Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E050805.708ON55155129880.0
NCAS0A031605.708ON55255226780.0
KNAG0C066405.708ON54753626440.0
YKR097W (PCK1)5.708ON54955126250.0
Smik_11.3615.708ON54955126070.0
Skud_11.3375.708ON54955126060.0
Suva_11.3345.708ON54853626030.0
TDEL0B021205.708ON54855125780.0
CAGL0H06633g5.708ON54453525580.0
KAFR0H001605.708ON54955225480.0
SAKL0E15048g5.708ON54253225380.0
KLLA0A00484g5.708ON54355224890.0
Ecym_40135.708ON54255124540.0
ZYRO0B16456g5.708ON54855124510.0
AFR292W5.708ON54155124340.0
KLTH0E00902g5.708ON54454923550.0
Kwal_55.196635.708ON54455123070.0
TPHA0E001705.708ON57851722760.0
Kpol_1043.755.708ON55852222710.0
TBLA0E017005.708ON57656622540.0
Suva_7.275singletonON961051633e-13
ZYRO0F18722gsingletonON69968780.65
Kwal_56.242656.259ON21780741.1
NCAS0B031008.382ON53188741.9
NDAI0A01340singletonON55441705.8
TBLA0B001002.1ON171750707.4
SAKL0B05126g8.762ON706119697.4
TPHA0O006001.380ON137268699.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E05080
         (551 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...  1155   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...  1036   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...  1023   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...  1015   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...  1008   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...  1008   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...  1007   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   997   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   989   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   986   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   982   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   963   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   949   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   948   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   942   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   911   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   893   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   881   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   879   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   872   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    67   3e-13
ZYRO0F18722g Chr6 (1551987..1554086) [2100 bp, 699 aa] {ON} some...    35   0.65 
Kwal_56.24265 s56 complement(928206..928859) [654 bp, 217 aa] {O...    33   1.1  
NCAS0B03100 Chr2 (534985..536580) [1596 bp, 531 aa] {ON} Anc_8.3...    33   1.9  
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}               32   5.8  
TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YN...    32   7.4  
SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} simila...    31   7.4  
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    31   9.1  

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score = 1155 bits (2988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/551 (100%), Positives = 551/551 (100%)

Query: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60
           MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST
Sbjct: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60

Query: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120
           GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH
Sbjct: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120

Query: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180
           LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP
Sbjct: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180

Query: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240
           ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN
Sbjct: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240

Query: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300
           QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE
Sbjct: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300

Query: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360
           KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP
Sbjct: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360

Query: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420
           SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL
Sbjct: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420

Query: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480
           ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK
Sbjct: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480

Query: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540
           QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA
Sbjct: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540

Query: 541 TPEVLAAAPRI 551
           TPEVLAAAPRI
Sbjct: 541 TPEVLAAAPRI 551

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/552 (87%), Positives = 523/552 (94%), Gaps = 1/552 (0%)

Query: 1   MSPIKASNT-PIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISS 59
           MSPIK S++ PID +DS  VEQ IR+EL LS+DVTTIRRNAPAA+LYEDALHER T+I+S
Sbjct: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60

Query: 60  TGALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRD 119
           +GAL+AYSG KTGRSPRDKRIVEEETSKD++WWGPVNKPCSE+TW+INRERAADYLRTRD
Sbjct: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120

Query: 120 HLYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQF 179
           HLYIVDAFAGWDP+YRIKVRVVCARAYHA+FMTNMLIRPTQEELA FGEPDFT+WNAGQF
Sbjct: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180

Query: 180 PANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSA 239
           PAN +TQDMSSKTTIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNILTLHSSA
Sbjct: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240

Query: 240 NQGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSH 299
           NQGI+NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS 
Sbjct: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300

Query: 300 EKEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTH 359
           EKEPEIF AIKYGSILENVIYD  TRVV YDD+++TENTRCAYPIE+IPSAKIPCLAD+H
Sbjct: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360

Query: 360 PSNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPF 419
           P NIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE TFSSCFGQPF
Sbjct: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420

Query: 420 LALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 479
           LALHPIRYATMLA+KIS HSA+AWLINTGWTGSSYV+GGKRCPLKYTRAILDSIHDGSLA
Sbjct: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480

Query: 480 KQEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDK 539
           KQ +ETLP+FNL VPT VN VPKE+LNPAKNW++GEAKY+ AVS L SLFVENFK YQD+
Sbjct: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540

Query: 540 ATPEVLAAAPRI 551
           ATP+VLAA P+I
Sbjct: 541 ATPDVLAAGPQI 552

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/536 (88%), Positives = 512/536 (95%)

Query: 14  TDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGR 73
           TD+  VEQKIR+EL+LSK+V TIRRNAPAA+LYEDALHER T+I+S+GAL+AYSGEKTGR
Sbjct: 10  TDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGR 69

Query: 74  SPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPE 133
           SP+DKRIVEEETSKD++WWGPVNKPCSERTW INRERAADYLRTRDHLYIVDAFAGWDP+
Sbjct: 70  SPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPK 129

Query: 134 YRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTT 193
           YRIKVRVVCARAYHALFMTNMLIRP++EELA FGEPDFTVWNAGQFPAN HTQDMSSK+T
Sbjct: 130 YRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKST 189

Query: 194 IEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFG 253
           IEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGI+NGDVTLFFG
Sbjct: 190 IEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFG 249

