Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E050705.706ON1556155681320.0
NCAS0A031705.706ON1319138630870.0
TDEL0B021405.706ON1147120427060.0
KNAG0C066305.706ON1281114927030.0
KAFR0H001805.706ON1241106726260.0
Smik_11.3605.706ON1180105525290.0
Kpol_1043.735.706ON1260107324880.0
Skud_11.3365.706ON1188108324690.0
Suva_11.3335.706ON1187107624590.0
SAKL0E15004g5.706ON1196127824480.0
YKR096W5.706ON1195105824410.0
CAGL0G02541g5.706ON1295108823920.0
Skud_9.175.706ON1118113022670.0
YIL151C5.706ON1118113022510.0
Suva_9.375.706ON1117111421370.0
Smik_9.185.706ON1118113021270.0
CAGL0H06611g5.706ON1282114021360.0
TPHA0E001905.706ON1361110720820.0
AFR290W5.706ON1217112820690.0
Kwal_55.196785.706ON1178125020370.0
KLLA0A00528g5.706ON1229105018770.0
TBLA0E017105.706ON152682717910.0
ZYRO0B16412g5.706ON137238715380.0
KLTH0E00968g5.706ON114838713851e-167
Ecym_40155.706ON125742313641e-163
TPHA0D046405.706ON9622181524e-09
Kpol_324.1singletonON5451218840.51
TBLA0C030405.251ON46854801.1
Ecym_3207na 1ON640102782.3
Skud_13.704.340ON154160782.7
YOL112W (MSB4)3.64ON49255763.3
NDAI0B051301.256ON82589773.3
TBLA0A03700singletonON57256764.4
Kpol_1020.372.210ON55568755.0
CAGL0L11220g4.324ON43984755.0
Suva_14.3946.355ON639110755.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E05070
         (1556 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...  3137   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...  1193   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1046   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...  1045   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1016   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   978   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   962   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   955   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   951   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...   947   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   944   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   926   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   877   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   871   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   827   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   823   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   827   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   806   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   801   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   789   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   727   0.0  
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   694   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...   597   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   538   e-167
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   530   e-163
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...    63   4e-09
Kpol_324.1 s324 (1..16356) [16356 bp, 5451 aa] {ON} (1..16356) [...    37   0.51 
TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.2...    35   1.1  
Ecym_3207 Chr3 complement(393631..395553) [1923 bp, 640 aa] {ON}...    35   2.3  
Skud_13.70 Chr13 complement(122945..127570) [4626 bp, 1541 aa] {...    35   2.7  
YOL112W Chr15 (106710..108188) [1479 bp, 492 aa] {ON}  MSB4GTPas...    34   3.3  
NDAI0B05130 Chr2 complement(1254612..1257089) [2478 bp, 825 aa] ...    34   3.3  
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               34   4.4  
Kpol_1020.37 s1020 complement(79930..81597) [1668 bp, 555 aa] {O...    33   5.0  
CAGL0L11220g Chr12 (1197228..1198547) [1320 bp, 439 aa] {ON} sim...    33   5.0  
Suva_14.394 Chr14 (676747..678666) [1920 bp, 639 aa] {ON} YNR038...    33   5.2  

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_5.706
            YIL151C
          Length = 1556

 Score = 3137 bits (8132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1556/1556 (100%), Positives = 1556/1556 (100%)

Query: 1    MPQASSSTLRNLVRLPPTNTATATATATNTTTVDPAYNNENNNNNNFDDNSINDGIINNT 60
            MPQASSSTLRNLVRLPPTNTATATATATNTTTVDPAYNNENNNNNNFDDNSINDGIINNT
Sbjct: 1    MPQASSSTLRNLVRLPPTNTATATATATNTTTVDPAYNNENNNNNNFDDNSINDGIINNT 60

Query: 61   NNTIDSINNNITNSIGNIARPKRHSSNSYNNYKTIPFTKRRIAACTPININNNNDNYNNN 120
            NNTIDSINNNITNSIGNIARPKRHSSNSYNNYKTIPFTKRRIAACTPININNNNDNYNNN
Sbjct: 61   NNTIDSINNNITNSIGNIARPKRHSSNSYNNYKTIPFTKRRIAACTPININNNNDNYNNN 120

Query: 121  ENMILMNNNNNNNNINNSFIDNLDYLSNTNNNTNMSTMAQYTPSKGTTISRRPSIIIRKQ 180
            ENMILMNNNNNNNNINNSFIDNLDYLSNTNNNTNMSTMAQYTPSKGTTISRRPSIIIRKQ
Sbjct: 121  ENMILMNNNNNNNNINNSFIDNLDYLSNTNNNTNMSTMAQYTPSKGTTISRRPSIIIRKQ 180

Query: 181  QQQQQQSHFTTATTIKSPSNHTSVNITPQASNYDPASEPPNSPYYLTTNSYSNMKNNNNA 240
            QQQQQQSHFTTATTIKSPSNHTSVNITPQASNYDPASEPPNSPYYLTTNSYSNMKNNNNA
Sbjct: 181  QQQQQQSHFTTATTIKSPSNHTSVNITPQASNYDPASEPPNSPYYLTTNSYSNMKNNNNA 240

Query: 241  NTTNTNNTIQPSPLPLPLPMDIPTNNSNNNNNNNITRSNNNNPQSRYFSPSPLPPPLQQN 300
            NTTNTNNTIQPSPLPLPLPMDIPTNNSNNNNNNNITRSNNNNPQSRYFSPSPLPPPLQQN
Sbjct: 241  NTTNTNNTIQPSPLPLPLPMDIPTNNSNNNNNNNITRSNNNNPQSRYFSPSPLPPPLQQN 300

Query: 301  HHQQQQTSHLNPISLSNSTSTSNPNINSSALNNNNNNNNNNTNTDNNNSNNNNSNNNKTT 360
            HHQQQQTSHLNPISLSNSTSTSNPNINSSALNNNNNNNNNNTNTDNNNSNNNNSNNNKTT
Sbjct: 301  HHQQQQTSHLNPISLSNSTSTSNPNINSSALNNNNNNNNNNTNTDNNNSNNNNSNNNKTT 360

Query: 361  NNPHDDNNNNNNNNNNQQPPPPPPPGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRC 420
            NNPHDDNNNNNNNNNNQQPPPPPPPGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRC
Sbjct: 361  NNPHDDNNNNNNNNNNQQPPPPPPPGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRC 420

Query: 421  SQLTTSQTTDLKNLWTIYKINLDLINNYINFITNALLPTQSKNDLHIGEEIIEIYRIERR 480
            SQLTTSQTTDLKNLWTIYKINLDLINNYINFITNALLPTQSKNDLHIGEEIIEIYRIERR
Sbjct: 421  SQLTTSQTTDLKNLWTIYKINLDLINNYINFITNALLPTQSKNDLHIGEEIIEIYRIERR 480

Query: 481  LWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSR 540
            LWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSR
Sbjct: 481  LWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSR 540

Query: 541  MAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQE 600
            MAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQE
Sbjct: 541  MAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQE 600

Query: 601  TFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVL 660
            TFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVL
Sbjct: 601  TFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVL 660

Query: 661  VYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIF 720
            VYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIF
Sbjct: 661  VYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIF 720

Query: 721  RNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSK 780
            RNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSK
Sbjct: 721  RNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSK 780

Query: 781  RKNSQTATTTTITANTSQTTTTTTNNNIVNMTDNNINTNNDNDNGNCPSKDGSMMSIDYI 840
            RKNSQTATTTTITANTSQTTTTTTNNNIVNMTDNNINTNNDNDNGNCPSKDGSMMSIDYI
Sbjct: 781  RKNSQTATTTTITANTSQTTTTTTNNNIVNMTDNNINTNNDNDNGNCPSKDGSMMSIDYI 840

Query: 841  NNINLNSNSSNINQLFDNNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISL 900
            NNINLNSNSSNINQLFDNNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISL
Sbjct: 841  NNINLNSNSSNINQLFDNNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISL 900

Query: 901  KCSIIVLKKFLNGPILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWN 960
            KCSIIVLKKFLNGPILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWN
Sbjct: 901  KCSIIVLKKFLNGPILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWN 960

Query: 961  SIVNFLNVLMVYLLDNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCW 1020
            SIVNFLNVLMVYLLDNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCW
Sbjct: 961  SIVNFLNVLMVYLLDNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCW 1020

Query: 1021 GTLWFDVICNKNINSDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTIL 1080
            GTLWFDVICNKNINSDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTIL
Sbjct: 1021 GTLWFDVICNKNINSDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTIL 1080

Query: 1081 DCPLDGIGFVANDEDGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQN 1140
            DCPLDGIGFVANDEDGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQN
Sbjct: 1081 DCPLDGIGFVANDEDGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQN 1140

Query: 1141 FILNNFAFKLTNLYDPSLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIE 1200
            FILNNFAFKLTNLYDPSLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIE
Sbjct: 1141 FILNNFAFKLTNLYDPSLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIE 1200

Query: 1201 EINLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFK 1260
            EINLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFK
Sbjct: 1201 EINLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFK 1260

Query: 1261 EQQQQQQQQEHLVNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTH 1320
            EQQQQQQQQEHLVNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTH
Sbjct: 1261 EQQQQQQQQEHLVNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTH 1320

Query: 1321 KMGVSINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVV 1380
            KMGVSINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVV
Sbjct: 1321 KMGVSINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVV 1380

Query: 1381 EASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQ 1440
            EASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQ
Sbjct: 1381 EASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQ 1440

Query: 1441 ERFKTKSIQNYNLYNDDDDDDDDTKTGTTTLSNTSVGVDNNVNNSRNTNVENELVTGFSS 1500
            ERFKTKSIQNYNLYNDDDDDDDDTKTGTTTLSNTSVGVDNNVNNSRNTNVENELVTGFSS
Sbjct: 1441 ERFKTKSIQNYNLYNDDDDDDDDTKTGTTTLSNTSVGVDNNVNNSRNTNVENELVTGFSS 1500

Query: 1501 PTPLPIDVTADDKMNKNQINDIANANATSDIDIDIDANDDEGELFLLMKKISNMLF 1556
            PTPLPIDVTADDKMNKNQINDIANANATSDIDIDIDANDDEGELFLLMKKISNMLF
Sbjct: 1501 PTPLPIDVTADDKMNKNQINDIANANATSDIDIDIDANDDEGELFLLMKKISNMLF 1556

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score = 1193 bits (3087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 722/1386 (52%), Positives = 896/1386 (64%), Gaps = 207/1386 (14%)

Query: 80   RPKRHSSNSYNNYKTIPFTKRRIAACTPININNNNDNYNNNENMILMNNNNNNNNINNSF 139
            R KRHSSNSY+N K  P  KRRIA    +++                            +
Sbjct: 53   RQKRHSSNSYSNAKNNPAVKRRIAKPEEVSLK---------------------------Y 85

Query: 140  IDNLDYLSNTNNNTNMSTMAQYTPSKGTTISRRPSIIIRKQQQQQQQSHFTTATTIKSPS 199
            IDN++Y + T  N N     Q TPSKGT +SRRPS+I +KQ                   
Sbjct: 86   IDNMEYGTATTGN-NSIICQQQTPSKGT-LSRRPSLI-KKQ------------------- 123

Query: 200  NHTSVNITPQASNYDPASEPPNSPYYLTTNSYSNMKNNNNANTTNTNNTIQPSPLPLPLP 259
                +N TPQ  +Y   SE P SP+YL  NS+SN    + A  TN NN    +       
Sbjct: 124  ----MNSTPQPMSY-VVSEVPASPFYLPANSFSNNYERSPALLTNNNNININNNNNSNNN 178

Query: 260  MDIPTNNSNNNNNNNITRSNNNNPQSRYFSPSPLPPPLQQNHHQQQQTSHLNPISLSNST 319
            +       N+ N ++I R NN+ P     +   LP P+ +  +   +     PI+     
Sbjct: 179  LRF-----NSMNASSIPRENNDVPAIEQLT---LPQPMSRTMNYSTEI----PIN----- 221

Query: 320  STSNPNINSSALNNNNNNNNNNTNTDNNNSNNNNSNNNKTTNNPHDDNNNNNNNNNNQQP 379
            S SN   + SA+  NN + N       N  N NN+N   T NN ++ N + NNNNNN   
Sbjct: 222  SNSNNIDDQSAIIPNNEHKNGENQESENYKNTNNNNEQDTNNNINNTNRDRNNNNNNNNN 281

Query: 380  PPPPPPGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYK 439
                   +S ++K + +AL++KLQDIYK+IVKQEI+LQ+RCSQLTTSQTTDLKNLWTIYK
Sbjct: 282  NNNSSSSTSSSSKKTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYK 341

Query: 440  INLDLINNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNF 499
            +N+DLINNY+ FIT ALL +QS+ DLHIGEEIIEIYRIERRLWVYGTITFLDVLK+FSNF
Sbjct: 342  VNIDLINNYVTFITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNF 401

Query: 500  MDPEVCCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEH 559
            MDPEVCCQFI+HVFI++S +L DIP KYSI WLQRLGDLSRMAIALYPSGFIDWKLSAE 
Sbjct: 402  MDPEVCCQFITHVFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEE 461

Query: 560  WYNEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQR 619
            WY EAMKFTY+HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQR
Sbjct: 462  WYMEAMKFTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQR 521

Query: 620  AFVERNNGNHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTS 679
            AFVERNNGN+RNLQLIEYLKH+EVMLLPTFLE+ +LQ VVL+YFQ KFGIL+        
Sbjct: 522  AFVERNNGNNRNLQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILE-------- 573

Query: 680  DNNNNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRH 739
                      V IP   S++ T S ++ +N TR   TID+FR++DMFIQNP+ LKYFFRH
Sbjct: 574  ----------VTIP---STSETISINTMNNNTR---TIDMFRSRDMFIQNPEQLKYFFRH 617

Query: 740  SGTFAQSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQT 799
            +  FA+SHILQLVGFGDPKNPFALLFELPK+LK+RKDKK K+K+   + +      ++  
Sbjct: 618  APAFAESHILQLVGFGDPKNPFALLFELPKYLKERKDKKEKKKSKSNSNSNNNNNAST-- 675

Query: 800  TTTTTNNNIVNMTDNNINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLFDNN 859
                                         + DGSMMSID     N      +IN LF +N
Sbjct: 676  -----------------------------AGDGSMMSID-----NSEMGEDDINNLFSDN 701

Query: 860  YSN-ILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIA 918
              N +  EEFF+NI+ L+F Y IP ++EIW+ SL +INLISLKCS+IVLKKFL+GP+LIA
Sbjct: 702  VMNQVTSEEFFQNIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIA 761

Query: 919  LPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNI- 977
            LPHLL W +FIISILLK E  +T   SKIFW   LK I PWN I+NFLNVL+ Y LDNI 
Sbjct: 762  LPHLLPWCYFIISILLKRE-GLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIG 820

Query: 978  -------NDENFK----LIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFD 1026
                   ND   K     I+ L NKY++M  + L   L+ FN+NE+LPE+WKCWGTLWFD
Sbjct: 821  LPTPSAVNDTKQKDMNVFILDLCNKYSTMGFADL---LQHFNENEDLPEVWKCWGTLWFD 877

Query: 1027 VICNKNINSDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDG 1086
             I NKN     +F N                              +GI+DH  LD P+DG
Sbjct: 878  TISNKNGMDADSFEN------------------------------LGIKDHMFLDFPIDG 907

Query: 1087 IGFVANDEDGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNF 1146
            IG+V  DE G NF+KR++R+IFL K + E F +LGLK+S+      RN  +P + IL  F
Sbjct: 908  IGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNNVPMDNILKMF 967

