +L SGHY     +   H        W  +DDE +
Sbjct: 591  TVVVHEGRSLSSGHYIVHCKQPEGH--------WATYDDEYI 624

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 50/111 (45%), Gaps = 10/111 (9%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKMY 738
           G +N G TCY+NS+LQ  F T+LFR +          +D++ PN     +S +L  ++ +
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMVY-----KIPSDNESPN-----DSVSLALQRSF 252

Query: 739 LNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQ 789
                S  P   L+       D      Q D QE   I++DRL   +   +
Sbjct: 253 YLLEKSKEPLDTLELTRSFGWDTGEAFTQHDVQELNRILMDRLETRMKGTE 303

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (49%), Gaps = 19/105 (18%)

Query: 982  KTLNFIVLPPILVIHLSRFYYD-----LTKKNN-----TVITYPLILNIVLKNN--EVAK 1029
            K + F   PP+L + L RF YD     L K N+       I     L+  +K+N      
Sbjct: 379  KGVVFESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPYLDPDVKDNYPNTCI 438

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y L+ ++ HSG++ +GHY +++  +PN        +W+ FDD+ V
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMI--KPN-----VTDQWFRFDDDKV 476

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 70/160 (43%), Gaps = 25/160 (15%)

Query: 659 KFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLF--ISSKFQSFIN 716
           K++I  +  + N   S+   G+ N GN C+++S+LQ L   + F  +   IS +  + I 
Sbjct: 314 KYTIENVPNAGNAIDSIVPRGIVNTGNICFMSSVLQVLLYCKPFISILNVISYRTVAKIG 373

Query: 717 DSKFP------------NTPKISNSFNLLFKKMYLNG---GCS-----VVPTSFLKTCNI 756
            S  P            +     N    + K    NG   G +     + P  F KT + 
Sbjct: 374 SSVSPSLDACLELYRRFDKQTCENEKKPVPKSKLANGNNVGITPAAEPIKPDDFYKTLSK 433

Query: 757 LRP--DLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNE 794
           L    DLR    Q+D +EFL  +LD+LH+E     + +NE
Sbjct: 434 LPKFRDLRW-GHQEDAEEFLTHLLDQLHEEFITSIDALNE 472

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 56/142 (39%), Gaps = 34/142 (23%)

Query: 989  LPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLK-------NNEVA------------- 1028
            LP +L+I L RF +      + ++ Y      V K       N+E+              
Sbjct: 638  LPQVLLIQLKRFSFINNTDKDKIVNYNAYSGRVEKIRKKIHYNHELTIPKETISSVHSNF 697

Query: 1029 ------KYRLYGIVNHSGNLISG-HYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHG 1081
                  KY+L G+V H G   SG HYT+ V  +       +  +W+  DD  + E     
Sbjct: 698  YDDAGTKYKLVGVVYHHGVSPSGGHYTADVYHQ-------EMDKWFRIDDVNIAELNKEE 750

Query: 1082 DMDKGILQVSSRDVYVLFYERI 1103
             +  G     SR  Y+L Y++I
Sbjct: 751  VLKGGEDGFDSRTAYILMYQKI 772

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
            (REAL)
          Length = 788

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 62/136 (45%), Gaps = 33/136 (24%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDLTK--KNNTVITYPLILNIVLKNNEV---AKYRLYG 1034
             +K  + +  P  L++HL +F ++ T   K    ++YP+ L++    ++     KY+L  
Sbjct: 614  AVKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCDDKDLPVKYQLLS 673

Query: 1035 IVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSR 1093
            +V H G +L SGHY +   K+P+         W  +DDE +              ++S R
Sbjct: 674  VVVHEGRSLSSGHYIAHC-KQPDG-------TWATYDDEYIN-------------KISER 712

Query: 1094 DV------YVLFYERI 1103
            DV      Y L Y R+
Sbjct: 713  DVLKEPNAYYLLYTRL 728

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 30/40 (75%), Gaps = 2/40 (5%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIND 717
           TG+ N+GNTCY+NS+LQ  F+  LFR+ FI + +QS  +D
Sbjct: 758 TGINNIGNTCYLNSLLQYYFSITLFRE-FIEN-YQSIESD 795

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 98/263 (37%), Gaps = 67/263 (25%)

Query: 857  YVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDSEK 916
            YVLSL  P P     + +KR    +CI     +  L  E++  CP C +++ +TI     
Sbjct: 253  YVLSL--PNPKEVDRANNKRC---DCIVHTVFEGSL--ESSIVCPGCQNNSKTTIDPFMD 305

Query: 917  L-LNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWKS 975
            L L++   +K      + H +   K F  H                    +ST++     
Sbjct: 306  LSLDIKDKQKLYECLDSFHKKELLKDFNYH----------------CGECNSTQD----- 344

Query: 976  KKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTV---ITYPLILNIV----------- 1021
                 IK L    LP +LV+ L RF + L   N  +   I +P  LN+            
Sbjct: 345  ----AIKQLGIHRLPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESESE 400

Query: 1022 --LKNNEVAK--YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEE 1077
              + N +V    Y L GIV+H G +  GHY +               +W+ F+D  V   
Sbjct: 401  NHIGNGKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGG--------QWFKFNDSMVSSI 452

Query: 1078 RNHGDMDKGILQVSSRDVYVLFY 1100
                       +V     Y+LFY
Sbjct: 453  SQE--------EVLKEQAYLLFY 467

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 103/266 (38%), Gaps = 61/266 (22%)

Query: 657 SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
           S K  +P +E+   L      +GL N+G+TC+++S+LQCL     F      S  Q   N
Sbjct: 122 STKTMVPAMERRDGL------SGLINMGSTCFMSSILQCLIHNPYF---IRHSMRQIHSN 172

Query: 717 DSKFPNTPKI-SNSFNLLFKKMY--LNGGCSVVPTS------------FLKTCNILRPDL 761
             K  +  K  S + + +  ++Y  LN   +  P+S             L TC       
Sbjct: 173 KCKVRSPDKCFSCALDKIVHELYGVLN---TDQPSSSSSATNRQGGFIHLLTCAWKINQS 229

Query: 762 RIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNV 821
                QQD  EF   +++ +H      Q  V   PN    D  N K  +           
Sbjct: 230 LAGYSQQDAHEFWQFLINEIH------QSYVLSLPNPKEVDRANNKRCD----------- 272

Query: 822 IGNGLSPIDHIFSGQMENSLQCQRC-GNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLE 880
                  +  +F G +E+S+ C  C  NS      F  LSL I            + KL 
Sbjct: 273 -----CIVHTVFEGSLESSIVCPGCQNNSKTTIDPFMDLSLDIK----------DKQKLY 317

Query: 881 ECINMFTSDEVLSGENAWDCPKCGSS 906
           EC++ F   E+L   N + C +C S+
Sbjct: 318 ECLDSFHKKELLKDFN-YHCGECNST 342

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 56/129 (43%), Gaps = 33/129 (25%)

Query: 989  LPPILVIHLSRFYYDLTKKNN----TVITYPLILNI--VLKNNEVAKYRLYGIVNH-SGN 1041
            LP  L +HL RF Y   +  N      + YPL L++      N   +Y L GIV H  G 
Sbjct: 959  LPKTLSLHLKRFKYSEEQNCNIKLFNKVNYPLYLDVSSSFNPNINKRYELNGIVVHMGGG 1018

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVK---EE---RNHGDMDKGILQVSSRDV 1095
               GHY ++   +        K  W   DDETV+   EE   R  GD         S+D+
Sbjct: 1019 PQHGHYVAICKND--------KFGWLLMDDETVETISEETVLRCKGD---------SKDL 1061

Query: 1096 ---YVLFYE 1101
               YVLFY+
Sbjct: 1062 TTAYVLFYK 1070

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 16/21 (76%)

Query: 677 ITGLRNLGNTCYINSMLQCLF 697
           + G  N GNTCY NS+LQCL+
Sbjct: 515 VFGYENFGNTCYCNSVLQCLY 535

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 57/139 (41%), Gaps = 22/139 (15%)

Query: 974  KSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNN----TVITYPLILNI--VLKNNEV 1027
            ++++L+ +K L     P  L +HL RF Y   K  N      I YP  L +     +   
Sbjct: 502  EAERLVGLKRL-----PKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLS 556

Query: 1028 AKYRLYGIVNHSGNLIS-GHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKG 1086
             +Y L   V H G+    GHY SL   E     G     W  FDDETV+       +   
Sbjct: 557  KRYELASAVIHLGDGPQYGHYISLCKTET---FG-----WLLFDDETVEAVDEQTVL--S 606

Query: 1087 ILQVSSRDVYVLFYERIYE 1105
                +S   YVLFY  + E
Sbjct: 607  FTGENSDTAYVLFYNEVSE 625

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (62%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFIS 708
           I G  N GNTCY NS+LQC F   +FR   +S
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFRTSMLS 157

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 16/103 (15%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYD--LTKKNNTVITYPLILNIV-----LKNNEVAKYRL 1032
             IK    +  P  LV+HL +F ++   + K    ++YP+ L+I       K    AKY+L
Sbjct: 704  AIKRSTILRAPETLVVHLKKFRFNGSTSSKMKQAVSYPMYLDITEYCESSKKVLPAKYQL 763

Query: 1033 YGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
              +V H G +L SGHY +   ++P+         W  +DDE +
Sbjct: 764  LSVVVHEGRSLSSGHYIAHC-RQPDG-------TWATYDDELI 798