Query: 254 LSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGS 313
           LSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCINLS EKEPEIF+AI++GS
Sbjct: 250 LSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGS 309

Query: 314 ILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGV 373
           +LENV YD K+  V YDDST+TENTRCAYPIE+IPSAKIPCLAD+HP NIILLTCDASGV
Sbjct: 310 VLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGV 369

Query: 374 LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAK 433
           LPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYA MLA 
Sbjct: 370 LPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAA 429

Query: 434 KISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQV 493
           K+S+H ANA+LINTGWTGSSYVSGGKRCPLKYTRAILD+IHDGSLA+  +E+LP+FNL+V
Sbjct: 430 KMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEV 489

Query: 494 PTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKATPEVLAAAP 549
           PT VN VP ELLNPAKNWAQGEAKYN AVSNLASLFVENFKIYQDKATP+VLAA P
Sbjct: 490 PTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGP 545

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/551 (86%), Positives = 515/551 (93%), Gaps = 3/551 (0%)

Query: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60
           MSP K + T      +++VEQKIRQEL LS +VTTIRRNAPAA+LYED L E  T+ISS+
Sbjct: 1   MSPSKMNATV---GSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSS 57

Query: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120
           GAL+AYSG KTGRSP+DKRIVEE TSKD+IWWGPVNKPCSERTWSINRERAADYLRTRDH
Sbjct: 58  GALIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDH 117

Query: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180
           +YIVDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFP
Sbjct: 118 IYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFP 177

Query: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240
           AN HTQDMSSK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSAN
Sbjct: 178 ANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSAN 237

Query: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300
           QGI+NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS E
Sbjct: 238 QGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAE 297

Query: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360
           KEPEIF+AIK+GS+LENVIYD K+ VV YDDS++TENTRCAYPI++IPSAKIPCLAD+HP
Sbjct: 298 KEPEIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHP 357

Query: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420
            NIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL
Sbjct: 358 KNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 417

Query: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480
           ALHPIRYATMLA K+S+H ANA+LINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 
Sbjct: 418 ALHPIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAN 477

Query: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540
           + +ETLP+FNLQVPT VN VP ELLNPAKNW+QGE+KY  AV+NLA+LFV+NFKIYQD+A
Sbjct: 478 ETYETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRA 537

Query: 541 TPEVLAAAPRI 551
           TP+VLAA P+ 
Sbjct: 538 TPDVLAAGPQF 548

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1008 bits (2607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/551 (85%), Positives = 513/551 (93%), Gaps = 3/551 (0%)

Query: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60
           MSP K + T      +++VEQKIRQEL LS +VTTIRRNAPAA+LYED L E+ T+ISS+
Sbjct: 1   MSPSKMNCTV---GSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSS 57

Query: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120
           GAL+AYSG KTGRSP+DKRIVEE TSKD+IWWGPVNKPCSERTWSINRERAADYLRTRDH
Sbjct: 58  GALIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDH 117

Query: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180
           +YIVDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFP
Sbjct: 118 IYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFP 177

Query: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240
           AN HTQDMSSK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSAN
Sbjct: 178 ANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSAN 237

Query: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300
           QGI+NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS E
Sbjct: 238 QGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAE 297

Query: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360
           KEPEIF+AIK+G++LENV YD K+ VV YDDS++TENTRCAYPI++IPSAKIPCLAD+HP
Sbjct: 298 KEPEIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHP 357

Query: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420
            NIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL
Sbjct: 358 KNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 417

Query: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480
           ALHPIRYATMLA K+S+H ANA+LINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 
Sbjct: 418 ALHPIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAN 477

Query: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540
           + +E+LP+FNLQVPT V  VP ELLNPAKNW+QGE KY  AV++LA+LFVENFKIYQD+A
Sbjct: 478 ETYESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRA 537

Query: 541 TPEVLAAAPRI 551
           TP+VLAA P+ 
Sbjct: 538 TPDVLAAGPQF 548

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/551 (85%), Positives = 512/551 (92%), Gaps = 3/551 (0%)

Query: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60
           MSP K   T      +++VEQKIRQEL LS +VTTIRRNAPAA+LYED L E+ T+ISS+
Sbjct: 1   MSPSKMHATT---GSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSS 57

Query: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120
           GAL+AYSG KTGRSP+DKRIVEE TSKD+IWWGPVNKPCSERTWSINRERAADYLRTRDH
Sbjct: 58  GALIAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDH 117

Query: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180
           +YIVDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFP
Sbjct: 118 IYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFP 177

Query: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240
           AN HTQDMSSK+TIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSAN
Sbjct: 178 ANLHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSAN 237

Query: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300
           QGI+NGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS E
Sbjct: 238 QGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAE 297

Query: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360
           KEPEIF+AIK+G++LENV YD K+ VV YDDS++TENTRCAYPI++IPSAKIPCLAD+HP
Sbjct: 298 KEPEIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHP 357

Query: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420
            NIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL
Sbjct: 358 KNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 417

Query: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480
           ALHPIRYATMLA K+S H +NA+LINTGW+GSSYVSGGKRCPLKYTRAILDSIHDGSLA 
Sbjct: 418 ALHPIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLAN 477

Query: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540
           + +E+LP+FNLQVPT V  VP ELLNPAKNW+QGEAKY  +V+NLA+LFVENFKIYQD+A
Sbjct: 478 ETYESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRA 537