Query: 1147 AFKLTNLYDPSLIIIPQTEQNIENENENENDDLE-FNKSILSNIMEFFQIHEPIEEINLN 1205
            +FK                 N +  + N  D+LE +  +I++ I EF  I EPI E NLN
Sbjct: 968  SFKWAG-------------SNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLN 1014

Query: 1206 LQLQPPLSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQ 1265
             ++ PPL  +  NE+IF+Y GYK+L  N +SF +NGE  SGSIY++WP+DY+     Q  
Sbjct: 1015 FEI-PPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYD-----QLI 1068

Query: 1266 QQQQEHLVNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVS 1325
              Q  +   ++T +  ++  G ++ ++ SF++  +  F  K ST  +++ T+        
Sbjct: 1069 LAQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDK-STLLSSTSTE-------P 1120

Query: 1326 INKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTR 1385
             N+++T+FVFDATSWLRHFAHIYKL+ N  LKFAVCLTTFQELRFLRKSKD NVVEASTR
Sbjct: 1121 FNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTR 1180

Query: 1386 AIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF-K 1444
            AIITMRQLY +G LLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEA++++QE+F K
Sbjct: 1181 AIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVK 1240

Query: 1445 TKSIQN 1450
            +K+++N
Sbjct: 1241 SKTVEN 1246

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1046 bits (2706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/1204 (48%), Positives = 732/1204 (60%), Gaps = 216/1204 (17%)

Query: 277  RSNNNNPQS--RYFSPSPLPPPLQQNHHQQQQTSHLNPISLSNSTSTSNPNI--NSSALN 332
            R+ N  P+S   Y + +   P     ++   +  HL+   + NS+  S PN+  + S L+
Sbjct: 101  RTVNRTPRSTTSYVADASASPYCYSPNNSNLRIDHLS--RMVNSSGVSIPNVCRDPSFLS 158

Query: 333  NN----NNNNNNNTNTDNNNSNNNNSNNNKTTNNPHDDNNNNNNNNNNQQPPPPPP---- 384
                  ++  +  T + N+   N+ S +N   +   DDNN N++  N             
Sbjct: 159  KEAHIVSDGQDTGTISINSGEVNDQSQDNSANDEGRDDNNENDSIRNKNSNNDNDNNREN 218

Query: 385  --------PGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWT 436
                    P   + +K SSQAL+QKLQDIYK+IVKQEI+LQ+RCSQLT SQTT+LK LW 
Sbjct: 219  NKDNNGNVPSVVVPSKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWV 278

Query: 437  IYKINLDLINNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSF 496
            IYK+N DLINNY+ FIT ALLP QS  DL IG+EI+EIYRIERRLWVYGTITFLDVLK+F
Sbjct: 279  IYKVNSDLINNYVTFITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNF 338

Query: 497  SNFMDPEVCCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLS 556
            SNFMDPEVC QFI+HVFI+IS +L DIP +Y+I W QRLGDLSRMAIALYPSGFIDWKLS
Sbjct: 339  SNFMDPEVCAQFITHVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLS 398

Query: 557  AEHWYNEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNI 616
            AEHWY EAMK+ Y HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNI
Sbjct: 399  AEHWYMEAMKYIYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNI 458

Query: 617  YQRAFVERNNGNHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQP 676
            YQRAFVERNNGNHRN QLIEYLKH+EVMLLP+FLES DLQ VVL+YF+ KFG+       
Sbjct: 459  YQRAFVERNNGNHRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGM------- 511

Query: 677  QTSDNNNNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYF 736
               D N N                                 +IF  + MF QNPD LKYF
Sbjct: 512  ---DTNEN---------------------------------NIFDTRQMFDQNPDQLKYF 535

Query: 737  FRHSGTFAQSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANT 796
            FRH+  FA+SHILQLVGFGDPKNPFALLFELP+ LKDR+DKK KRK   + TT T     
Sbjct: 536  FRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSVTTET----- 590

Query: 797  SQTTTTTTNNNIVNMTDNNINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLF 856
                                                S M+ID               +  
Sbjct: 591  -----------------------------------SSAMAIDE-------------EEYI 602

Query: 857  DNNYS-NILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPI 915
            D+++S     ++FF+NID L  PY  P ++E+W  SLK +N+ SL CS+IVLKKFL GP+
Sbjct: 603  DSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEGPM 662

Query: 916  LIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLD 975
            ++ALPHLL W +FII+++ K+++ ITD  S+ FW   +  I PWN+IVNFLNVL+ Y LD
Sbjct: 663  VVALPHLLPWAYFIIAVVSKVQH-ITDGASREFWLELVNRIFPWNTIVNFLNVLIAYTLD 721

Query: 976  NINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINS 1035
            NI+       + +      +S+  L+++++ FN NE+LPE+WKCWG LWFD IC+K+   
Sbjct: 722  NIHPS-----LPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKD--- 773

Query: 1036 DTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDED 1095
                                  +  D+Y++       GI+DH  LD P+DGIGF  +DE 
Sbjct: 774  ---------------------KVQMDSYES------AGIKDHMFLDLPIDGIGFDRDDES 806

Query: 1096 GINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYD 1155
            GI F+KR+ R+IFL K + E F    L +S +   +CR T  P N +L +F FKL + + 
Sbjct: 807  GIKFWKRACRVIFLFKRIAENF-QTRLVVSSQAQVHCRRTD-PMNHVLKSFCFKLRDTF- 863

Query: 1156 PSLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSIL 1215
                          N N           S+L N +E F   E   + N ++Q+ P LS+L
Sbjct: 864  -------------YNSN-----------SVLQNTIEVF---EEGSDANKDMQMTPQLSVL 896

Query: 1216 GGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVND 1275
              NE+IF Y+GYKRL  ++  +   GE +S S+Y+SW  + +K  E  Q +  Q+   N+
Sbjct: 897  -ENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSK-NEIPQSEPTQQQTANE 954

Query: 1276 STMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVF 1335
            + +  E +        + S  EF                   N       +N   TFFV 
Sbjct: 955  ADLFIEGI--------NTSLTEF-------------------NIDFPECKMNGKDTFFVL 987

Query: 1336 DATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYK 1395
            DATSWLRHFAH+YKL+ N  L+FA+CLTTFQELRFLRKSKD NVVEA+TRA+IT+RQLY 
Sbjct: 988  DATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYT 1047

Query: 1396 EGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF--KTKSIQNYNL 1453
            E ++LPLRFTGNVAT IEEHLEFEEQITWRSHVDEFV EAI ++Q R   + +   +  L
Sbjct: 1048 ENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQENRDFHHVVL 1107

Query: 1454 YNDD 1457
              DD
Sbjct: 1108 VTDD 1111

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 1045 bits (2703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/1149 (50%), Positives = 712/1149 (61%), Gaps = 202/1149 (17%)

Query: 345  DNNNSNNNNSNNNKTTNNPHDDNNNNNNNNNN----------------QQPPPPPPPGSS 388
            DNN       NN+   N+    N N +NN  N                  P       ++
Sbjct: 222  DNNGEGEVAGNNDNADNDGLPTNGNGDNNEKNLSNDNDNSNNNSNNNNNYPADQSDAQNT 281

Query: 389  ITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNY 448
              T+ SSQAL+QKLQDIYK+IVKQEI+LQ+RCSQLTTSQTT+LKNLWTIYKIN DLINNY
Sbjct: 282  SVTRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNY 341

Query: 449  INFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQF 508
              FIT ALLP+Q   D+ IGEEI+EIYRIERRLWVYGTITFLDVLK+FSNFMDPEVC QF
Sbjct: 342  TTFITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQF 401

Query: 509  ISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFT 568
            I+HVFI++S IL DIP K++I WLQRLGDLSRMAIALYPSGFIDWKLSAEHWY EAMKFT
Sbjct: 402  ITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFT 461

Query: 569  YSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERN-NG 627
            YSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQR FV+RN  G
Sbjct: 462  YSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGG 521

Query: 628  NHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNG 687
            N+RN  LI+YLKH+EVMLLP+FL S DLQ VVL YFQ +FGI         S+NN     
Sbjct: 522  NYRNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGI-------DYSENN----- 569