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 106/266 (39%), Gaps = 55/266 (20%)

Query: 657 SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFIS-SKFQSFI 715
           S K  IP + K   L      +GL N+G+TCY++ ++QCL     F    ++ S F+  I
Sbjct: 122 SSKSCIPLMSKRDGL------SGLVNMGSTCYVSCIIQCLVRNPYFLKYSLNQSHFK--I 173

Query: 716 NDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCN-----ILRPDLRIPDD---- 766
             +  P T  IS + + +    Y   G S +     KT N     +L    +I  +    
Sbjct: 174 CKTHDPTTC-ISCALDSIVTDFY---GISDLDDDVKKTNNDGLIDLLTCSWKINQNLAGY 229

Query: 767 -QQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNG 825
            QQD  EF   +L+RLH E  +     +  P      E N ++ N  Y            
Sbjct: 230 SQQDAHEFWQFLLNRLHSEYKSNIGPTDTAP----LKEGNHELCNCIYH----------- 274

Query: 826 LSPIDHIFSGQMENSLQCQRC-GNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECIN 884
                 +F G +++S+ C  C  ++      F  LSL I   ++          L EC+N
Sbjct: 275 -----KVFQGFLKSSIVCPECNSDAKTTIEPFMDLSLDIKGKNT----------LYECLN 319

Query: 885 MFTSDEVLSGENAWDCPKCGSSASST 910
            F   E L  +  + C  C +S   T
Sbjct: 320 SFHKKEQLH-DFDYHCKNCNTSQDPT 344

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 21/106 (19%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTK---KNNTVITYPLILN------IVLKNNEVAK--- 1029
            K L    L P+L+    RF + L+    K N VI +PL LN      +  +++  +K   
Sbjct: 345  KQLAVAKLSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMKDYCDVEQRDDSNSKPDL 404

Query: 1030 -YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
             Y L GI+ H+G +  GHYT++  K P       + +W  F+D  V
Sbjct: 405  IYELIGIICHTGTVNEGHYTAIC-KIP-------EGQWIKFNDSMV 442

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 64/152 (42%), Gaps = 34/152 (22%)

Query: 979  ITIKTLNFI-VLPPILVIHLSRF-YYDLTKKNNTVITY------------------PLIL 1018
            +  K   FI  LP +L+I L RF + + T K+N+++ Y                   LI+
Sbjct: 682  VEAKKQTFIDRLPQVLLIQLKRFQFINNTDKDNSMVNYNAYNGRIEKIRKKINYEHELII 741

Query: 1019 NIV------LKNNEVAKYRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDD 1071
             I          +E  +Y L G++ H G +   GHYT+ V          +  +WY  DD
Sbjct: 742  PIESISSANAYKDENRRYHLTGVIYHHGVSSDGGHYTADVYHR-------ESDKWYRIDD 794

Query: 1072 ETVKEERNHGDMDKGILQVSSRDVYVLFYERI 1103
             ++ E      +  G     SR  Y+L Y++I
Sbjct: 795  VSIIELEKEDVLKGGEESGDSRTAYILMYQKI 826

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 98/239 (41%), Gaps = 48/239 (20%)

Query: 676 SITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKF-QSFINDSKFPN-TPKISNSFNLL 733
            ++GL N+G+TCY++ ++QCL    +    F+   F Q+   + K  +    +S + + +
Sbjct: 135 GLSGLVNMGSTCYMSCIIQCL----VRNPYFLKHSFNQTHYKECKIRDPVSCLSCALDSV 190

Query: 734 FKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDD-----QQDTQEFLMIILDRLHDELSNQ 788
             ++Y       V        +IL    +I +D     QQD  EF   +++R+H E    
Sbjct: 191 VFELYGKTQKKAVDDKNGGLIDILNCTWKINEDLVGYSQQDAHEFWQFLMNRIHSE---- 246

Query: 789 QEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDH-IFSGQMENSLQCQRCG 847
                       Y  NN  ++  +  H           + I H +F G +E++++C  C 
Sbjct: 247 ------------YKLNNNTIEVPKDTHQL--------CNCIYHKVFQGFLESTIECANCR 286

Query: 848 NSSYNYSTFYV-LSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGS 905
             S   +  Y+ LSL +    +          L EC+N F   E L  +  + C  CG 
Sbjct: 287 KESKTTTEAYMDLSLDLKDKKT----------LYECLNSFHMKEELK-DFTFHCSNCGG 334

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 48/114 (42%), Gaps = 15/114 (13%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDL---TKKNNTVITYPLILNI----VLKNNEVAK--- 1029
             +K L    LPP+L++ L RF + L   + K N  I YP  L +       +NE      
Sbjct: 338  ALKQLTISKLPPVLLLQLKRFEHKLNGQSSKLNDSIEYPPYLRMNDYCQTSSNETIDSPD 397

Query: 1030 -----YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEER 1078
                 Y L G++ H+G +  GHY        N  +          D+ETV +E+
Sbjct: 398  DSDIIYELIGVICHTGTVNEGHYICSCKLANNQWVKFNDSMITIVDNETVLKEQ 451

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 64/134 (47%), Gaps = 25/134 (18%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDLTK--KNNTVITYPLILNIV-LKNNEV------AKY 1030
             +K    +  P  L++HL +F ++ T   K    ++YP+ L++    +NE        KY
Sbjct: 614  AVKRNTILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCDNEGNKKILPVKY 673

Query: 1031 RLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQ 1089
            +L  +V H G +L SGHY +   K+P+         W  +DDE + +       DK +L+
Sbjct: 674  QLISVVVHEGRSLSSGHYVAHC-KQPDG-------LWATYDDEYINK-----ISDKEVLR 720

Query: 1090 VSSRDVYVLFYERI 1103
             +  + Y L Y R+
Sbjct: 721  ET--NAYYLVYSRL 732

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
            YPL072W
          Length = 734

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 95/236 (40%), Gaps = 54/236 (22%)

Query: 833  FSGQMENSLQCQRCGNSS-YNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEV 891
            F GQ+ + L C +C NSS  N   F +  L +P+  S         KL + ++   +D +
Sbjct: 298  FGGQLADHLVCMKCTNSSKVNIHPFIIYPLTVPQAMS--------AKLSDMVSDNQTDTI 349

Query: 892  LSGENAWDCPKC----------GSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKF 941
                  + C  C          G   +    + +++L        +M+ ++E     + +
Sbjct: 350  ----EGYSCLTCKVSTIVNYEKGRGYAKCTQEEKRILKTLEDALPDMAINDELSDELTSY 405

Query: 942  FTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFY 1001
                      I+ + K     A   ST       KK + +++      P  LV+HLSR  
Sbjct: 406  ----------INSYNKDGIVGADLKST-----IVKKTVVVES------PKTLVMHLSRSM 444

Query: 1002 YDLT--KKNNTVITYPLILNI---VLKNNEVA-----KYRLYGIVNHSGNLISGHY 1047
            +D    ++N+  + +  IL     V+++N+        Y+L  IV HSG+   GHY
Sbjct: 445  FDGISYQRNSCGVAFDEILESREQVIRHNKCVGINPISYKLKAIVAHSGSHSQGHY 500

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 91/439 (20%), Positives = 158/439 (35%), Gaps = 132/439 (30%)

Query: 677  ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSF----------INDSKFPNTPKI 726
            + GL N GNTC++NS+LQ L +++       +   Q++          + + +F +  K+
Sbjct: 98   VGGLVNDGNTCFMNSVLQSLASSKTLLQFLDNEVIQAYKEAEESEDEHVAEKEFESEKKL 157

Query: 727  SNS----------------------------------FNLLFKKMY--LNGGCSVVPTSF 750
            S S                                  F+   K++   LN         +
Sbjct: 158  SESKTKPKKKVYGKRKKRLTRNAEKDALDDDQDANIEFSTTLKELLNKLNAK-HYRDRPY 216

Query: 751  LKTCNILRPDLRIPD-------DQQDTQEFLMIILDRLHDEL-------SNQQEV---VN 793
             KT  +L+   + P+       DQ+D QEF   IL  L   +       S  +E     +
Sbjct: 217  FKTNKLLKTMSKAPNKSIILGYDQEDAQEFFQTILSELEKNVKSLYGKSSKDEEAPVQFD 276

Query: 794  EYPNLLLYDENNLKVQNKEY--KHWFDKNVI-----GNGLSPIDHI--FSGQMENSLQCQ 844
            + P   +  +  L      Y      D N +      +  SP   I    G     + C 
Sbjct: 277  QLPEDSMVGQERLGEMGTVYIPTEQIDPNCVLAHENKSLYSPFKLITPLDGLTAERIGCL 336

Query: 845  RCG-NSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
            +CG N    YS F  LSL +P  +  +      +KL E +  +   E++ G    +C +C
Sbjct: 337  QCGENGGIRYSVFSGLSLNLPSENLGS-----TLKLSELLREWIKPEIIEG---VECNRC 388

Query: 904  GSSA------------SSTISDSEKLLNVTSSKKKNMSS-----HNEHHRYKSKFFTLHT 946
              +A              +   SEKL+    ++ + +         +   YK     LHT
Sbjct: 389  ALNAVLEHLEKTLIQYEGSEHSSEKLVAAVKARVEQLKDILAKPAIDDDDYKK----LHT 444

Query: 947  RSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYD--- 1003
             +        +K S             KSK++I  +       PP+L IH++R  +D   
Sbjct: 445  EN------MVRKCS-------------KSKQIIISRP------PPLLCIHINRSVFDPRT 479