Query: 541 TPEVLAAAPRI 551
           TP+VLAA P+ 
Sbjct: 538 TPDVLAAGPQF 548

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/536 (86%), Positives = 505/536 (94%)

Query: 16  SNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGRSP 75
           ++ VEQKIRQEL LS +VTTIRRNAPAA+LYED L E+ T+ISS+GAL+AYSG KTGRSP
Sbjct: 13  TSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGALIAYSGVKTGRSP 72

Query: 76  RDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEYR 135
           +DKRIVEE TSKD+IWWGPVNKPCSERTWSINRERAADYLRTRDH+YIVDAFAGWDP+YR
Sbjct: 73  KDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYIVDAFAGWDPKYR 132

Query: 136 IKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTIE 195
           IKVRVVCARAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFPAN HTQDMSSK+TIE
Sbjct: 133 IKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANLHTQDMSSKSTIE 192

Query: 196 INFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGLS 255
           INFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI+NGDVTLFFGLS
Sbjct: 193 INFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIKNGDVTLFFGLS 252

Query: 256 GTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSIL 315
           GTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS EKEPEIF+AI++G++L
Sbjct: 253 GTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGAVL 312

Query: 316 ENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLP 375
           ENV YD  + VV YDDS++TENTRCAYPI++IPSAKIPCLAD+HP NIILLTCDASGVLP
Sbjct: 313 ENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNIILLTCDASGVLP 372

Query: 376 PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKI 435
           PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLA K+
Sbjct: 373 PVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLATKM 432

Query: 436 SKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVPT 495
           S+H ANA+LINTGWTGSSYVSGG RC LKYTRAILDSIHDGSLAK  +E+LP+FNLQVPT
Sbjct: 433 SQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASYESLPIFNLQVPT 492

Query: 496 NVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKATPEVLAAAPRI 551
            VN VP ELLNPAKNW+QGEAKY  AV+NLA+LFVENFKIYQD+ATP+VLAA P+ 
Sbjct: 493 KVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPDVLAAGPQF 548

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/551 (84%), Positives = 508/551 (92%), Gaps = 3/551 (0%)

Query: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60
           MSP K + +    TD ++VEQKIR EL LS +V TIRRNAPAAILYEDAL+E+ T I+S+
Sbjct: 1   MSPSKMNRSV---TDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASS 57

Query: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120
           GAL+AYSG+KTGRSP+DKRI+EEETSKD+IWWGPVNKP  E+TWSINRERAADYLRTR H
Sbjct: 58  GALIAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTH 117

Query: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180
           LYIVDAFAGWDP YRIKVRVVCARAYHALFMTNMLIRPT EELA FGEPDFTVWNAGQFP
Sbjct: 118 LYIVDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFP 177

Query: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240
           AN+HTQ MSSKTT+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSAN
Sbjct: 178 ANYHTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSAN 237

Query: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300
           QGI+  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI L+ E
Sbjct: 238 QGIQKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAE 297

Query: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360
           KEPEI+ AIK+GSILENV+YDPKTR V Y+DS++TENTRCAYPIE IPSAKIPCLAD+HP
Sbjct: 298 KEPEIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHP 357

Query: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420
            N++LLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL
Sbjct: 358 QNLVLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL 417

Query: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480
           ALHPIRYATMLAKK+S+H ANAWLINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLAK
Sbjct: 418 ALHPIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAK 477

Query: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540
           + +ETLP FNL +PT VN VPKELLNP+KNW +GEAKYN AV+NLA LFVENFKIYQD+A
Sbjct: 478 ESYETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRA 537

Query: 541 TPEVLAAAPRI 551
           TPEVLAA P++
Sbjct: 538 TPEVLAAGPQV 548

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  989 bits (2558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/535 (85%), Positives = 501/535 (93%)

Query: 17  NQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGRSPR 76
           N VE++IR EL LSK+VT IRRNAPAA+LY+DAL E+ T+ISS GAL+AYSGEKTGRSP+
Sbjct: 10  NSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPK 69

Query: 77  DKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEYRI 136
           DKRIVEEETS+D++WWGPVNKPCSERTW+INRERAADYLRTR+ LY+VDAFAGWDP+YRI
Sbjct: 70  DKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRI 129

Query: 137 KVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTIEI 196
           KVRVVCARAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFPAN  TQDM+SKTTIEI
Sbjct: 130 KVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEI 189

Query: 197 NFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGLSG 256
           NFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSS NQGI+NGDVTLFFGLSG
Sbjct: 190 NFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSG 249

Query: 257 TGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSILE 316
           TGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCINLS EKEPEIF+AI++GS+LE
Sbjct: 250 TGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLE 309

Query: 317 NVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLPP 376
           NVIYD ++  V YDDS++TENTRCAYPI+FIPSAKIPCLA  HP NIILLTCDASGVLPP
Sbjct: 310 NVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPP 369

Query: 377 VSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKIS 436
           VSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL+LHP+RYATMLA+K+ 
Sbjct: 370 VSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMH 429

Query: 437 KHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVPTN 496
           +HSANAWLINTGWTGSSYVSGGKRC LKYTRAILD+IHDGSLAK EFE+LP+FNLQVP  
Sbjct: 430 EHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKA 489

Query: 497 VNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKATPEVLAAAPRI 551
           V  VP ELLNPA+NW++GEAKY +AVS LA LFVENFK YQDKAT +VLAA P++
Sbjct: 490 VEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  986 bits (2548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/552 (83%), Positives = 507/552 (91%), Gaps = 4/552 (0%)