Query: 688  ANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSH 747
                                           IF  QDMF Q P  L++FFRH+  FA+SH
Sbjct: 570  -------------------------------IFDTQDMFFQPPSCLRFFFRHAPAFAESH 598

Query: 748  ILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNN 807
            ILQLVGFG+PKNPFALLFELPK+LK+R+DKK K K+  T+     TA+ S T   T ++ 
Sbjct: 599  ILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTS-----TADVSSTAPKTVDD- 652

Query: 808  IVNMTDN-NINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLFDNNYSNILCE 866
                TDN N  TN+D++                     L +  S                
Sbjct: 653  --QATDNVNEGTNDDHE---------------------LTATLSG--------------P 675

Query: 867  EFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWI 926
            E+ +NI+ L++  + P  I  W++SL  IN+ SLKCS+IVLKKFL+GP+LIALPH L W 
Sbjct: 676  EYLDNIETLKYAIETPD-ICTWIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWT 734

Query: 927  HFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII 986
             FII+  +K+ N + + ++  FW   +K I PW++I +FLNVL+ Y+LDN    N  +I 
Sbjct: 735  VFIIACGIKV-NELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYG--NTTIIE 791

Query: 987  SLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNN 1046
             L  +Y+ M    L++ML  FN++E+LPE+WKCWGTLW+D ICNKN              
Sbjct: 792  ELCMQYSDM---DLDDMLAHFNKSEDLPEVWKCWGTLWYDAICNKN-------------- 834

Query: 1047 TTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRL 1106
                           + D D T    GI DH  LD P+DGI F A DE G  F+KR++R+
Sbjct: 835  ---------------SVDAD-TFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRV 878

Query: 1107 IFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQ 1166
            IFL K + + F + GLKISHE   YCRN K   +  L  F FKL                
Sbjct: 879  IFLFKGISKKF-DFGLKISHEAGVYCRNEKAADS-PLRRFTFKL---------------- 920

Query: 1167 NIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLG 1226
                E+ +E    +FN        EF  + E +  IN +    P LS++ G ENIF Y+G
Sbjct: 921  ----ESYDEPTSSKFN--------EFIPLCEEVSAINNDALATPSLSVVQG-ENIFEYMG 967

Query: 1227 YKRLNFNIQSFHENGEIISGSIYSSWPIDY-------------NKFKEQQQQQQQQEHLV 1273
            Y+ L  +  SF +NGEI+S SIY+SW ID              N   E Q         +
Sbjct: 968  YRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEAAAAASSATDNNAVSEGQGDLAANGTPI 1027

Query: 1274 NDSTMKNENVTVGDITP-------EDASFKEFMKLS-------FHLKLSTRSNNSQTQNT 1319
            + S       T   +T        E+  FK+FM L        +H  ++ +S     +N 
Sbjct: 1028 SASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKS--YLVKNL 1085

Query: 1320 HKMGV-SINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGN 1378
             +  V  +++ +TFF+FDATSWLRHFAHIYK++ NG LKF VCLTTFQELRFLRKSKD N
Sbjct: 1086 WESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDEN 1145

Query: 1379 VVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIR 1438
            VVEA+ RAIITMRQLY+E +LLPLRFTGNVA DIEEHLEFEEQITWRSHVDEFVIEA+++
Sbjct: 1146 VVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMK 1205

Query: 1439 SQERFKTKS 1447
            +Q++F T  
Sbjct: 1206 AQDKFTTAG 1214

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1016 bits (2626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/1067 (51%), Positives = 687/1067 (64%), Gaps = 172/1067 (16%)

Query: 390  TTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYI 449
             TK +S+ LI+KLQ+IYK+IVKQE++LQ RCSQLTTSQTT+LKNLW+IYK+N DLINNYI
Sbjct: 276  VTKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYI 335

Query: 450  NFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFI 509
             FIT ALLP+QS  D+ IGEEI+EIYRIERRLWVYGTITFLDVLK+FSNFMDPEVC QFI
Sbjct: 336  TFITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFI 395

Query: 510  SHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTY 569
            +HVFI++S +L D+P K+SI WLQRLGDLSRMAIALYPSGFIDWKLSAEHWY EAMKFTY
Sbjct: 396  THVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTY 455

Query: 570  SHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERN-NGN 628
            SHGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQR FV+RN NGN
Sbjct: 456  SHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGN 515

Query: 629  HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGA 688
             RN  LI+YLKH+EVMLLP+FLE+ DLQ VVL YF  +FG+          D N+N    
Sbjct: 516  VRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGV----------DYNDN---- 561

Query: 689  NVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHI 748
                                         +IF  QDMF Q P  L+++FRH+  FA+SHI
Sbjct: 562  -----------------------------NIFETQDMFFQVPASLRFYFRHAPAFAESHI 592

Query: 749  LQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNNI 808
            LQLVGFG+PKNPFALLF+LP FLK+RKDKK K K+  +   +T++ +T+ +     N + 
Sbjct: 593  LQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEISTMSIDTNDSRGPILNTSA 652

Query: 809  VNMTDNNINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLFDNNYSNILCEEF 868
                                          Y+N  N                   +  E+
Sbjct: 653  ------------------------------YVNEGN-------------------IVTEY 663

Query: 869  FENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHF 928
            F+NID L+ P   P  I +WL+SL+++N+ SLKCS+IVL+KFL GP+LIALPH+L W +F
Sbjct: 664  FDNIDSLRLPIDHP-NILVWLKSLEHLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYF 722

Query: 929  IISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLIISL 988
            II+  LK ++S   +  K FW   ++ I+PWN++ +FLNVL+ Y+LDN      + I  L
Sbjct: 723  IIATFLKAQSSKNTSSVK-FWTIVMRRILPWNTLTSFLNVLLAYILDNFYQT--ESIAKL 779

Query: 989  SNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKN-INSDTTFLNQNNNNT 1047
               Y++    +  E+L +FN+NENLPEIWKCWGTLWFDVI NK  +N+D           
Sbjct: 780  CETYSNF--ENFYELLDYFNRNENLPEIWKCWGTLWFDVISNKRALNAD----------- 826

Query: 1048 TTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLI 1107
                                T   +GIEDH  LD PLDGIGF   DE G NF+ R++R++
Sbjct: 827  --------------------TFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIV 866

Query: 1108 FLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQN 1167
            FL K + E     GL++S     +CR   I  N IL +F+FK+                 
Sbjct: 867  FLFKGIAENLQT-GLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGF-------------- 911

Query: 1168 IENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLGY 1227
                     D+  ++    S I +   + E I+E NL+   +P LS++ G ENIF Y+GY
Sbjct: 912  ---------DESSYSGQPFSTINKLLPLFENIDETNLDFDARPMLSVVKG-ENIFEYVGY 961

Query: 1228 KRLNFNIQSFHENGEIISGSIYSSWPID---------YNKFKEQQQQQQQQEHLV--NDS 1276
            K+L  N  SF  NGE++S SIY++W ID          N++    Q  QQQ  L+     
Sbjct: 962  KKLFLNNHSFDRNGELVSSSIYTAWVIDNDNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQ 1021

Query: 1277 TMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFD 1336
              +  N    + T +D +F+ +M      KL+   + +    T      IN++ T+FVFD
Sbjct: 1022 NFQMRNFASNEDTEDDFNFELYMNPE---KLNKNMDQASIWTT--ANDEINRNITYFVFD 1076

Query: 1337 ATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKE 1396
            ATSWLRHFAHIYKLS N  L FAVCLTTFQELRFLRKSKD NVV A+ RAIITMRQLY E
Sbjct: 1077 ATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVVGAAARAIITMRQLYSE 1136

Query: 1397 GKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF 1443
            GKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEA++++Q +F
Sbjct: 1137 GKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKF 1183

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score =  978 bits (2529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/1055 (50%), Positives = 678/1055 (64%), Gaps = 183/1055 (17%)