Query: 1004 -LTKKNNTVITYPLILNIV 1021
             + +KNN+ + +   LN+ 
Sbjct: 480  YMIRKNNSRVLFKSKLNLA 498

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (47%), Gaps = 19/105 (18%)

Query: 981  IKTLNFIVLPPILVIHLSRFYYDL---TKKNNTVITYPLILNI--------VLKNNEVAK 1029
            I+ L    LPP+L++ L RF + +   + K N  I++PL LN+         L       
Sbjct: 349  IRQLTTAKLPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKPVDCLHPVPNMM 408

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y+L  I++H G +  GHYT++     N D+      W  F+D  V
Sbjct: 409  YKLSAIISHHGTVHQGHYTTIC--RINGDI------WAKFNDSMV 445

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 8/74 (10%)

Query: 1030 YRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGIL 1088
            Y+L G+V H G +   GHYT+ V       L   +++WY  DD TV E      +  G  
Sbjct: 767  YKLTGVVYHHGLSSSGGHYTADV-------LHQDEEKWYRIDDTTVTEINKEEVVTGGEE 819

Query: 1089 QVSSRDVYVLFYER 1102
               SR  Y+L Y+R
Sbjct: 820  GSHSRTAYILIYQR 833

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
            YER151C (REAL)
          Length = 910

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 90/399 (22%), Positives = 159/399 (39%), Gaps = 87/399 (21%)

Query: 744  SVVPTSFLKTCNILRP--DLRIPDDQQDTQEFLMIILDRLHDELSNQQEVV--NEYPNLL 799
            +V P  F KT + +    DL+    Q+D +EFL  +LD+LH+EL +  + +  NE  N+L
Sbjct: 557  AVKPDEFYKTLSTIPKFKDLQW-GHQEDAEEFLTHLLDQLHEELISAIDGLSDNEIQNML 615

Query: 800  LYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVL 859
                    + +++ K +F +N+   G +      + +++  ++     N        +  
Sbjct: 616  Q------SINDEQLKIFFIRNLSRYGKAEFIKNATPKLKELIETHGMINDDSTEENGWHE 669

Query: 860  SLAIPKPSSTTFSRSKRVKLEECINMFTS--DEVLSGE--NAWDCPKCGSSASSTISDSE 915
                 K    T + +KR      + +  S   ++  G+  +  D P    S S T+   +
Sbjct: 670  VSGSSKRGKKTKTAAKRT-----VEIVPSPISKLFGGQFRSVLDVPNNKESQSITLDPFQ 724

Query: 916  KL-LNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWK 974
             + L+++ S      S N+      KF      S   + PF+         SS+ N+   
Sbjct: 725  TIQLDISDS------SVNDLETAFKKF------SEYELLPFK---------SSSGND--- 760

Query: 975  SKKLITIKTLNFI-VLPPILVIHLSRF-YYDLTKKNNTVITY------------------ 1014
                +  K   FI  LP +L+I   RF + +   K+N +  Y                  
Sbjct: 761  ----VEAKKQTFIDKLPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDH 816

Query: 1015 PLIL------NIVLKNNEVAK----YRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKK 1063
             LI+      +I LKN+        Y+L G++ H G     GHYT+ V         S+ 
Sbjct: 817  ELIIPEESMSSITLKNHTSGADDRIYKLTGVIYHHGVGSDGGHYTADV-------YHSEH 869

Query: 1064 QRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYER 1102
             +WY  DD  + E  +   +  G     SR  Y+L Y++
Sbjct: 870  NKWYRIDDVNITELEDDDVLKGGEEASDSRTAYILMYQK 908

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 23/32 (71%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSK 710
           G +N+GNTCY+NS LQ LF   + +D+ ++ K
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMILNYK 141

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 1030 YRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKE 1076
            Y L GI+ H G N  SGHY S +  E + D      +WY F+D+ V E
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDENDED------KWYKFNDDKVSE 477

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
            YNL186W
          Length = 661

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 65/140 (46%), Gaps = 37/140 (26%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDLTK--KNNTVITYPLILNIV--LKNNEV-----AKY 1030
             +K  + I  P  L+ HL +F ++ T   K    ++YP+ L++    ++NE       KY
Sbjct: 490  AVKRSSIIRAPETLLTHLKKFRFNGTASSKMKQAVSYPMFLDLTEYCESNEKDHVVPVKY 549

Query: 1031 RLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQ 1089
            +L  +V H G +L SGHY  +  K+P+   G+    W  +DDE +              +
Sbjct: 550  QLTTVVVHEGRSLSSGHYI-VHCKQPD---GT----WATYDDEYIN-------------K 588

Query: 1090 VSSRDV------YVLFYERI 1103
            ++ RDV      Y L Y R+
Sbjct: 589  ITERDVLKEPNAYYLLYTRL 608

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 38/84 (45%), Gaps = 3/84 (3%)

Query: 646 HQERESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDL 705
           HQ  E  +    ++ +    E  P    S  I G  N GNTCY NS+LQCLF    FR  
Sbjct: 90  HQAIEEFLDIDIKRITPSISEVLPYGDGSNKIFGYENFGNTCYCNSILQCLFFLDDFRID 149

Query: 706 FISSKFQSFINDSKFP---NTPKI 726
            +    +  I+  K     NTP+I
Sbjct: 150 ILKHPRKESIDGRKLKYSGNTPRI 173

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 55/123 (44%), Gaps = 17/123 (13%)

Query: 989  LPPILVIHLSRFYYDLTKKNNT----VITYPLILNIVLKNNEV--AKYRLYGI-VNHSGN 1041
            LP  L +HL RF Y   K  NT     I YPLIL++    N+    KY L  I V+  G 
Sbjct: 504  LPHTLALHLKRFKYLEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELISIVVHLGGG 563

Query: 1042 LISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSR-DVYVLFY 1100
               GHY S+          S K  W  FDDETV E  N   + K +     +   YVLFY
Sbjct: 564  PHHGHYVSICK--------SDKFGWLLFDDETV-ESINEETVLKFVGDPEDQTTAYVLFY 614

Query: 1101 ERI 1103
              I
Sbjct: 615  REI 617

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 43/102 (42%), Gaps = 6/102 (5%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKMY 738
           G+ NLGNTCY+N+ LQ LF     R+  +    +  I +       ++     + F+K+ 
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIKEGVDTYHAQLVRELKVTFQKLK 162

Query: 739 LNGGCSVVPTSFLKTCNILRPDLRIPD------DQQDTQEFL 774
              G ++ P   L+    + P     D       QQD +E  
Sbjct: 163 DRKGENITPLLLLEILRRVFPQFSETDPQGGFYKQQDAEELF 204

 Score = 36.2 bits (82), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 8/46 (17%)

Query: 1030 YRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
            Y L G++ H G N  SGHY + +  + +       ++WY FDD+ V
Sbjct: 415  YDLIGVITHQGANSESGHYQAFIRDDAD-------EKWYRFDDDKV 453

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 62/153 (40%), Gaps = 24/153 (15%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTP---KISNSFNLLFK 735
           G +N+GNTCY+N+ LQ L+     RD  ++  F   IN+ K        K+       F+
Sbjct: 108 GFKNMGNTCYLNATLQALYRIDDLRDAVLN--FDVSINNDKNGENETHIKLVTELKRCFE 165

Query: 736 KMYLNGGCSVVPTSFLKTCNILRPDLRIPD------DQQDTQEFL--------MIILDRL 781
            +      SV+P   L       P     D       QQD +E L        ++  D+ 
Sbjct: 166 GLKNKSFKSVMPVVLLNALRKTYPQFAERDPQSGFYKQQDAEELLTQLFHSMGIVFGDKF 225

Query: 782 HDELSNQ-----QEVVNEYPNLLLYDENNLKVQ 809
            D+   Q     ++  NE    +   EN+LK+Q
Sbjct: 226 TDDFRIQFRTTIKDTNNESDLSVREGENDLKLQ 258

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 106/254 (41%), Gaps = 45/254 (17%)

Query: 832  IFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEV 891
            IF G ++  + C+ CG  S     FY LSL + K      S  + V      N     + 
Sbjct: 569  IFGGLLKQLVTCKSCGEVSKTEQPFYDLSLHL-KGKRKLHSSEENVGT--TTNALADTDS 625

Query: 892  LSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRS 951
             + +   D     S +S T SD+    N + + ++ +          ++ F++     +S
Sbjct: 626  SNAKQTQDNLVANSISSKTTSDT----NTSFASQEGL----------TRRFSI----EKS 667

Query: 952  ISPFRKKTSPAAVPSSTKNEPWKSKKL----ITIKTLNFIVLPPILVIHLSRFYYDLT-- 1005
            I  F    +P  +    + + +  +K        K    +  P  L+IHL +F ++ T  
Sbjct: 668  IRDF---FNPELIKVDKEKKGYVCEKCNKTTNATKRSTILRAPETLLIHLKKFRFNGTSS 724

Query: 1006 KKNNTVITYPLILNIV----LKNNEV--AKYRLYGIVNHSG-NLISGHYTSLVNKEPNHD 1058
             K    ++YP+ L++        + +   KY+L  +V H G +L SGHY +   K+P+  
Sbjct: 725  SKMKQAVSYPMFLDLTEFCEAGKDSILPVKYQLLSVVVHEGRSLSSGHYIAHC-KQPD-- 781