Query: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALH-ERNTIISS 59
           MSP K + TP+   D N VEQKIRQELDLS  VTTIRRNAP ++LYEDAL  E+NTIISS
Sbjct: 1   MSPSKVT-TPLK--DLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISS 57

Query: 60  TGALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRD 119
           TGAL+AYSGEKTGR P+DKRIVEE  SK+DIWWGPVNKPCSERTW INRERAADYLRTR+
Sbjct: 58  TGALIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTRE 117

Query: 120 HLYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQF 179
           H+YIVDAFAGWDP+YRIKVRVVCARAYHALFMTNMLIRPT++EL  FG+PDFTVWNAGQF
Sbjct: 118 HIYIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQF 177

Query: 180 PANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSA 239
           PANFHT+DMSSKTTIEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSA
Sbjct: 178 PANFHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSA 237

Query: 240 NQGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSH 299
           N+GI   DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCINLS 
Sbjct: 238 NEGIEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSV 297

Query: 300 EKEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTH 359
           EKEPEIF +IK+GSILENV+YDPK+R V YDDS++TENTRCAYPIEFIPSAKIPC+A++H
Sbjct: 298 EKEPEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSH 357

Query: 360 PSNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPF 419
           P NIILLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+PTFSSCFGQPF
Sbjct: 358 PKNIILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPF 417

Query: 420 LALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 479
           LALHP++YATMLA+K+ KH ANAWLINTGWTGSSY++GGKRCPL YTRAILD+IHDGSL 
Sbjct: 418 LALHPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLE 477

Query: 480 KQEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDK 539
           K+ FETLP+FNL+VP NVNNVP +LLNP+KNW +GE KY+ AV  L+ LF+ENFK Y+DK
Sbjct: 478 KESFETLPIFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDK 537

Query: 540 ATPEVLAAAPRI 551
           AT EVLAA PR+
Sbjct: 538 ATKEVLAAGPRL 549

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/532 (84%), Positives = 497/532 (93%)

Query: 20  EQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGRSPRDKR 79
           EQ+IR ELDLS +V TIRRNAPAA+LYEDAL ER T ISS+GAL+AYSGEKTGRSPRDKR
Sbjct: 11  EQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGEKTGRSPRDKR 70

Query: 80  IVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEYRIKVR 139
           IV+E TS D++WWGPVNK CSERTW INRERAADYLRTRDHLYIVDA+AGWDP YRIKVR
Sbjct: 71  IVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAGWDPRYRIKVR 130

Query: 140 VVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTIEINFK 199
           VVCARAYHALFMTNMLIRPT++ELAEFGEPDFTVWNAGQFPAN HT  M+SKTT+EINFK
Sbjct: 131 VVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMTSKTTVEINFK 190

Query: 200 AMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGLSGTGK 259
            MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQGI + DVTLFFGLSGTGK
Sbjct: 191 EMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVTLFFGLSGTGK 250

Query: 260 TTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSILENVI 319
           TTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCI LS EKEPEI+ AIK+GS+LENVI
Sbjct: 251 TTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAIKFGSVLENVI 310

Query: 320 YDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLPPVSK 379
           Y+P+TR V Y+DS++TENTRCAYPI++IPSAKIPCLAD HPSNI+LLTCDASGVLPPVS+
Sbjct: 311 YNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCDASGVLPPVSR 370

Query: 380 LTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKISKHS 439
           LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP++YATMLA+K++KH+
Sbjct: 371 LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMAKHN 430

Query: 440 ANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVPTNVNN 499
           ANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK+++ETLP FNL++PT VNN
Sbjct: 431 ANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTFNLEIPTRVNN 490

Query: 500 VPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKATPEVLAAAPRI 551
           VP ELLNPAKNW +GEAKY +AV NLA LFVENFK YQD+AT +VL+A P++
Sbjct: 491 VPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGPQL 542

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/552 (80%), Positives = 499/552 (90%), Gaps = 10/552 (1%)

Query: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60
           MSP K  N+          E+ IR EL LS +V TIRRNAPAA+LYEDAL ER+T IS+ 
Sbjct: 1   MSPTKTQNS---------AEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNA 51

Query: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120
           GAL+AYSG+KTGRSPRDKRIVEEETSKD++WWGPVNKPCSERTW INRERAADYLRTRDH
Sbjct: 52  GALIAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDH 111

Query: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180
           +YIVDA+AGWDP YRIKVRVVCARAYHALFMTNMLIRP++EEL  FGEPDFTVWNAGQFP
Sbjct: 112 IYIVDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFP 171

Query: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240
           AN HT  M+SKTT+EINFK MEMVILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSAN
Sbjct: 172 ANTHTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSAN 231

Query: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300
           QGI++ DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKC+ LS E
Sbjct: 232 QGIQDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAE 291

Query: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360
           KEPEIF AIK+GS+LEN+IYDP TR V Y+DST+TENTRCAYPIE+IPSAKIPCLAD HP
Sbjct: 292 KEPEIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHP 351

Query: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420
            NI+LLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL
Sbjct: 352 KNIVLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL 411

Query: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480
           +LHP++YATMLA+K+++H+ANAWLINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLAK
Sbjct: 412 SLHPMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAK 471