Query: 392  KTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINF 451
            K S  ALIQKLQ++Y++IVKQEI+LQ+RCSQLT SQTT+LK+LWTIYKIN +L+NNY+ F
Sbjct: 250  KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309

Query: 452  ITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISH 511
            IT ALLP+Q  +DL IG+EI+EIYRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQFI+H
Sbjct: 310  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369

Query: 512  VFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSH 571
            VFI++S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+TY+H
Sbjct: 370  VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429

Query: 572  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRN 631
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN
Sbjct: 430  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 489

Query: 632  LQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVN 691
              LIEYLKH+E MLLP+FLES DLQNVVL YF  KFGI              + NG N  
Sbjct: 490  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGI--------------DANGCN-- 533

Query: 692  IPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQL 751
                                       IF  +DMFIQNPD  KYFFRH  +FAQSHILQ+
Sbjct: 534  ---------------------------IFNCEDMFIQNPDFFKYFFRHGPSFAQSHILQI 566

Query: 752  VGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNNIVNM 811
            VGFG+PKNPFA+LFELPK+LK            +       T+N   + T ++       
Sbjct: 567  VGFGEPKNPFAILFELPKYLK----------ERKDKKERKKTSNNDSSVTESS------- 609

Query: 812  TDNNINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLFDNNYSNILCEEFFEN 871
            T N+ N N D+D     S   SM   D                         L  EFF +
Sbjct: 610  TGNSRNGNEDDDETM--SSTTSMSDPD-------------------------LLVEFFND 642

Query: 872  IDLLQFPYKIPQTI--EIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFI 929
            ID L+ P  +P  +  E WLE+LK +N+ SLKC +IVL+KFL+GP+ +ALPH+L WI+FI
Sbjct: 643  IDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFI 701

Query: 930  ISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLIISLS 989
            ISI LK  N + D  SK FW   +K + PW+++V F+NVL+ YLLDN  + +  +I  L 
Sbjct: 702  ISICLK-SNQLNDPISKEFWIVIIKRMFPWDTMVTFMNVLIAYLLDN--ETSNSIIGDLC 758

Query: 990  NKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNNTTT 1049
            N+Y+ ++   L+E+L  FN+NE+LPEIW CWGTLWFD IC KN +S ++           
Sbjct: 759  NEYSKLN---LSELLNSFNENEDLPEIWGCWGTLWFDAICQKNTHSISS----------- 804

Query: 1050 TTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFL 1109
                       DN+      + +GI D+  LD P DGI F   DE+G  F+KR+ R+IFL
Sbjct: 805  ----------EDNF------QEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFL 848

Query: 1110 CKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQNIE 1169
             + +  +FP LG+ + H+    C  + +  N IL +  +KL  L             NI 
Sbjct: 849  FREVSRSFP-LGVIVRHDPLVNC--SSLQSNNILRDLVYKLEPL------------TNIR 893

Query: 1170 NENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLGYKR 1229
            +           +  +LS +   F I E   EIN +L   P LS++ G+ NIF+Y+GYK+
Sbjct: 894  S-----------SVPVLSTLESIFDISEARSEINTDLHAVPELSVINGD-NIFHYVGYKK 941

Query: 1230 LNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTVGDIT 1289
            L  +   F +NGE +S S+Y+SW                  ++ N +     N++  +  
Sbjct: 942  LRPDYTCFDKNGEFLSASLYTSW------------------YVPNCNNNLETNISYANER 983

Query: 1290 PEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFAHIYK 1349
              +A F E MK S H +++    + +T              T+FVFDATSWLRH A I+K
Sbjct: 984  ENEALFLECMK-SVHPEIAYPEIDFKT--------------TYFVFDATSWLRHSARIFK 1028

Query: 1350 LSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVA 1409
            L++N  L+FA+CLTTFQELRFLRKSKD NV+EA+TR IIT+RQLY E K+LPLRFTGNVA
Sbjct: 1029 LAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVA 1088

Query: 1410 TDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK 1444
            T IEE+LEFEEQITWR+HVDEFVIE+I+++QE+ +
Sbjct: 1089 THIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1123

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  962 bits (2488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1073 (48%), Positives = 687/1073 (64%), Gaps = 176/1073 (16%)

Query: 385  PGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDL 444
            P  S+  + SSQAL+QKLQDIYK+I+KQE++LQ+RCSQLT SQTT++KNLW IYK+N DL
Sbjct: 305  PSVSVPPRKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADL 364

Query: 445  INNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEV 504
            INNY+ FIT AL P+QSK+DL IGEEI++IY+IERRLWVYGTITFLDVLK+FSNFMDPEV
Sbjct: 365  INNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEV 424

Query: 505  CCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEA 564
            CCQFI+HVFI+IS +L+DIP KY+I WLQ+LGDLSRMA+AL+PSGFIDWKLSAE WY  A
Sbjct: 425  CCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAA 484

Query: 565  MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER 624
            M+++Y +GKLYYHMSTVQQNTLEAFVNLGKSVFCQ TF PSQQY+QLVIDNIYQRAF +R
Sbjct: 485  MEYSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADR 544

Query: 625  N-NGNHRNLQ-LIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNN 682
            N + N RN Q L++YLKH+EVMLLP F+ES DLQ VVL+YF  KFGI          D N
Sbjct: 545  NSSSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGI----------DYN 594

Query: 683  NNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGT 742
            NN                                + +F+ + MFIQN D LK++FRH+  
Sbjct: 595  NN-------------------------------NVKMFQPRQMFIQNNDQLKFYFRHANA 623

Query: 743  FAQSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTT 802
            FA++ ILQLVG+G+PKNPFALLF LPK+LK+R+DKK KRK         I      +TT 
Sbjct: 624  FAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRK-----PKNQIVGEDGSSTTF 678

Query: 803  TTNNNIVNMTDNNINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLFDNNYSN 862
            +                             S+  ++Y+ N+  N        +F      
Sbjct: 679  S-----------------------------SVSGMEYMVNMETN--------VF------ 695

Query: 863  ILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHL 922
            +  E+FF NID L     +P +I +W +SLK  N  + KCS+IVL+KFLNGP+++ALPH+
Sbjct: 696  LGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHI 755

Query: 923  LTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENF 982
            L W++F+ISI L+IE    D     FWY+F+K I PWNS+V FLNVL+ Y++DN  D + 
Sbjct: 756  LPWVYFLISIALQIE-KYQDTAMMEFWYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNS- 813

Query: 983  KLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQ 1042
              +  L ++Y S+   +L E+L+ FN NE+LPE+WKC G+LWFD+I  K          +
Sbjct: 814  -PLNELCDQYGSL---NLEELLRNFNANEDLPEVWKCRGSLWFDIIDEK----------R 859

Query: 1043 NNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKR 1102
            N+ N  + T+                    GI+D+  LD P+DGI F  NDE GI F+KR
Sbjct: 860  NSQNCDSYTE-------------------CGIKDYQFLDFPVDGIEFDENDEIGIKFWKR 900

Query: 1103 SIRLIFLCKSMIETFPNLG-LKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIII 1161
            S+R+IFL + ++E F   G L IS+      R   +  N  L  ++FKL           
Sbjct: 901  SVRVIFLFRGIVERFNGFGNLAISYNAPVINRRG-LGVNSHLVGYSFKLM---------- 949

Query: 1162 PQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENI 1221
                         ++DD+ F+  ++SN        E I+  N +    P LS++ G ENI
Sbjct: 950  ------------AKSDDIMFDDMLVSNF-------EEIDSNNSDFNAIPLLSMIYG-ENI 989

Query: 1222 FNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNE 1281
            F Y+GYKR++ +  SF +NG++IS S Y++W I+             Q+  VN   + N 
Sbjct: 990  FEYVGYKRIHADYYSFDKNGDLISTSFYNTWSIN-------------QDTGVNGGPLSNN 1036