Query: 1059 LGSKKQRWYYFDDE 1072
             GS    W  +DDE
Sbjct: 782  -GS----WATYDDE 790

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
           G +N+GNTCY+N+ LQ LF     R+L ++   ++F N
Sbjct: 109 GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTN 146

>KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {ON}
            Anc_8.202 YER151C
          Length = 829

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 63/152 (41%), Gaps = 38/152 (25%)

Query: 979  ITIKTLNFI-VLPPILVIHLSRFYY--------DLTKKN--NTVI---------TYPLIL 1018
            +  K   FI  LP +L+I L RF +        D+T  N  N  I          + LI+
Sbjct: 687  VEAKKQTFIDKLPEVLLIQLKRFSFVSNVGKSNDMTNYNAYNGRIEKIRKKINYGHELII 746

Query: 1019 -------NIVLKNNEVAKYRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFD 1070
                   N  + N E   Y L G++ H G +   GHYT+ V       L S+ ++WY  D
Sbjct: 747  PSESVSSNATMSNRE---YSLTGVIYHHGLSPDGGHYTADV-------LHSESKKWYRID 796

Query: 1071 DETVKEERNHGDMDKGILQVSSRDVYVLFYER 1102
            D  + E      +  G     SR  Y+L Y++
Sbjct: 797  DVNINELEEDDVLKGGEEDNDSRTAYILMYQK 828

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (70%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFIS 708
           TGL N+GNTCY+NS+LQ  FA    RD  I+
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 47/113 (41%), Gaps = 27/113 (23%)

Query: 981  IKTLNFIVLPPILVIHLSRFYYDL---TKKNNTVITYPLILNIVL----KNNEVAK---- 1029
            IK L    L P+LV  L RF + L   T K N  I YPL LN+       NN+  +    
Sbjct: 365  IKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESN 424

Query: 1030 --------YRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETV 1074
                    Y L  I++H G +  GHY  +V             +W+ F+D  V
Sbjct: 425  SENVPDMIYELTSIISHKGTVNEGHYIVVVKVNDG--------QWFKFNDSMV 469

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 118/263 (44%), Gaps = 36/263 (13%)

Query: 657 SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
           S+K  I + E+   L+      GL N+G+TC+++S+LQ L       +    S  Q+  N
Sbjct: 122 SKKTHITSQERKDGLF------GLVNMGSTCFMSSILQTLIHNPYVVNY---SMCQTHYN 172

Query: 717 DSKFPN-TPKISNSFNLLFKKMYL--NGGCSVVPTSFLKTCNILRPDLRIPDD-----QQ 768
             +  N     S + +L+  + Y   + G +   T F+   ++L   L++ ++     QQ
Sbjct: 173 MCQSKNPLSCTSCALDLIITEFYATESKGNNSSHTGFI---SLLNSLLQVNENFAGYSQQ 229

Query: 769 DTQEFLMIILDRLHDELS-NQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLS 827
           D  EFL  IL+++H++   N  E VN      +  +     QN    +    ++ GN +S
Sbjct: 230 DAHEFLQFILNQIHNDYKLNSMEDVNSGNTTAIAMKTLPGTQNSNNNNNNTNHIHGNDVS 289

Query: 828 --PIDHI-FSGQMENSLQCQRCGNSS-YNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECI 883
              + H  F G +++S+ C +C N S      F  LSL +   S+          L +C+
Sbjct: 290 CKCLSHSNFQGSLKSSILCPQCNNDSKTTIDPFMDLSLDVKDKSN----------LYQCL 339

Query: 884 NMFTSDEVLSGENAWDCPKCGSS 906
           + F   E L   N + C +C S+
Sbjct: 340 DSFHKLEKLHDFN-FHCSECNST 361

>Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON}
            YER151C (REAL)
          Length = 905

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 67/164 (40%), Gaps = 40/164 (24%)

Query: 972  PWKSKKL--ITIKTLNFI-VLPPILVIHLSRF-YYDLTKKNNTVITY------------- 1014
            P+KS     +  K   FI  LP +L+I   RF + +   K+N +  Y             
Sbjct: 747  PFKSSSGNDVEAKKQTFIDKLPQVLLIQFKRFSFINNVDKDNAMTNYNAYNGRIEKIRKK 806

Query: 1015 -----PLIL------NIVLKNNEVA----KYRLYGIVNHSG-NLISGHYTSLVNKEPNHD 1058
                  LI+      +I LKN+        Y+L G++ H G +   GHYT+ V       
Sbjct: 807  IKYGHELIIPEESMSSITLKNHATGIADRNYKLTGVIYHHGISSDGGHYTADV------- 859

Query: 1059 LGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYER 1102
              S+  +WY  DD  + E  +   +  G     SR  Y+L Y++
Sbjct: 860  YHSEHNKWYRIDDVNIIELEDDDVLKGGEEASDSRTAYILMYQK 903

>Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt, 250
            aa]
          Length = 249

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 14/80 (17%)

Query: 1025 NEVAKYRLYGIVNHSGNLI-SGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDM 1083
            NE  KY+L  +V H GN + SGHY + + KE  +      +RW  ++DE +    +    
Sbjct: 182  NEPGKYKLTSVVCHKGNSVQSGHYVAFIKKEIEN-----VERWVLYNDEKIVIAED---- 232

Query: 1084 DKGILQVSSRDVYVLFYERI 1103
                L+  S++ Y+  Y R+
Sbjct: 233  ----LEELSKNGYIYIYSRV 248

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 69/145 (47%), Gaps = 20/145 (13%)

Query: 678 TGLRNLGNTCYINSMLQCLF--------ATRLFRDLFISSKFQSFINDSKFPNTPKISNS 729
            GL NLGN+CY+NS+LQC +           L  +  +S  + S  N+ K     K++N+
Sbjct: 326 VGLINLGNSCYLNSILQCFYNGGIPNWSVEELGTEFPLSVVYPS--NNLKC-QLLKLTNA 382

Query: 730 FNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQ 789
             +    +Y NG   + PT+F K       +    + QQD  EFL  ++D L +++ N  
Sbjct: 383 MKIE-SDLYPNG---IKPTAFKKCIGGSHNEFS-SNRQQDAMEFLTYMIDVLDNKIFNTA 437

Query: 790 EVVNEYPNLLLYDENNLKVQNKEYK 814
              N+    ++ D    K+Q ++ K
Sbjct: 438 NNPNDTMRFIMED----KIQCQKCK 458

>KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some
            similarities with uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 774

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 43/88 (48%), Gaps = 11/88 (12%)

Query: 1019 NIVLKNN--EVAKYRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVK 1075
            N+V  +N  E  KY L G++ H G +   GHYT  V    + DL     +WY  DD  V 
Sbjct: 692  NLVSTSNSEESFKYYLSGVIYHHGVSPSGGHYTCDVY---DKDL----DKWYRIDDVNVD 744

Query: 1076 EERNHGD-MDKGILQVSSRDVYVLFYER 1102
            E +N  D +  G     SR  Y+L YE+
Sbjct: 745  EIKNKEDILRSGDSASDSRTAYILLYEK 772

 Score = 35.8 bits (81), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 60/142 (42%), Gaps = 24/142 (16%)

Query: 667 KSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLF-------------ISSKFQS 713
           K+  L   L   G+ N G+ C+I+S+LQ L   R F +L              +S    +
Sbjct: 326 KAKKLITELVPRGIYNKGSICFISSVLQLLIHCRSFVNLLNVIHTTTVSRTNSVSPLLNA 385

Query: 714 FINDSKFPNTPKISNSFN-------LLFKKMYLNGGC-SVVPTSFLKTCNILRPDLR--I 763
            ++  K  +   I N  N          K   LN    S+ P  F K+ + L P  +   
Sbjct: 386 CMDVFKRFDRETIVNELNETRENSKTKSKSSNLNENIISIDPEPFYKSISTL-PKFKDLT 444

Query: 764 PDDQQDTQEFLMIILDRLHDEL 785
              Q+D +EFL  +LD+LH+E 
Sbjct: 445 WGRQEDAEEFLTHMLDQLHEEF 466

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 73/193 (37%), Gaps = 47/193 (24%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRL--FRDLFISSKFQSFINDSKFPNTPKISNSFNLLFK 735
            GL NLGN+CY+NS+LQ L    +  +   F+ S+F     D  +P +        LL  
Sbjct: 323 CGLINLGNSCYLNSVLQSLLNGGVPNWSLDFLGSEFPL---DVVYPASNLKCQWIKLLNA 379

Query: 736 -----KMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQE 790
                ++Y NG   + PT+F K       +    + QQD  EFL  + D L  +  +   
Sbjct: 380 MKCEPEIYPNG---IKPTTFKKCVGKSHEEFS-SNRQQDAMEFLTFLSDLLDRKFFSDSS 435

Query: 791 VVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSS 850
             +  PN L+                                    ME+ LQC +CG   
Sbjct: 436 SADSNPNDLV---------------------------------RFMMEDRLQCNKCGKVK 462

Query: 851 YNYSTFYVLSLAI 863
           Y+Y     + L +
Sbjct: 463 YSYEPAEAIQLPL 475

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
            similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 96/244 (39%), Gaps = 70/244 (28%)

Query: 833  FSGQMENSLQCQRCGNSS-YNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEV 891
            F G++ + L C  C NSS    + F +L LA+P+  +         KL E   M + ++V
Sbjct: 335  FRGKVADHLVCTACRNSSKVRVTQFNMLPLAVPQAIT--------AKLAE---MVSDNQV 383