Query: 481 QEFETLPVFNLQVPTNVNN-VPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDK 539
           +E+E LP+FNLQ+P  V + VP  LLNP+KNWA+GEAKY + V +LA+LFVENFK YQDK
Sbjct: 472 EEYEVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDK 531

Query: 540 ATPEVLAAAPRI 551
           AT +VLAA P++
Sbjct: 532 ATEQVLAAGPQL 543

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/551 (80%), Positives = 493/551 (89%), Gaps = 9/551 (1%)

Query: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60
           MSP K   +P         E+KIR EL LS  V  IRRNAPAA+LYEDAL ERNT ISST
Sbjct: 1   MSPSKVFQSP---------EEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISST 51

Query: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120
           GAL+AYSGEKTGRSP+DKRIV+E TS + +WWGPVN+  SERTW INRERA DYLRTR+H
Sbjct: 52  GALIAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREH 111

Query: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180
           LYIVDAFAGWDP YRIK+R+VC RAYHALFMTNMLIRPT+EELAEFGEPDFTVWNAGQFP
Sbjct: 112 LYIVDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFP 171

Query: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240
           AN HT+ MSSKTT+EINFKAMEMVILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSAN
Sbjct: 172 ANTHTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSAN 231

Query: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300
           QGI  GDVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD GVFNIEGGCYAKCI LS E
Sbjct: 232 QGIAKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAE 291

Query: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360
           KEPEIF AI+YGS+LENV+Y+P +RVV YDDS++TENTRCAYPIE+IPSAKIPCL+++HP
Sbjct: 292 KEPEIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHP 351

Query: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420
           SNI+LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL
Sbjct: 352 SNIVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL 411

Query: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480
           ALHP++YATMLA+K+S+H+ANAWLINTGWTG+SYVSGGKRCPLKYTRAILD+IH GSLA 
Sbjct: 412 ALHPMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLAN 471

Query: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540
            ++ETLPVF L +P  V  VP ELLNP++NW +GE KY+ AV++LA+LFV+NFKIYQD+A
Sbjct: 472 ADYETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQA 531

Query: 541 TPEVLAAAPRI 551
           T EVL A P++
Sbjct: 532 TKEVLYAGPQL 542

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/551 (78%), Positives = 491/551 (89%), Gaps = 3/551 (0%)

Query: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60
           MSP   S  P+  TD+ +VE++IR+EL L  +V TIR NAPAA LYED L E+ T + S+
Sbjct: 1   MSP---SKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSS 57

Query: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120
           GAL AYSG KTGRSP+DKRI+EEETSK+++WWGPVNKP SE+TWSINRERAADYLRTRDH
Sbjct: 58  GALAAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDH 117

Query: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180
           LYI+DA+AGWDP YRIKVRV+CARAYHALFMTNMLIRP+ EELA FGEPDFTVWNAGQFP
Sbjct: 118 LYIIDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFP 177

Query: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240
           AN +T+ M+SKTT+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSAN
Sbjct: 178 ANRNTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSAN 237

Query: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300
           QGI  GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI+L+ E
Sbjct: 238 QGIERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAE 297

Query: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360
           KEPEI+ AIK+GS+LENV++D   R V Y D+++TENTRCAYPI++IPSAKIPCLAD HP
Sbjct: 298 KEPEIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHP 357

Query: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420
           SNI+LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL
Sbjct: 358 SNIVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFL 417

Query: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480
           ALHP+RYATMLAKK+ +H+ANAWL+NTGWTGSSY +GGKRCPLKYTRAILDSIHDGSL+K
Sbjct: 418 ALHPMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSK 477

Query: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540
            ++ETLP+FNL  P  VN VP  LLNPAK+W +G  KYN+AV  LA+ F ENFKIYQD+A
Sbjct: 478 ADYETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQA 537

Query: 541 TPEVLAAAPRI 551
           TP+VLAA P+ 
Sbjct: 538 TPDVLAAGPQF 548

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  942 bits (2434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/551 (80%), Positives = 490/551 (88%), Gaps = 10/551 (1%)

Query: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60
           MSP K   TP         E+KIR EL LS  V TIRRNAPAA+LYEDAL ER T ISST
Sbjct: 1   MSPSKVYQTP---------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISST 51

Query: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120
           GAL+AYSGEKTGRSP+DKRIV+E TS D+IWWGPVN+  SE+TW INRERAAD+LRTR+H
Sbjct: 52  GALIAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREH 111

Query: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180
           LYIVDA+AGWDP YRIK+R+VC RAYHALFMTNMLIRPT+EELAEFGEPDFTVWNAGQFP
Sbjct: 112 LYIVDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFP 171

Query: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240
           AN HT+ MSSKTT+EINF+AMEMVILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSAN
Sbjct: 172 ANTHTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSAN 231

Query: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300
           QG  N DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD GVFNIEGGCYAKCI LS E
Sbjct: 232 QG-PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGE 290

Query: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360
           KEPEIF AIKYGS+LENV+YDP TRVV Y+DS++TENTRCAYPIE+IPSA+IPCL++ HP
Sbjct: 291 KEPEIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHP 350

Query: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420
           SNI+LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL
Sbjct: 351 SNIVLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL 410

Query: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480
           ALHP++YATMLA+K+S+H+A+AWLINTGWTGSSY +GGKRCPLKYTRAILDSIHDG+LA+
Sbjct: 411 ALHPMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQ 470