Query: 1282 NVTVGDITPEDASFKEFMKLSFHLKLSTRSN--NSQTQN--THKMGVSINKHRTFFVFDA 1337
            + +    + +  + KE     F  +  +     N +  +    K G+ + +  T+F+ DA
Sbjct: 1037 SSSSNAASSDPMNEKELFNKCFDPEYDSVDEFWNKEIYDDIGRKFGMELYED-TYFILDA 1095

Query: 1338 TSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEG 1397
            TSWLRHFAH+YK++ N  LKF++CLTTFQELRFLRKSKD NVVEA+TRAIIT+RQL+ EG
Sbjct: 1096 TSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEG 1155

Query: 1398 KLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQN 1450
            KLLPLRFTGNVAT IEEHLEFEEQITWRSHVDEFVIEA+I+++ + K + + N
Sbjct: 1156 KLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETKRKEQEMHN 1208

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  955 bits (2469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/1083 (50%), Positives = 687/1083 (63%), Gaps = 199/1083 (18%)

Query: 388  SITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINN 447
            S  +K SS ALIQKLQ++YK+IVKQEI+LQ+RCSQLT SQTT+LK+LWTIY+IN +LINN
Sbjct: 259  SANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINN 318

Query: 448  YINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQ 507
            Y+ FIT ALLP+Q  +DL IG+EI+EIYRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQ
Sbjct: 319  YVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 378

Query: 508  FISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKF 567
            FI+HVF+++S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+
Sbjct: 379  FITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKY 438

Query: 568  TYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNG 627
             Y+HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNG
Sbjct: 439  IYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNG 498

Query: 628  NHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNG 687
            N RN  LIEYLKH+E MLLP+FLES DLQNVV+ YF  KFGI              + NG
Sbjct: 499  NLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGI--------------DANG 544

Query: 688  ANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSH 747
             N                             IF  +DMFIQNPD  KYFFRH+ +FAQSH
Sbjct: 545  CN-----------------------------IFNPEDMFIQNPDFFKYFFRHAPSFAQSH 575

Query: 748  ILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNN 807
            ILQ+VGFG+PKNPFA+LFELPK+LK+RKDKK ++K+S          ++S T ++T N+ 
Sbjct: 576  ILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNN--------DSSVTESSTGNSR 627

Query: 808  IVNMTDNNINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLFDNNYSNILCEE 867
              N  D+ I            S   S+   D++                          E
Sbjct: 628  NDNNDDDEIM-----------SSTASISDHDFL-------------------------AE 651

Query: 868  FFENIDLLQFPYKIPQTI--EIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925
            FF +ID L+ P  +P  +  E WLE+LK +N+ SLKC +IVL+KFL+GP+ IALPH+L W
Sbjct: 652  FFNDIDTLRRPI-LPSMLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPW 710

Query: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985
            I+FII+  LK  N ++D  SK FW   +K + PW++IV F+NVL+ YLLDN   E    I
Sbjct: 711  IYFIIATCLK-SNQLSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDN---EALNPI 766

Query: 986  IS-LSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNN 1044
            I  L +KY ++   +L  +L+ FN++E LPEIW CWGTLWFD IC KN +S ++      
Sbjct: 767  IGELCSKYGTL---NLAGLLESFNESEELPEIWNCWGTLWFDTICQKNAHSISS------ 817

Query: 1045 NNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSI 1104
                           +DN+      + +GI+D+  LD P DGI F   DE G  F+KR+ 
Sbjct: 818  ---------------DDNF------QEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRAC 856

Query: 1105 RLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQT 1164
            R+IFL + +  TFP +G+ +S++    C +++   + IL N  +KL  L           
Sbjct: 857  RIIFLFRELSRTFP-IGVIVSNDPLIKCSSSQ--SSIILRNLVYKLEPL----------- 902

Query: 1165 EQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNY 1224
              NI +           N  IL+ +     I E   + N++L   P LS+  G +NIF+Y
Sbjct: 903  -SNIRS-----------NTPILTALENSVDISEARSKNNIDLYAVPELSVNSG-DNIFHY 949

Query: 1225 LGYKRLNFNIQSFHENGEIISGSIYSSWPI-DYNKFKEQQQQQQQQEHLVNDSTMKNENV 1283
             GYK+L  +   F  NGE +S S+Y+ W + + N   E                + N ++
Sbjct: 950  TGYKKLRPDYTCFDRNGEFLSASLYTRWYLPNGNNISE---------------ALVNSDI 994

Query: 1284 TVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRH 1343
              GD   ED  F E MK                         I+   T+FVFDATSWLRH
Sbjct: 995  EKGD---EDL-FLECMKPD--------------------CPGIDFETTYFVFDATSWLRH 1030

Query: 1344 FAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLR 1403
             A I+KL++N  LKFA+CLTTFQELRFLRKSKD NV+EA+TR IIT+RQLY E K+LPLR
Sbjct: 1031 SARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLR 1090

Query: 1404 FTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK-------TKSIQNYNLYND 1456
            FTGNVAT IEE+LEFEEQITWR+HVDEFVIE+I ++QE+ +       T    NY +   
Sbjct: 1091 FTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTPRHSNYVVLIS 1150

Query: 1457 DDD 1459
            DDD
Sbjct: 1151 DDD 1153

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/1076 (49%), Positives = 671/1076 (62%), Gaps = 193/1076 (17%)

Query: 392  KTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINF 451
            K SS ALIQKLQ++YK+IVKQEI+LQ+RCSQLT SQTT+LK+LWTIY+IN +L+NNY+ F
Sbjct: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321

Query: 452  ITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISH 511
            IT ALLP+Q ++DL IG+EI+EIYRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQFI+H
Sbjct: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381

Query: 512  VFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSH 571
            VF+++S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+H
Sbjct: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441

Query: 572  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRN 631
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN
Sbjct: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 501

Query: 632  LQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVN 691
              LIEYLKH+E MLLP+FLES DLQNVVL YF  KFGI              + NG N  
Sbjct: 502  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGI--------------DANGCN-- 545

Query: 692  IPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQL 751
                                       IF  +DMFIQNPD  KYFFRH+ +FAQSHILQ+
Sbjct: 546  ---------------------------IFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQI 578

Query: 752  VGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNNIVNM 811
            VGFG+PKNPFA+LFELPK LK                         +    ++NN     
Sbjct: 579  VGFGEPKNPFAILFELPKHLK--------------------ERKDKKERKKSSNNESSIT 618

Query: 812  TDNNINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLFDNNYSNILCEEFFEN 871
              +  N+ N+ND+ +       +MS    +  +++   S I              EFF +
Sbjct: 619  ESSTSNSRNENDDND------EIMS----STTSISERDSLI--------------EFFND 654

Query: 872  IDLLQFPYKIPQ-TIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFII 930
            ID L+ P      T E WLESLK +N+ SLKC +IVL+KFL+GP+ IALPH L WI+FII
Sbjct: 655  IDTLRRPIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFII 714

Query: 931  SILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLIISLSN 990
            SI LK  + ++D  SK FW   +K I PW+++V F+N+L+  +LD  N+    +I SL +
Sbjct: 715  SICLK-SSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLD--NEMTSPIIGSLCD 771

Query: 991  KYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNNTTTT 1050
            +Y+ +   +L E+L  F + E LPEIW CWGTLWFD IC KN NS               
Sbjct: 772  EYSDL---NLAELLDVFKEKEELPEIWGCWGTLWFDTICQKNTNS--------------- 813

Query: 1051 TKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFLC 1110
                          +D     +GI+D+  LD P+DGI F  NDE+G  F+KR+ R IFL 
Sbjct: 814  ------------ISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLF 861

Query: 1111 KSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQNIEN 1170
            + +  +F  +G+ I++E+S     + +  N IL N ++KL  L                 
Sbjct: 862  RELSRSF-QIGVIINNESS--INRSSLQSNNILGNLSYKLEPL----------------- 901

Query: 1171 ENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLGYKRL 1230
                    L  +   L+ +     + E   E N++L   P LS++ G  +IFNY GYK+L
Sbjct: 902  ------STLGSSIPTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGG-SIFNYTGYKKL 954