Query: 892  LSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRS 951
             S E  + C  C            K+L             NE  R  S + T    +  S
Sbjct: 384  ESIE-GYSCLTCKVG---------KIL------------ENEKGRDTSSYETTEQNTLAS 421

Query: 952  ISPFRKKTSPAAVPSSTKNE-----------PWKSKKLITIKTLNFIV-------LPPIL 993
            ++         A P+ T N+            +    L+T +  + IV        P +L
Sbjct: 422  LA--------RAFPNLTINDDVSEELMNYINGYNRDGLVTSQLKSTIVKKNVVVDAPQVL 473

Query: 994  VIHLSRFYYDLTK--KNNTVITYPLILNI---VLKNNEV-----AKYRLYGIVNHSGNLI 1043
            +IHLSR  ++ T   +N   + +  IL +   V++N+         Y L  IV H+G+  
Sbjct: 474  LIHLSRSMFNGTNYTRNPCAVNFDEILQLQEQVIQNDRCVGINSVNYELKAIVKHAGSHS 533

Query: 1044 SGHY 1047
             GHY
Sbjct: 534  QGHY 537

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 55/132 (41%), Gaps = 27/132 (20%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYDLTK---KNNTVITYPLILNI----VLKNNEV----A 1028
             IK L+   LP +LV+ L RF + L     K N  I YP  LN+       +++V     
Sbjct: 342  AIKRLSIYKLPSVLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNMRDYCSSGDSDVDVPDL 401

Query: 1029 KYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGIL 1088
             Y L G+V H G +  GHY +              ++W+ F+D  V        +++   
Sbjct: 402  IYELIGVVAHKGTVNEGHYVATTK--------VAGRQWFKFNDSMVSSVTQEEALNE--- 450

Query: 1089 QVSSRDVYVLFY 1100
                   Y+LFY
Sbjct: 451  -----QAYLLFY 457

 Score = 35.8 bits (81), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 105/264 (39%), Gaps = 60/264 (22%)

Query: 657 SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
           S K  +P++E+   L+      GL NLG+TC+++S+LQ L     F +  IS       +
Sbjct: 122 SIKTVVPSVERRDGLH------GLLNLGSTCFMSSILQILIRNPYFFNFSISQS-----H 170

Query: 717 DSKFP-NTPK--ISNSFNLLFKKMYLNGGCS---VVPTSFLKT-CNILRPDLRIPDD--- 766
             K P   PK  IS +   +  + Y +   S   V P +       +L    +I ++   
Sbjct: 171 SKKCPIQDPKSCISCALEKMVCEFYGSSAYSTGDVEPQAMYSGFIGLLVCSWKINENLAG 230

Query: 767 --QQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGN 824
             QQD  EF   +L++LH +    Q    +  N  + D+                     
Sbjct: 231 YSQQDAHEFWQFLLNQLHHDF---QVCSGKGVNDAISDDL-------------------- 267

Query: 825 GLSPIDH-IFSGQMENSLQCQRCGNSS-YNYSTFYVLSLAIPKPSSTTFSRSKRVKLEEC 882
             + I H  F G +++S+ C  C N S      F  LSL I   S+          L  C
Sbjct: 268 -CTCIAHSTFQGLLKSSIVCPDCQNDSKTTIDPFMDLSLDIKDKSN----------LYNC 316

Query: 883 INMFTSDEVLSGENAWDCPKCGSS 906
           ++ F   E L   N + CP C +S
Sbjct: 317 LDSFHKKERLHDFN-YHCPNCNTS 339

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 770

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 53/113 (46%), Gaps = 13/113 (11%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTP------KISNSFNL 732
           GL NLGN+CY+NS+LQ L    + R+  +     SF  D  +P T       KI N+  L
Sbjct: 317 GLLNLGNSCYLNSVLQVLLNGGI-RNWNLDG-LGSFPTDVVYPRTNLHCQLIKIRNAMTL 374

Query: 733 LFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDEL 785
             +  Y  G   + PT+F K       +      QQD+ EF   + D+L  E+
Sbjct: 375 Q-QSRYPEG---IKPTTFKKVIGGSHEEFS-SGRQQDSLEFFSYLSDKLDREI 422

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 9/62 (14%)

Query: 1028 AKYRLYGIVNHSGNLI-SGHYTSLVNKEPNHDLGSKKQRWYYFDDETV---KEERNHGDM 1083
            AKY+L  ++ H GN + SGHY + + K     +   K++W  ++DE +    +E N  D+
Sbjct: 703  AKYKLTAVICHKGNSVHSGHYVAFIKK-----VVEGKEQWVLYNDEKILLANDEPNFEDI 757

Query: 1084 DK 1085
            +K
Sbjct: 758  EK 759

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFI 707
            GL N+GNTCY+NS+LQ  F+ +  RD  +
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFIL 791

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 2/39 (5%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716
           TGL N+GNTCY+NS+LQ  F+    RD  ++  +Q  +N
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRDYVLN--YQKMLN 737

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIND 717
           TG+ N+GNTCY+NS+LQ  FA    R+  +  ++Q  I D
Sbjct: 722 TGINNIGNTCYLNSLLQFYFAISPLREYIV--QYQKTIAD 759

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 61/286 (21%), Positives = 117/286 (40%), Gaps = 47/286 (16%)

Query: 784  ELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQC 843
            +LS  Q   +E+  LLL     L+ ++ E       +    GL+       G + ++L C
Sbjct: 207  KLSRGQNDAHEFTQLLL---ETLEKEHTELSLMLKGDKRLEGLAVPAFPIRGSLADNLVC 263

Query: 844  QRCGNSS-YNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTS-----DEVLSGENA 897
             RCG SS  N   F + +L +P  +S            E I+ +T        +L+ E  
Sbjct: 264  LRCGGSSKVNVHQFSMHTLPVPNATSADLRDMLFDNQTETIDDYTCVSCQIRAILATEKN 323

Query: 898  WDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRK 957
                   S+  + I +  +L         ++S + +   + + + + + + H  I+   K
Sbjct: 324  RGRQGVDSTELAIIEELARL-------APSISINEDMPPHLAAYVSAYNKDH-CITAALK 375

Query: 958  KTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLT--KKNNTVITYP 1015
             T                K+ +++ +      P +L++HLSR  ++     KN   +T+P
Sbjct: 376  ST--------------IVKRTVSVDS------PRVLILHLSRSVFNGVSYAKNTCNVTFP 415

Query: 1016 --LILN-IVLKNNE-----VAKYRLYGIVNHSGNLISGHYTSLVNK 1053
              L++N  +L+NN+       +Y+L  ++ H G    GHY    +K
Sbjct: 416  EELVINEQLLENNKCVGVRAVRYKLCAMIKHIGTHSQGHYACFRHK 461

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 124/319 (38%), Gaps = 84/319 (26%)

Query: 750  FLKTCNILRPDLRIPD-------DQQDTQEFLMIILDRLHDEL---------SNQQEVVN 793
            + KT  +L+   + P+       DQ+D QEF   IL  L   +          N+   + 
Sbjct: 216  YFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELA 275

Query: 794  EYPNLLLYDENNLKVQNKEY--KHWFDKN-VIGNGLS----PIDHI--FSGQMENSLQCQ 844
            + P   +  +  L      Y      D N V+G+       P D +    G     + C 
Sbjct: 276  DIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCL 335

Query: 845  RCG-NSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
            +CG N    YS F  LSL +  PS T  S    +KL + +  +   E++ G    +C +C
Sbjct: 336  QCGENGGIRYSVFSGLSLNL--PSDTVGS---ALKLSQLLREWVKPEIIEG---VECNRC 387

Query: 904  GSSA----------SSTISD--SEKLLNVTSSKKKNMSS-----HNEHHRYKSKFFTLHT 946
               A             I+D  SEKL++  SS+ + + +       +   YK     LHT
Sbjct: 388  ALKAVLEHLEKTLTQYEINDKVSEKLVSAVSSRVEELKAILAKPVVDDDDYKK----LHT 443

Query: 947  RSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYD--- 1003
             +        +K S             KSK+++  +       PP+L IH++R  +D   
Sbjct: 444  EN------MVRKCS-------------KSKQILISRP------PPLLSIHINRSVFDPRT 478

Query: 1004 -LTKKNNTVITYPLILNIV 1021
               +KNN+ + +   LN+ 
Sbjct: 479  YTIRKNNSKVLFKSRLNLA 497

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSK--FQSFINDSKF 720
           TGL N+GNTCY+NS+LQ  F+    R   +  +   Q F+N+ ++
Sbjct: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEY 777

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 39.7 bits (91), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 55/128 (42%), Gaps = 20/128 (15%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDL--FISSKFQSFINDSKFPNTPKISNSFNLLFKK 736
           G+ N GN C+++S+LQ L     F +L   IS K  + +  + F         +    K+
Sbjct: 348 GIVNTGNICFMSSILQVLLFCEPFVNLMNLISVKTSAKMGSTGFLLLDACLELYRKFDKQ 407

Query: 737 MYLNGGCS---------------VVPTSFLKTCNILRP--DLRIPDDQQDTQEFLMIILD 779
            +     S               + P  F KT + L    DLR    Q+D +EFL  +LD
Sbjct: 408 AFEREKASRSSSGVNISSALADAIKPDDFYKTLSKLPKFKDLRW-GHQEDAEEFLTHLLD 466