Query: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540
            E+ETLPVF L +P  V  VP ELLNPAKNW +GE KY +AVS LAS F ENFKIYQD+A
Sbjct: 471 AEYETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQA 530

Query: 541 TPEVLAAAPRI 551
           T EV+ A P+I
Sbjct: 531 TEEVVRAGPQI 541

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/549 (77%), Positives = 477/549 (86%), Gaps = 7/549 (1%)

Query: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60
           MSP K  N           +  IRQEL L ++V TIRRNAPAA+LYEDAL E  T I+S+
Sbjct: 1   MSPTKTRN-------HVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASS 53

Query: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120
           GAL+A+SG KTGRSP+DKRIV+E TS  +IWWGPVNK CSE+TW +NRERAADYLRTRDH
Sbjct: 54  GALIAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDH 113

Query: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180
           LYIVDA+AGWDP YRIK+RVVCARAYHALFMTNMLIRPT+EEL  FGEPDFTVWNAGQFP
Sbjct: 114 LYIVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFP 173

Query: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240
           AN HT  M+SKTT+EINF+ MEMVILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSAN
Sbjct: 174 ANTHTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSAN 233

Query: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300
           QGIR+ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  
Sbjct: 234 QGIRDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEA 293

Query: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360
           KEPEIF AIK+GS+LENV YDP TRVV Y+D  +TENTRCAYPIE+IPSAKIPCLA++HP
Sbjct: 294 KEPEIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHP 353

Query: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420
            NI+LLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFL
Sbjct: 354 KNIVLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFL 413

Query: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480
           ALHP++YATMLA+K+S+H ANAWLINTGWTG+S+V GG RCPLKYTRAILD++HDGSLA+
Sbjct: 414 ALHPLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQ 473

Query: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540
           ++FETLP F L VP +VNNVP+ +LNPAKNW +GE KY   V  LA LF ENFK YQD+A
Sbjct: 474 EDFETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRA 533

Query: 541 TPEVLAAAP 549
           + +V++A P
Sbjct: 534 SADVISAGP 542

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/551 (75%), Positives = 473/551 (85%), Gaps = 7/551 (1%)

Query: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60
           MSP K  N          V+ +IR+EL L ++V TIRRNAPAA+LYEDAL E  T IS++
Sbjct: 1   MSPSKIRNLV-------SVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISAS 53

Query: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120
           GAL+A+SG KTGRSP+DKRIV+E TS  +IWWGPVNK CSE+TW +NRERAAD+LRTRDH
Sbjct: 54  GALIAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDH 113

Query: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180
           LYIVDA+AGWDP YRIK+RVVCARAYHALFMTNMLI+PT +EL EFGEPDFTVWNAGQFP
Sbjct: 114 LYIVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFP 173

Query: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240
           AN HT  M+SKTTIEINF+ MEMVILGTEYAGEMKKGIFTVMFYLMP++H +LTLHSSAN
Sbjct: 174 ANTHTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSAN 233

Query: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300
           QGIR+ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  
Sbjct: 234 QGIRDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEA 293

Query: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360
           KEPEIF AI++GS+LENV YD  TR V +++  +TENTRCAYPIE+IPSAKIPCLAD HP
Sbjct: 294 KEPEIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHP 353

Query: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420
            NI+LLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFL
Sbjct: 354 KNIVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFL 413

Query: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480
           ALHP++YATMLA K+S H A+AWLINTGWTG S+V GG RCPLKYTRAILD+IHDG+LAK
Sbjct: 414 ALHPLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAK 473

Query: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540
           +E+ETLP FNL +P +VNNVP  +LNPA++W  GEAKY   V  LA+LFVENFK Y+  A
Sbjct: 474 EEYETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANA 533

Query: 541 TPEVLAAAPRI 551
           + E++ A P +
Sbjct: 534 STEIMCAGPLL 544

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/517 (78%), Positives = 447/517 (86%)

Query: 33  VTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGRSPRDKRIVEEETSKDDIWW 92
           +  I+RN P A LYED L E  T +SSTGAL+AYSG KTGRSP+DKRIVEEE SKD+IWW
Sbjct: 60  LINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIWW 119

Query: 93  GPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEYRIKVRVVCARAYHALFMT 152
           GPVNK CSERTW+INRERA DYL TRD LY++DAF GWDP YRIK+RVVCARAYHALFM 
Sbjct: 120 GPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFMN 179

Query: 153 NMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTIEINFKAMEMVILGTEYAG 212
           NMLIRPT+EEL  FG+PDFTVWNAGQF AN  T DMSSKT++EINFK MEM ILGTEYAG
Sbjct: 180 NMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYAG 239

Query: 213 EMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGLSGTGKTTLSADPHRLLIG 272
           EMKKGIFTVMFYLMP++HN+LTLHSSANQ   NGDVTLFFGLSGTGKTTLSADPHR LIG
Sbjct: 240 EMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLIG 299

Query: 273 DDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSILENVIYDPKTRVVHYDDS 332
           DDEHCWSD GVFNIEGGCYAKCI LS EKEP+IF AIK+GS+LEN IYD +T  V YD+S
Sbjct: 300 DDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDNS 359

Query: 333 TLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLPPVSKLTPEQVMYHFISG 392
           T+TENTRCAYPI++I +AKIPCLAD HP+N+ILLTCDASGVLPPVSKLTPEQVMYHFISG
Sbjct: 360 TITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISG 419