Query: 1231 NFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTVGDITP 1290
              N   F +NGE +S S+Y+SW                  ++ N S     N+       
Sbjct: 955  CPNYTCFDKNGEFLSASLYTSW------------------YVPNGSNNPETNINSNCEKE 996

Query: 1291 EDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFAHIYKL 1350
             +  F E +K          S++ +          I+ + T+FVFDATSWLRH A I+KL
Sbjct: 997  NEGQFLECLK----------SDDRE----------IDLNTTYFVFDATSWLRHSARIFKL 1036

Query: 1351 SKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVAT 1410
            ++N  LKFA+CLTTFQELRFLRKSKD NV+EA+TR IIT+RQLY E K+LPLRFTGNVAT
Sbjct: 1037 AQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVAT 1096

Query: 1411 DIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK-------TKSIQNYNLYNDDDD 1459
             IEE+LEFEEQITWR+HVDEFVIE+I+++QE+ +       +    NY +   DDD
Sbjct: 1097 HIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRFNYVILISDDD 1152

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/1278 (43%), Positives = 747/1278 (58%), Gaps = 246/1278 (19%)

Query: 207  TPQASNYDPASEPPNSPYYLTTNSYSNMKNNNNANTTNTNNTIQPSPLPLPLPMDIPTNN 266
            TPQ   + PA + P SP+YL T S SN++  +    TN N+++Q       LP DI  +N
Sbjct: 97   TPQP--FYPA-DTPQSPFYLPTTSSSNLEAASKV-ITNDNSSVQ-------LP-DICIDN 144

Query: 267  SN--------------NNNNNNITRSNNNNPQSRYFSPSPLPPPLQQNHHQQQQTSHLNP 312
                            N+++  ITR+  N  Q                  ++  T  L  
Sbjct: 145  KQQPERRQQQRLEKRVNHDDKKITRNAANGEQ------------------KESITDELQ- 185

Query: 313  ISLSNSTSTSNPNINSSALNNNNNNNNNNTNTDNNNSNNNNSNNNKTTNNPHDDNNNNNN 372
                               +N  +  ++NT+ D N  ++ +++  + ++   DD  NN  
Sbjct: 186  -----------------GTDNTPHEQSSNTHADTNQQSDQHNSVQQGSSGGSDDGENNRE 228

Query: 373  NNNNQQPPPPPPPGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLK 432
            N+          P  ++  K +SQAL+QKLQDIY+ IVKQEI+LQ+RCSQLT SQTTD+K
Sbjct: 229  NSGI--------PIVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMK 280

Query: 433  NLWTIYKINLDLINNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDV 492
            NLW IYK+N +LINNYI+FIT ALLP+Q + DL IG+EI+EIYR+ERRLWVYGTITFLDV
Sbjct: 281  NLWVIYKVNAELINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDV 340

Query: 493  LKSFSNFMDPEVCCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFID 552
            LK+FSNFMDPEVCCQFISHVF++IS +L D+P +YSI WL+RLGDLSRMAIALYPSGFID
Sbjct: 341  LKNFSNFMDPEVCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFID 400

Query: 553  WKLSAEHWYNEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLV 612
            WKLSAEHWY++A+ +TY HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQYMQLV
Sbjct: 401  WKLSAEHWYSQALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLV 460

Query: 613  IDNIYQRAFVERNNGNHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDS 672
            IDNIYQRAF ER+ G+ RN  ++EYLKH+EVMLLP+FLES +LQ VVL +FQ +FG+   
Sbjct: 461  IDNIYQRAFAERSGGSSRNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVW-- 518

Query: 673  TPQPQTSDNNNNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDH 732
                    NN                                  +D F ++ +FIQ+ + 
Sbjct: 519  -------PNN----------------------------------VDFFDHKQIFIQDGEK 537

Query: 733  LKYFFRHSGTFAQSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTI 792
            L+YFF H+  FA+SHILQLVGFGDP+NPFA+LFELPKFL                     
Sbjct: 538  LRYFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFL--------------------- 576

Query: 793  TANTSQTTTTTTNNNIVNMTDNNINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNI 852
                             + +   + TN D+ NG                     S+S ++
Sbjct: 577  ------KERKERKERRRSKSSPPLPTNLDDGNG---------------------SSSISV 609

Query: 853  NQLFDNNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLN 912
            +  F+N             ID  + PY  PQ I+IW +SL  +NL S++CS+ VLKKFL+
Sbjct: 610  DHYFEN-------------IDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLH 656

Query: 913  GPILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVY 972
             P+L ALPHLL W HF++S+ ++I +S++ +  K FW  F++ I PWNS+V+FLN LM +
Sbjct: 657  APLLTALPHLLPWAHFLVSVAIRI-SSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAF 715

Query: 973  LLDNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKN 1032
            LLD  N  N   +  L  +YN M    L+ +++ F  +E LPE+WKCWGTLWFD I NK+
Sbjct: 716  LLD--NSRNMSSVEKLCEEYNKM---DLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKS 770

Query: 1033 INSDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVAN 1092
                +                              ++++ GI DH  LD P+DGI F  +
Sbjct: 771  ELKAS------------------------------SVQSTGIRDHLFLDAPIDGICFDQD 800

Query: 1093 DEDGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTN 1152
            DE G+ F+KR+ R+IF+ K M + F + G+++S    +  R+        L  F+FK   
Sbjct: 801  DESGLKFWKRACRVIFMFKGMAKEF-HYGIRVSDTPISTRRDVTTLH--ALKRFSFKFEE 857

Query: 1153 LYDPSLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPL 1212
            L            Q  +NE   ++D+             F ++ EPI  IN N +  P L
Sbjct: 858  L-----------PQEWDNEVFLQSDN-------------FIKVFEPISPINSNFEAVPSL 893

Query: 1213 SILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHL 1272
            S++ G E+IF + GY+R+  +   F++NG++I+GS+Y+S  ++    +       ++ H+
Sbjct: 894  SMIDG-ESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKR-HV 951

Query: 1273 VNDSTMKNEN--VTVGDITPED-ASFKEFMKLSFHLKLSTRSNNSQTQNTHK-MGVSINK 1328
             N   +   N  V   + TPE    + E   L+  +  +   +   ++  H  +  + + 
Sbjct: 952  ENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADS 1011

Query: 1329 HRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAII 1388
            + T+FV DATSWLRHFAH+YKL+ N  LKFA+CLTTFQELRFLRKSKD +VVEA+TRA+I
Sbjct: 1012 NVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVI 1071

Query: 1389 TMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSI 1448
            T RQLY E KLLPLRFTGN+AT +EEHLEFEEQITWRSHVDEFVIEA+ +SQ +FK  ++
Sbjct: 1072 TARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNL 1131

Query: 1449 QNYNL---YNDDDDDDDD 1463
            Q  +    Y   D  DDD
Sbjct: 1132 QARDQGQEYIPTDPKDDD 1149

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  944 bits (2441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/1058 (50%), Positives = 675/1058 (63%), Gaps = 187/1058 (17%)

Query: 392  KTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINF 451
            K S  ALIQKLQ++YK+IVKQEI+LQ+RCSQLT SQTT+LK+LWTIYKIN DL+NNY+ F
Sbjct: 269  KRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTF 328

Query: 452  ITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISH 511
            IT ALLP+Q  +DL IG+EI+EIYRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQFI+H
Sbjct: 329  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 388

Query: 512  VFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSH 571
            VF+++S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+H
Sbjct: 389  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 448

Query: 572  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRN 631
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN
Sbjct: 449  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 508

Query: 632  LQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVN 691
              LIEYLKH+E MLLP+FLES DLQNVVL YF  KFGI              + NG N  
Sbjct: 509  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGI--------------DANGCN-- 552

Query: 692  IPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQL 751
                                       IF  +DMF+QNPD  KYFFRH  +FAQSHILQ+
Sbjct: 553  ---------------------------IFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQI 585