Query: 780 RLHDELSN 787
           +LH+E  N
Sbjct: 467 QLHEEFVN 474

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 8/75 (10%)

Query: 1030 YRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGIL 1088
            Y+L G+V H G +   GHYT  V +E          +WY  DD  V+E      +  G  
Sbjct: 714  YKLIGVVYHHGVSPSGGHYTCDVYQE-------TLNKWYRIDDTNVQEIEKDEVLKGGEE 766

Query: 1089 QVSSRDVYVLFYERI 1103
               SR  Y+L Y+++
Sbjct: 767  GNDSRTAYILIYQKL 781

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
           (UBP3) - Ubiquitin-specific protease [contig 231]
           PARTIAL
          Length = 444

 Score = 39.3 bits (90), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 59/136 (43%), Gaps = 39/136 (28%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLF---- 734
           G+ N GN C+++S+LQ L    LF + F+S      +N      + K+ N+  LL     
Sbjct: 10  GIVNSGNICFMSSILQVL----LFCEPFVS-----LMNLISIKTSAKMGNTGFLLLDACL 60

Query: 735 --------------KKMYLNGGCSVV---------PTSFLKTCNIL--RPDLRIPDDQQD 769
                         K   +N G S +         P  F KT + L    DLR    Q+D
Sbjct: 61  ELYRKFDKVTFEREKAARINAGNSGISSALADAIKPDDFYKTLSKLPKFKDLRW-GHQED 119

Query: 770 TQEFLMIILDRLHDEL 785
            +EFL  +LD+LH+E 
Sbjct: 120 AEEFLTHLLDQLHEEF 135

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 1030 YRLYGIVNHSGNLISG-HYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGIL 1088
            Y+L G+V H G   SG HYT  V +E        +++W+  DD  V+E      +  G  
Sbjct: 377  YKLIGVVYHHGVSSSGGHYTCDVYQEA-------QKKWFRIDDINVQEIEMEEVLQPGEE 429

Query: 1089 QVSSRDVYVLFYERI 1103
               SR  Y+L Y+++
Sbjct: 430  GSDSRTAYILIYQKL 444

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 89/409 (21%), Positives = 159/409 (38%), Gaps = 91/409 (22%)

Query: 677  ITGLRNLGNTCYINSMLQCLFATR---LFRDLFISSKFQ--------SFINDSKFPNTPK 725
            I GL N GNTC++N +LQ + +++    F D  I+ K +          +N+ K  NT K
Sbjct: 84   IGGLVNDGNTCFMNCVLQSMASSKELLKFLDEEIACKAKLDEDQSNGDDVNNEKPHNTSK 143

Query: 726  ISN----------------SFNLLFKKMY--LNGGCSVVPTSFLKTCNILRPDLRIPD-- 765
                               +F+   K++   LN         + K   +L+   + P+  
Sbjct: 144  QQQKREEEAKSEGETVPDVTFSAALKELLDKLNAKY-YRDRPYFKANKLLKSMSKAPNKN 202

Query: 766  -----DQQDTQEFLMIILDRLH------DELSNQQEVVNE--YPNLLLYDENNLKVQNKE 812
                 DQ+D QEF   +L  L       D  +  +  + E   P   +  +  L      
Sbjct: 203  ILLGYDQEDAQEFFQTMLSELEKNAKSLDNTTIDKHAILEKDLPETAVIGQARLDHVGAV 262

Query: 813  Y--KHWFDKNVIGNG-----------LSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVL 859
            Y        N+I  G           ++P+D I + ++   LQC   G   Y+ S+   L
Sbjct: 263  YIPTEQVTPNLIPPGSKEKYFTKFKLITPLDGILAERI-GCLQCGETGGIRYSVSSGLSL 321

Query: 860  SLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTISDS-EKLL 918
            +L    PS    S    +KL + +  +   E++ G    +C +C   A   + D  ++ L
Sbjct: 322  NL----PSDNMGSS---LKLSDLLKDYIKPEIIEG---VECNRC---ALIAVRDHLKEQL 368

Query: 919  NVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSI---SPFRKKTSPAAVPSSTKNEPWKS 975
                 KK N         ++S+   L     + +     ++K  +   V  S+K     S
Sbjct: 369  QQYEDKKANAIPAKLCQAFQSRIQELEKVLSKPVIDDEEYKKLHTENMVRKSSK-----S 423

Query: 976  KKLITIKTLNFIVLPPILVIHLSRFYYD----LTKKNNTVITYPLILNI 1020
            K+++  +       PP+L IH++R  +D    + +KNN  + +   LN+
Sbjct: 424  KQVLISRP------PPLLAIHINRSVFDPRTFMIRKNNARVLFKSRLNL 466

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
            (REAL)
          Length = 503

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 96/456 (21%), Positives = 157/456 (34%), Gaps = 116/456 (25%)

Query: 678  TGLRNLGNTCYINSMLQCLFATRLFRDLF--ISSKFQSF--------------------- 714
             GL N GN C+I S LQ L     F +    I S  Q                       
Sbjct: 58   VGLINRGNDCFITSALQALAGIPRFVEYLNGIKSILQELNNPELKSFSRSTRENPTADNI 117

Query: 715  INDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDL------RIPDDQQ 768
             NDS+  N    S   +    ++ +    SV  +    +  I+   L      ++   Q 
Sbjct: 118  ANDSRLENFSDSSTPLHESLMRL-IADLVSVRESKMTISPKIVVNALESIFKSKMSSKQN 176

Query: 769  DTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSP 828
            D  EF +I+L  L +E S    +V    ++L  D  N                       
Sbjct: 177  DAHEFTVILLQTLQEEHS---RLVKHTKHMLNVDVPNFP--------------------- 212

Query: 829  IDHIFSGQMENSLQCQRC-GNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFT 887
                F G+    L C +C G S  ++   ++  L++P+ SS           E  +++ +
Sbjct: 213  ----FEGETSKFLVCVQCNGLSKISHQKTFIRELSVPQKSS-----------ENLLDILS 257

Query: 888  SDEVLSGENAWDCPKCGSSA----------SSTISDSEKLLNVTSSKKKNMSSHNEHHRY 937
            +DE    E+ + C  C + A               D   +L+         S + +    
Sbjct: 258  NDETEIIED-YSCLICRARAILAHEQYRNFKDCAPDELLILDALKDYATEASINEDLPLE 316

Query: 938  KSKFFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHL 997
              ++   +T+    IS  + K                 K+ I +K      LP +LVIHL
Sbjct: 317  IDQYINHYTKDKFCISNVKGKVI---------------KRDIAVK------LPKVLVIHL 355

Query: 998  SRFYYD-LTKKNN----------TVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGH 1046
            SR  ++ +T   N           +  Y  I N+ L  N    Y L  +V H+G+   GH
Sbjct: 356  SRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLTENRQIVYNLKSVVKHTGSHSRGH 415

Query: 1047 YTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGD 1082
            Y     K    D+   K+   + D  ++   RNH +
Sbjct: 416  YMCYRRK---GDILFDKEDESFVDSRSIITNRNHNE 448

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 66/169 (39%), Gaps = 39/169 (23%)

Query: 738 YLNGGCSVVPTSFLKTC---NILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNE 794
           YL G   V P  F++T    N+L   +      QD  EFL  +L+ + D L    E +  
Sbjct: 376 YLTG--VVSPIQFVETLKKENVLFSTMM----HQDAHEFLNFLLNEVSDYLGAHSEQI-- 427

Query: 795 YPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYS 854
                         Q  + K+  D N +       + +F G + N  +C  C N++Y   
Sbjct: 428 -------------AQGLDVKNPGDINFV-------NRLFQGTLTNRTKCLTCDNTTYRNE 467

Query: 855 TFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
            F   ++ + + S T         ++  +  F   E+L+G N + C  C
Sbjct: 468 PFLDFAIEVQQDSET--------DIQTTLADFHQKELLNGANKFYCDVC 508

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
            Anc_8.202 YER151C
          Length = 854

 Score = 39.3 bits (90), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 58/140 (41%), Gaps = 32/140 (22%)

Query: 989  LPPILVIHLSRF-YYDLTKKNNTVITYPLILNIVLK-------NNEVA------------ 1028
            LP +L++ L RF + +   K+N ++ Y  I   + K        +E+             
Sbjct: 722  LPQVLLVQLKRFSFVNNEDKDNNMMNYNSINGRIEKIRKKISYGHELVIPEESLSPHSWS 781

Query: 1029 ----KYRLYGIVNHSG-NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDM 1083
                KY+L G++ H G +   GHYT+ V             +WY  DD  + E +    +
Sbjct: 782  QTNRKYQLTGVIYHHGLSSDGGHYTADV-------FNKTADKWYRIDDINITELKKDDVL 834

Query: 1084 DKGILQVSSRDVYVLFYERI 1103
              G     +R  Y+L Y+++
Sbjct: 835  KGGEDGTDTRTAYILMYQKL 854

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 38.9 bits (89), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 77/194 (39%), Gaps = 47/194 (24%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTP------KISNSFN 731
            GL NLGN+CY+NS+LQ LF   +  D  +      F  D  +P+        K+ N+  
Sbjct: 322 CGLINLGNSCYMNSVLQLLFNAGV-PDWSLEQIGTEFPLDVVYPSNNILCQLIKLRNAMK 380

Query: 732 LLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEV 791
           +  ++ Y NG   + PTSF K C     +      QQD+ EF   ++++L       ++V
Sbjct: 381 IEPER-YPNG---IKPTSF-KRCIAQAHEEFSSSRQQDSMEFFTFLIEQL------DKKV 429