Query: 393 YTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKISKHSANAWLINTGWTGS 452
           YTSKMAGTE GVTEP+PTFSSCFGQPFLALHP++YA+MLA+K+ KH ANAWL+NTGWTGS
Sbjct: 420 YTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTGS 479

Query: 453 SYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVPTNVNNVPKELLNPAKNWA 512
           SYVSGG RCPLKYTRAILD+IHDGSL  +E+ETLP+FNLQ+P N N VP ELLNPA +W 
Sbjct: 480 SYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSWT 539

Query: 513 QGEAKYNAAVSNLASLFVENFKIYQDKATPEVLAAAP 549
                Y  AV  L  LF ENFK Y+DKAT EV+ A P
Sbjct: 540 DSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/522 (77%), Positives = 458/522 (87%), Gaps = 1/522 (0%)

Query: 30  SKDVTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGRSPRDKRIVEEETSKDD 89
           +KD+T I+RN P A LYED L E +T +SSTGAL+AYSG KTGRSP+DKRIVEE +SKD+
Sbjct: 38  NKDIT-IKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDN 96

Query: 90  IWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEYRIKVRVVCARAYHAL 149
           IWWGPVNKPCSE TWSINRERA DYL TR  LY++DA+AGWD  YRIK+RVVCAR YHAL
Sbjct: 97  IWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHAL 156

Query: 150 FMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTIEINFKAMEMVILGTE 209
           FM NMLIRPT EEL  FGEPDFT+WNAG F AN  T+DM+SKT+IEINFK+MEMVILGTE
Sbjct: 157 FMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTE 216

Query: 210 YAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGLSGTGKTTLSADPHRL 269
           YAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQG+ NGDVTLFFGLSGTGKTTLSADPHR 
Sbjct: 217 YAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRE 276

Query: 270 LIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSILENVIYDPKTRVVHY 329
           LIGDDEHCWSD GVFNIEGGCYAKCI L+ EKEPEIF AIK+GS+LEN +YD  T VV Y
Sbjct: 277 LIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDY 336

Query: 330 DDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLPPVSKLTPEQVMYHF 389
           DDS +TENTRCAYPI+FI SAKIPCL D HP+N+ILLTCDASGVLPPVSKLTPEQVMYHF
Sbjct: 337 DDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHF 396

Query: 390 ISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKISKHSANAWLINTGW 449
           ISGYTSKMAGTEQGVTEPEPTFS+CFGQPFLALHP++YA MLA K++ H A+AWLINTGW
Sbjct: 397 ISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGW 456

Query: 450 TGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVPTNVNNVPKELLNPAK 509
           TG+SY +GGKRCPLKYTRAILD+IH+GSLA +E+ETLPVFNL +P NV NVP ELLNP+K
Sbjct: 457 TGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSK 516

Query: 510 NWAQGEAKYNAAVSNLASLFVENFKIYQDKATPEVLAAAPRI 551
            W+  +  Y+ AV  L SLFV+NF IYQD+AT +V+AA P +
Sbjct: 517 TWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/566 (72%), Positives = 473/566 (83%), Gaps = 21/566 (3%)

Query: 7   SNTPIDPTDSNQV-------EQKIRQE--------LDLSKD--VTTIRRNAPAAILYEDA 49
           SNT I+ T+ N         +QK+  E         D SKD  +  I+ N  AAILYEDA
Sbjct: 11  SNTSINGTNINNYNGNPSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDA 70

Query: 50  LHERNTIISSTGALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRE 109
           L E  T+ISS+GAL+AYSG KTGRSP+DKRIV E+ SKD++WWGPVNKPCSE+TW INRE
Sbjct: 71  LKEPKTVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRE 130

Query: 110 RAADYLRTRDHLYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEP 169
           R  DYL TR +LY++DA+ GWDP YR+KVRVVCARAYHALFMTNMLIRPT+EEL  F EP
Sbjct: 131 RTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEP 190

Query: 170 DFTVWNAGQFPANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVH 229
           DFTVWNAG F AN +T DM+SKT++EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+H
Sbjct: 191 DFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIH 250

Query: 230 HNILTLHSSANQGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGG 289
           HNILTLHSSAN+GI   DVT+FFGLSGTGKTTLSADP+RLLIGDDEHCWSD GVFNIEGG
Sbjct: 251 HNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGG 310

Query: 290 CYAKCINLSHEKEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPS 349
           CYAKCI L+ EKEPEIF+AI++GS+LENV Y+     V Y+D  +TENTRCAYPI++I S
Sbjct: 311 CYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKS 370

Query: 350 AKIPCLADTHPSNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEP 409
           AKIPCLA++HP N+ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE 
Sbjct: 371 AKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEA 430

Query: 410 TFSSCFGQPFLALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAI 469
           TFSSCFGQPFLALHPI YATMLAKK+ ++ +NAWLINTGWTGSSY +GG RCPLKYTRAI
Sbjct: 431 TFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAI 490

Query: 470 LDSIHDGSLAKQEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAK----YNAAVSNL 525
           LD+IHDG+LA + +ETLPVFNLQ+PT+VN VP E+LNP  +W     K    YN AV+ L
Sbjct: 491 LDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKL 550

Query: 526 ASLFVENFKIYQDKATPEVLAAAPRI 551
           A+LFVENFKIYQDKAT +VLAA P++
Sbjct: 551 AALFVENFKIYQDKATDDVLAAGPQV 576

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 67.4 bits (163), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 55/105 (52%), Gaps = 17/105 (16%)

Query: 380 LTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKISKHS 439
           LT E+VMYHF SG+ S   G                 +PFLALHPI Y T++A K+  HS
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAHS 58

Query: 440 ANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFE 484
             A+LINTG+             LK TR   DSIHD SLAK+ F 
Sbjct: 59  --AYLINTGYA------------LK-TRVNFDSIHDDSLAKELFR 88

>ZYRO0F18722g Chr6 (1551987..1554086) [2100 bp, 699 aa] {ON} some
           similarities with uniprot|P32319 Saccharomyces
           cerevisiae YBL017C PEP1 Type I transmembrane sorting
           receptor for multiple vacuolar hydrolases cycles between
           the late-Golgi and prevacuolar endosome-like
           compartments
          Length = 699

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 334 LTENTRCAYPIEFIPSAKIPCLADTHP--SNIILLTCDASGVLPPVSKLTPEQVMYHFIS 391
           +TE+   ++    +P  +I C +DTHP  +N++LL CD+   L    + TP+   +    
Sbjct: 118 MTEDQGRSWKQLSLPQDEIDCFSDTHPFNTNLLLLHCDSR--LENNPETTPDSSSFQERI 175

Query: 392 GYTSKMAG 399
            Y S  AG
Sbjct: 176 AYASDDAG 183

>Kwal_56.24265 s56 complement(928206..928859) [654 bp, 217 aa] {ON}
           YPL233W (NSL1) - Protein required for cell viability
           [contig 165] FULL
          Length = 217

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 10  PIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGE 69
           P D   + QV QK ++  D +  V  +RR AP  + + D + E  + +    AL+A   E
Sbjct: 89  PFDLELNEQVRQKYQEWEDQTVRVAQLRREAPQKLCH-DYVAEARSALEEADALIASFTE 147

Query: 70  KTGRSPRDKRIVEEETSKDD 89
               S RD++   EE  K D
Sbjct: 148 SDETSSRDQQESVEELYKSD 167

>NCAS0B03100 Chr2 (534985..536580) [1596 bp, 531 aa] {ON} Anc_8.382
           YDR181C
          Length = 531

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 37/88 (42%), Gaps = 5/88 (5%)

Query: 324 TRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLPP----VSK 379
           T++VH  D +L EN        ++P  K P L  T P  +  L      ++ P       
Sbjct: 424 TKLVHDKDISL-ENDELRKSWGYLPQDKTPILKSTAPQGLFSLIKKGKHLITPPNLFKKN 482

Query: 380 LTPEQVMYHFISGYTSKMAGTEQGVTEP 407
           L P+++    +  +  K+  TE  + +P
Sbjct: 483 LAPKRLKQRTLPQFKRKIKSTESSIKKP 510

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 20/41 (48%)

Query: 491 LQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVE 531
           L +  NV   P+      KNW +GEA +   +   ASLFV 
Sbjct: 213 LSIVVNVGKNPQHEYIGFKNWTRGEAPFVDGIKGFASLFVS 253

>TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YNL242W
          Length = 1717

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 347  IPSAKIPCLADTHPSNIILLTCDASGVLPPVSKLTPEQVMYHFIS-GYTS 395
            + S K+ CL     S  ILLT +AS    P S     +++YH+IS GYT+
Sbjct: 968  LSSLKVKCLL---KSGTILLTDNASTSSKPPSNKQSNRMLYHYISQGYTT 1014

>SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} similar
           to uniprot|Q05670 Saccharomyces cerevisiae YMR232W FUS2
           Cytoplasmic protein localized to the shmoo tip required
           for the alignment of parental nuclei before nuclear
           fusion during mating
          Length = 706

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 51/119 (42%), Gaps = 15/119 (12%)

Query: 67  SGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWS-INRERAADYL---------R 116
           +  K GR   DK I++++    ++ W   N+P  ++T+S ++  +  DY+         +
Sbjct: 100 NASKRGRDEEDKEIIQKKPPSLNLVWDAFNEPSQKKTYSPLDLHKFKDYMTLESPRIDPK 159

Query: 117 TRDHLYIVDAFAGWDPEYRIKVRV---VCARAYHA--LFMTNMLIRPTQEELAEFGEPD 170
             + L  +      + +Y   + +   V  R  H    F   +L + + EEL  FG  D
Sbjct: 160 LSNLLQTIQNLVETEEKYARVLEISNAVYRRELHENRKFKNKLLNKNSNEELLLFGNID 218

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 34/68 (50%), Gaps = 9/68 (13%)

Query: 460 RCPLKYTR----AILDSIHD-----GSLAKQEFETLPVFNLQVPTNVNNVPKELLNPAKN 510
           +CP+ +T+    AI   +++      S+ K E E +P+  +  P  + N+P E  NP  +
Sbjct: 359 KCPIDHTKYQELAITSKVNNQPITSASIQKSEEEKIPIIQMTSPKIIKNIPLESTNPLPS 418

Query: 511 WAQGEAKY 518
           +    +K+
Sbjct: 419 FHSLASKF 426

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,456,530
Number of extensions: 2704199
Number of successful extensions: 7392
Number of sequences better than 10.0: 30
Number of HSP's gapped: 7555
Number of HSP's successfully gapped: 30
Length of query: 551
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 436
Effective length of database: 40,294,809
Effective search space: 17568536724
Effective search space used: 17568536724
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)