Query: 792 VNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSY 851
           +N++                             G  P D +    ME  LQC  C    Y
Sbjct: 430 LNKFV----------------------------GTIPTD-LLRFTMEQKLQCTSCHGVKY 460

Query: 852 NYSTFYVLSLAIPK 865
              T   + L + K
Sbjct: 461 TEQTHGCIQLPLLK 474

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFI 707
           G +N+GNTCY+N+ LQ L+     RD+ +
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMIL 138

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFIS 708
            G+ N+GNTCY+NS+LQ  F  +  RD  ++
Sbjct: 698 AGINNVGNTCYLNSLLQFFFTIKPLRDFILN 728

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFIS 708
            GL N+GNTCY+NS+LQ  FA    R+  I+
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLREYLIN 792

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 45/108 (41%), Gaps = 9/108 (8%)

Query: 676 SITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTP---KISNSFNL 732
           S  G +N+GNTCY+N+ LQ L+     RD+ ++      ++ S   +     +I      
Sbjct: 107 SPVGFKNMGNTCYLNATLQALYRVDDVRDMILNYNPSEGVSSSSAQDEETHKQIVIEMKR 166

Query: 733 LFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDD------QQDTQEFL 774
            F+ ++     SV+P   L T     P     D       QQD +E  
Sbjct: 167 CFENLHNKSFKSVLPIVLLNTLRKCYPQFAERDQQGGFYKQQDAEELF 214

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 63/135 (46%), Gaps = 28/135 (20%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNL---LF 734
            GL NLGN+CY+N++LQ LF         +SS     + D  FP T  +  S NL   L 
Sbjct: 309 CGLLNLGNSCYMNAVLQVLFNGG------VSSWSLDELGD--FP-TDVVYVSSNLKCQLI 359

Query: 735 K---------KMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDEL 785
           K         +MY NG   V P++F K C     +      QQD  EF   ++D L  +L
Sbjct: 360 KLRNALRTNPEMYPNG---VKPSTF-KDCVGGTHEEFSSGRQQDALEFFSYLIDLLDKKL 415

Query: 786 SNQQEVVNEYPNLLL 800
            N+ E    +PN L+
Sbjct: 416 FNRSEF---HPNDLM 427

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 674 SLSITGLRNLGNTCYINSMLQCLFATRLFR 703
           S  + G  N GNTCY NS+LQCL+    FR
Sbjct: 111 STKVFGYENFGNTCYCNSVLQCLYNLTEFR 140

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 62/161 (38%), Gaps = 39/161 (24%)

Query: 745 VVPTSFLKTCNILRPD--LRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYD 802
           V P++F+   NIL+ +  L      QD  EFL  +L+ L D L    E            
Sbjct: 379 VSPSNFV---NILKQENILFSSSMHQDAHEFLNYLLNELSDTLKRDME------------ 423

Query: 803 ENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLA 862
              L     E K  F           I+ +F G + NS +C  C   +     F    + 
Sbjct: 424 ---LDTDKLESKPTF-----------IEDLFKGSLCNSTKCFTCDTITARDEPFLDFPIE 469

Query: 863 IPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKC 903
           I           + +K+++ +N +   E+L+G N + C KC
Sbjct: 470 I--------QEDEEIKIQDILNNYKHRELLTGANKFYCDKC 502

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 46/101 (45%), Gaps = 15/101 (14%)

Query: 982  KTLNFIVLPPILVIHLSRFYYDLTKKNNT----VITYPLILNIVLK-NNEVAK-YRLYGI 1035
            +T+    LP  L IHL RF Y   +  N      I YPL L +    ++ V K Y L GI
Sbjct: 510  RTVGLKSLPKTLAIHLKRFKYSEARNCNAKLFNRIHYPLDLRVCSSFDSAVCKDYELNGI 569

Query: 1036 V-NHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVK 1075
            V +  G    GHY ++     N   G     W  FDDETV+
Sbjct: 570  VIHMGGGPHHGHYVAICK---NDLFG-----WLLFDDETVE 602

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFI 707
            G +N+GNTCY+N+ LQ L+     RD+ +
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVNDLRDMIL 138

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 39.3 bits (90), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 13/110 (11%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTP------KISNSFN 731
            GL NLGN+CY+NS++Q LF   + +D  +      F  D  FP+T       K+ N+  
Sbjct: 318 CGLINLGNSCYLNSVVQVLFNGGV-KDWNL-DMLGDFPRDVVFPSTNLKCQLIKLRNALK 375

Query: 732 LLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRL 781
           +  +K Y +G   V P S +K C     +      QQD  EFL   +D+L
Sbjct: 376 IHPEK-YQHG---VKPAS-VKKCIGEDNEEFSSGRQQDAMEFLTYFIDKL 420

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFI 707
            G +N+GNTCY+N+ LQ L+     RD+ +
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVDDLRDMIL 138

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 38.9 bits (89), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFIS 708
           GLRN+GNTCY N+ LQ L+  +  R+  ++
Sbjct: 107 GLRNMGNTCYFNASLQALYRIKPLREKVLA 136

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
            weakly similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072w UBP16
          Length = 483

 Score = 38.9 bits (89), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 66/163 (40%), Gaps = 46/163 (28%)

Query: 981  IKTLNFIVLPPILVIHLSRFYYDLTK--KNNTVITYPLILNIV------LKNNEVAK--- 1029
            +K   F+  P I VIHLSR  Y+     +N   + +   L+          +NE  K   
Sbjct: 326  LKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEFTKRVR 385

Query: 1030 YRLYGIVNHSGNLISGHYTSLVNK-------------EPNHDLGSKK--------QR--- 1065
            YRL  IV H+G+  SGHY  L  K                  +G KK        +R   
Sbjct: 386  YRLKSIVIHTGSHYSGHYQVLRRKPIIMKSKVSGDIVNTGTTIGEKKPTVMDSNFRRMKS 445

Query: 1066 -----WYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERI 1103
                 ++   D  VKE+R    +++       + VY+LFYERI
Sbjct: 446  TTIYPFWLISDTNVKEKRISDIVNE------QKSVYMLFYERI 482

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 38.9 bits (89), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRD 704
           TGL N+GNTCY+NS+LQ  F     RD
Sbjct: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 38.5 bits (88), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFR 703
           + GL N GNTCY NS+LQCL+  +  R
Sbjct: 98  VFGLENYGNTCYCNSVLQCLYNLKELR 124

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 829 IDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTS 888
           I  +F G M NS++C  C N + N   F+    AIP       S  + + +++ +  F  
Sbjct: 464 IHTLFQGTMNNSIKCLTCDNITSNEEPFF--DFAIP------VSEDEELNVQDILRDFHQ 515

Query: 889 DEVLSGENAWDCPKC 903
            E+L+G N + C  C
Sbjct: 516 REMLNGANKFYCDSC 530

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 42/87 (48%), Gaps = 15/87 (17%)

Query: 996  HLSRFYYDLTKKNN----TVITYPLILNIVLK-NNEVAK-YRLYGIVNH-SGNLISGHYT 1048
            HL RF Y    ++N     VI YPL L +    ++ V K Y L GIV H  G    GHY 
Sbjct: 552  HLKRFKYSEKHQSNIKLFNVIHYPLNLRVCSTFDHAVCKDYELNGIVIHMGGGPQHGHYV 611

Query: 1049 SLVNKEPNHDLGSKKQRWYYFDDETVK 1075
            ++      H+L      W  +DDETV+
Sbjct: 612  AIC----KHELFG----WLLYDDETVE 630

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 63/152 (41%), Gaps = 21/152 (13%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSK--FQSFINDSKFPNTPKISNSFNLLFKK 736
           G +N+GNTCY+N+ LQ L+ T   R + +  K   QS   + +     KI       F+ 
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMILDYKPPAQSSTYNPEDEMHHKIVLEIKRCFEN 171

Query: 737 MYLNGGCSVVPTSFLKTCNILRPDLRIPD------DQQDTQE--------FLMIILDRLH 782
           +      SV+P   L       P     D       QQD +E        F ++  D+  
Sbjct: 172 LEKKNFKSVMPMMLLTVLRKCYPQFAERDPRGGFYKQQDAEELFTQLFHTFSIVFGDKFS 231

Query: 783 DEL-----SNQQEVVNEYPNLLLYDENNLKVQ 809
           ++      +  ++  NE    +  DEN+LK+Q
Sbjct: 232 NDFTILFKTTIKDTNNEDDVQIKTDENDLKLQ 263

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFI 707
           TGL N+GNTCY+NS+LQ  F     R   +
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQFIV 732

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 644 KYHQERESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFR 703
           K  Q R SL++ R  +  I  +   P        TGL N+GNTCY+NS+LQ  F     R
Sbjct: 672 KIGQVRNSLLINRYLETGIIDVSCLP---AGNWPTGLNNIGNTCYLNSLLQYYFCISPLR 728

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin-specific
            protease
          Length = 782

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 125/288 (43%), Gaps = 43/288 (14%)

Query: 773  FLMIILDRLHDELSNQQEVVNEYPNLLL--YDENNLKVQNKEYKHWFDKNVIGNGLSPID 830
            FL +I      ++S  Q   +E   ++L   +  NL +Q       F KN   N + P  
Sbjct: 258  FLRVIEGIFKAKISTGQNDAHELTQVVLQTLENENLALQK------FVKNHSLNVIIPTF 311

Query: 831  HIFSGQMENSLQCQRCGNSS-YNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSD 889
             +  G + +SL C  CG SS  N   F + SL +P+  +          L + I+   +D
Sbjct: 312  PVH-GSLADSLFCLSCGESSKVNIHEFTMYSLPVPQLIN--------ADLAQMISDNQTD 362

Query: 890  EVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSH 949
            ++    + + C  C  +A   I  +EK  N  ++  +      E      K F ++    
Sbjct: 363  QI----SGYSCLCCKLNA---IIANEKNRNYQNNSDEENQILKELEELLPKAF-INDDLA 414

Query: 950  RSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLT--KK 1007
            R++S +        + +S      + K  I  KT+  +  P +L++HLSR  +D    +K
Sbjct: 415  RNLSTYINSYEKGGIKTS------EIKSTIVKKTV-VVDSPDVLILHLSRSVFDGMGYQK 467

Query: 1008 NNTVITY--PLILN-IVLKNNEVA-----KYRLYGIVNHSGNLISGHY 1047
            N   +++   L++N  V++NN+        Y+L  ++ H G+  +GHY
Sbjct: 468  NTCNVSFEEELVVNRQVIENNKCVGIRKDSYKLRSMLRHQGSHSTGHY 515

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFIS 708
           GL N+GNTCY+NS+LQ  FA    R+   S
Sbjct: 726 GLNNIGNTCYLNSLLQYYFAIAPLRNYICS 755

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKM 737
           GL+N+GNTCY+N+ LQ L+     R+  ++        D K  N P    S  LL +++
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLREAILNF-------DKKSGNFPADDESHFLLVQEL 156

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 66/305 (21%), Positives = 120/305 (39%), Gaps = 78/305 (25%)

Query: 758  RPDLRIPDDQQDTQEFLMIILDRLH--------DELSNQQEVVNEYPNLLLYDENNLKVQ 809
            R ++ +  DQ+D QEF   +L  L         ++L        E P   L  +NNL+  
Sbjct: 235  RKNMLLGYDQEDAQEFFQNLLAELENNIKSLNSEKLDTTPIAKTELPADALVGQNNLEKV 294

Query: 810  NKEY--KHWFDKNVIGNG-----------LSPIDHIFSGQMENSLQCQRCG-NSSYNYST 855
               Y      D N I +            ++P+D I + +    + C +CG N    YS 
Sbjct: 295  GTVYIPTEQIDPNSILHDKSIKNFTPYKLITPLDGITAER----IGCLQCGENGGIRYSV 350

Query: 856  FYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASST----- 910
            F  LSL +P  +         +KL + ++ ++  E++ G    +C +C  +A+ +     
Sbjct: 351  FSGLSLNLPNENIGC-----TLKLSQLLSDWSKPEIIEG---VECNRCALTAAHSHLLGQ 402

Query: 911  ---------ISDSEKLLNVTSSKKKNMSSHNEHHRYKSK-FFTLHTRSHRSISPFRKKTS 960
                      S  EKL+N    + + +           + +  LHT      +   +K S
Sbjct: 403  LKEFRKKPEGSIPEKLINAVEDRVQQIEEVLAKPVIDDEDYEKLHT------ANMVRKCS 456

Query: 961  PAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYD----LTKKNNTVITYPL 1016
                         KSK+++  +       PP+L IH++R  +D    + +KNN+ + +  
Sbjct: 457  -------------KSKQILISRP------PPLLSIHINRSVFDPRTYMIRKNNSKVLFKS 497

Query: 1017 ILNIV 1021
             LN+ 
Sbjct: 498  RLNLA 502

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSF 714
           I GL N GNTC++NS+LQ L ++R   D   ++  +++
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTY 137

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 87/238 (36%), Gaps = 55/238 (23%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNL--LFK 735
            GL NLGN+CY+NS+LQ LF   +  D  +      F  D  +P+T        L    K
Sbjct: 313 CGLNNLGNSCYMNSVLQVLFNGAV-PDWSLEV-LGDFPRDVVYPSTNLKCQLIKLRNAIK 370

Query: 736 KMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEY 795
           +   +    + P++F K C     +      QQD  EF    +D L              
Sbjct: 371 RNPSDYTTGIKPSTF-KRCIGESHEEFSSGRQQDAMEFFTYFIDEL-------------- 415

Query: 796 PNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHI-FSGQMENSLQCQRCGNSSYNYS 854
                                 DK +   G +P D + F+  ME+ L+C  C    Y   
Sbjct: 416 ----------------------DKKLFSRGSNPNDQLRFT--MEDRLECNNCHCVKYTEQ 451

Query: 855 TFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSSASSTIS 912
               +S AI  P        ++  L E I  +   EVL     + CP C ++  +T S
Sbjct: 452 ----VSEAIQIP---LLDNDEKQDLCERIRAYFQGEVLE----FKCPGCNATTIATKS 498

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (66%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFI 707
            G +N+GNTCY+N+ LQ L+     R++ +
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVNDLREMIL 138

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFIS 708
           TG+ N+GNTCY+NS+LQ  F     R+  ++
Sbjct: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFR 703
           TGL N+GNTCY+NS+LQ  F+    R
Sbjct: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 83/202 (41%), Gaps = 53/202 (26%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRL--FRDLFISSKFQSFINDSKFPNTPKISNSFNLLFK 735
            GL NLGN+CY+NS++Q L    +  +   F+ S+F     D  +P    +   +  LF 
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGIPNWSLDFLGSEFPL---DVVYPGN-NLKCQWIKLFN 378

Query: 736 KM------YLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSN-- 787
            M      Y NG   + PT+F K                         + + H+E S+  
Sbjct: 379 AMRCEPEFYPNG---IKPTTFKKC------------------------IGQNHEEFSSNR 411

Query: 788 QQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCG 847
           QQ+ +          E    + +   + +F  ++  +G S ++ +    ME+ LQC +CG
Sbjct: 412 QQDAM----------EFLTFLLDLLDRKFF--SIGSSGASNVNDLVRFIMEDRLQCNKCG 459

Query: 848 NSSYNYSTFYVLSLAIPKPSST 869
              Y+Y     + + + + S T
Sbjct: 460 KVKYSYEPAEAIQIPLEENSET 481

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
            UBP16Deubiquitinating enzyme anchored to the outer
            mitochondrial membrane, probably not important for
            general mitochondrial functioning, but may perform a more
            specialized function at mitochondria
          Length = 499

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 11/79 (13%)

Query: 980  TIKTLNFIVLPPILVIHLSRFYYD-LTKKNN----------TVITYPLILNIVLKNNEVA 1028
             IK    + LP IL++HLSR  ++ +T   N          T+  Y L  +  +  N   
Sbjct: 330  VIKKDVVVQLPDILIVHLSRSTFNGITYSRNPCNVKFGERITLSEYTLAESGTITENRQV 389

Query: 1029 KYRLYGIVNHSGNLISGHY 1047
            KY L  +V H+G+  SGHY
Sbjct: 390  KYNLKSVVKHTGSHSSGHY 408

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 679 GLRNLGNTCYINSMLQCLFATRLFRDLFISSK 710
           GL N+GNTCY+NS+LQ  F+    R+  ++ K
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 36.6 bits (83), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFR 703
           TG+ N+GNTCY+NS+LQ  F+    R
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 20/24 (83%)

Query: 677 ITGLRNLGNTCYINSMLQCLFATR 700
           + GL N GNTC++NS+LQCL +++
Sbjct: 83  VGGLVNDGNTCFMNSVLQCLASSK 106

 Score = 36.2 bits (82), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 87/206 (42%), Gaps = 41/206 (19%)

Query: 826  LSPIDHIFSGQMENSLQCQRCG-NSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECIN 884
            ++P+D I + +    + C +CG N    YS F  LSL +P  +  +      +KL + ++
Sbjct: 306  VTPLDGITAER----IGCLQCGENGGIRYSVFSGLSLNLPSDNIGS-----PIKLSQLLD 356

Query: 885  MFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTL 944
             ++  E++ G    DC +C  +A   +    + LN   S+               K  TL
Sbjct: 357  EWSKPEIIEG---VDCNRCALNA--VLEHLVEQLNTIQSQPD----------VNQKLVTL 401

Query: 945  HTRSHRSISPFRKKTSPAAVPSS------TKNEPWKSKKLITIKTLNFIVLPPILVIHLS 998
                   I+  +   S  A+         T+N   KS K    K +     PP+L +H++
Sbjct: 402  M---EDRINEVKSVLSKLAIDDDDYKRMHTENMVRKSSKS---KQILISRPPPLLSVHIN 455

Query: 999  RFYYD----LTKKNNTVITYPLILNI 1020
            R  +D    + +KNN+ + +   LN+
Sbjct: 456  RSVFDPRTYMIRKNNSRVIFKSKLNL 481

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFIS 708
           TG+ N+GNTCY+NS+LQ  F+    R+  + 
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLG 782

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 36.6 bits (83), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 678 TGLRNLGNTCYINSMLQCLFATRLFR 703
           TG+ N+GNTCY+NS+LQ  F+    R
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 121,509,149
Number of extensions: 5721266
Number of successful extensions: 24066
Number of sequences better than 10.0: 371
Number of HSP's gapped: 24396
Number of HSP's successfully gapped: 645
Length of query: 1105
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 985
Effective length of database: 39,721,479
Effective search space: 39125656815
Effective search space used: 39125656815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)