Query: 752  VGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNNIVNM 811
            VGFG+PKNPFA+LFELPK+LK+RKDKK ++K+S          N S  T ++T       
Sbjct: 586  VGFGEPKNPFAILFELPKYLKERKDKKERKKSSN---------NDSSVTESSTG------ 630

Query: 812  TDNNINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLFDNNYSNILCEEFFEN 871
                 N+ NDN++      D  +M              S+   + D++    L  EFF +
Sbjct: 631  -----NSRNDNED------DDEIM--------------SSTTSISDHD----LLAEFFND 661

Query: 872  IDLLQFPYKIPQTI--EIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFI 929
            ID L+ P  +P  +  E WLE+LK +N+ SLKC IIVL+KFL+GP+ IALPH+L WI+FI
Sbjct: 662  IDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFI 720

Query: 930  ISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLIISLS 989
            ISI LK  + ++D  SK FW   +K   PW+++V F+NVL+VYLLDN    +  +I  L 
Sbjct: 721  ISICLK-SSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNS--IIGDLC 777

Query: 990  NKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNNTTT 1049
            + Y+ +S S L E+   FN+ E LPEI  CWGTLWFD IC KN +S ++           
Sbjct: 778  DDYDKLSLSELLEL---FNEGEELPEILGCWGTLWFDTICEKNTHSISS----------- 823

Query: 1050 TTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFL 1109
                       DN+      + +GI+D+  LD P DGI F   DE+G  F+KR+ R IFL
Sbjct: 824  ----------EDNF------QEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFL 867

Query: 1110 CKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQNIE 1169
             + +  +FP +G+ I ++   Y   +      IL +  FKL  L             NI 
Sbjct: 868  FRELSRSFP-IGVIIRNDPLIY--RSSFQNTNILGSLVFKLEPLC------------NIH 912

Query: 1170 NENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLGYKR 1229
            N           N  +L  +     I E   E N +L   P LS+  G+ NIF+Y+GYK+
Sbjct: 913  N-----------NIPVLGALESIIDISEARSENNTDLHAVPELSVNEGD-NIFHYVGYKK 960

Query: 1230 LNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTVGDIT 1289
            L  +   F +NGE +S S+Y++W +                   +++T   +N+      
Sbjct: 961  LRADYTCFDKNGEFLSASLYTTWYVPN-----------------SNNTNIEDNINYNSEK 1003

Query: 1290 PEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFAHIYK 1349
              +  F E +K  +                      I+   T+FVFDATSWLRH A I+K
Sbjct: 1004 ENEGLFLECIKSDYP--------------------EIDFKTTYFVFDATSWLRHSARIFK 1043

Query: 1350 LSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVA 1409
            L++N  L+FA+CLTTFQELRFLRKSKD NV+EA+TR IIT+RQLY E K+LPLRFTGNVA
Sbjct: 1044 LAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVA 1103

Query: 1410 TDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKS 1447
            T IEE+LEFEEQITWR+HVDEFVIE+++++QE+ ++ S
Sbjct: 1104 THIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESAS 1141

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/1088 (47%), Positives = 685/1088 (62%), Gaps = 200/1088 (18%)

Query: 367  NNNNNNNNNNQQPPPPPPPGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTS 426
            N+N+N+  NN   P              +QAL+QKLQDIYK IV+QE++LQ++C+QLT+S
Sbjct: 353  NSNSNDKANNSNKP--------------TQALVQKLQDIYKNIVRQEVELQEKCAQLTSS 398

Query: 427  QTTDLKNLWTIYKINLDLINNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGT 486
            QTTDL ++W+IY+IN++L+ NY+ FI+ ALL +QS+ DL IG+EI+E YRI RRLWVYGT
Sbjct: 399  QTTDLNSIWSIYRINVELVTNYVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGT 458

Query: 487  ITFLDVLKSFSNFMDPEVCCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALY 546
            ITFLDVLK+FS+FMDPEVC QFI+HVFI+IS +L DIP KYSI W+QRLGDLSRMAIALY
Sbjct: 459  ITFLDVLKNFSSFMDPEVCSQFITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALY 518

Query: 547  PSGFIDWKLSAEHWYNEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQ 606
            PSGFIDWKLS+E+WYN+A+K+TY +GKLYYHMST+QQNTLEAFVNLGKSVFCQ+TF PS 
Sbjct: 519  PSGFIDWKLSSEYWYNQALKYTYGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSP 578

Query: 607  QYMQLVIDNIYQRAFVERNNGNHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTK 666
            QYMQLVIDNIYQRAF+ER + N RN QLIEYLKH+EVMLLP F+ + +LQ VV+ YF+ K
Sbjct: 579  QYMQLVIDNIYQRAFIERGSNNTRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHK 638

Query: 667  FGILDSTPQPQTSDNNNNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMF 726
            FG                                                ++IF+ +D+F
Sbjct: 639  FGT-------------------------------------------DLHDLNIFQPRDIF 655

Query: 727  IQNPDHLKYFFRHSGTFAQSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQT 786
            +QNP++LKYFFRH+  FA+SHILQ VGFGD KNPFALLF+LPKFLK++KDKK ++K   +
Sbjct: 656  LQNPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSS 715

Query: 787  ATTTTITANTSQTTTTTTNNNIVNMTDNNINTNNDNDNGNCPSKDGSMMSIDYINNINLN 846
                                                     P+ + S+MS+D I+  +L 
Sbjct: 716  GE---------------------------------------PTSNESVMSLDNISTDSL- 735

Query: 847  SNSSNINQLFDNNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIV 906
                            I  +++F N++ +Q PY  P   +IWL+SL  +NL +++C +IV
Sbjct: 736  ----------------ISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIV 779

Query: 907  LKKFLNGPILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFL 966
            L+KFL+GP ++ALPHL+ W +FIIS+ LK E ++ D +S+ FW SF++ ++P NSIV+FL
Sbjct: 780  LRKFLHGPFVVALPHLMVWTYFIISVCLKSE-TLVDEESRYFWSSFMRRLLPLNSIVSFL 838

Query: 967  NVLMVYLLDNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFD 1026
            NVL+ Y LDN       LI S+S + +SM    L E+L  FN NE LPE+WKCWGTLWFD
Sbjct: 839  NVLIAYALDNSYYST--LISSISEELDSM---DLQELLTKFNNNEELPEVWKCWGTLWFD 893

Query: 1027 VICNKNINSDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDG 1086
             I +K+ N+DT               N+ E I              G+ DH   D P+DG
Sbjct: 894  AITDKS-NTDT---------------NSYEKI--------------GVSDHLFFDSPIDG 923

Query: 1087 IGFVANDEDGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNF 1146
            I F + DE+G  F+KR++R+IFL K + ETF ++G+ +SH    YCR   +  N IL +F
Sbjct: 924  IVFDSKDENGEKFWKRALRIIFLFKKIAETF-DIGITLSHTAPVYCRRDDVELNHILGSF 982

Query: 1147 AFKLTNLYDPSLIIIPQTEQNIENEN----ENENDDLEFNKSILSNIMEFFQIHEPIEEI 1202
            +FK+              EQ++ N N    E EN         L  I+E   + E   E+
Sbjct: 983  SFKI--------------EQHLLNGNTVQVEIEN--------CLGAIIE---MTEMPNEV 1017

Query: 1203 NLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQ 1262
            N+ +   PP+S L  NENIF Y GYKR+   +Q+F +NGE+ S + Y+SW          
Sbjct: 1018 NITMDATPPMS-LQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSW---------- 1066

Query: 1263 QQQQQQQEHLVNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKM 1322
                   + +V  S    EN   G      +  + F        + +   N + +N+  +
Sbjct: 1067 ----YSAQEIVPKSAASPENSVAG-----SSPGRSFQSQDVEENIFSVFTNEE-ENSTSL 1116

Query: 1323 GVSINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEA 1382
               +N   T FV DATSWLRH AHIYKL+ N FL F++CLTTFQELRFLRKSKD NV+EA
Sbjct: 1117 LDGLNLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEA 1176

Query: 1383 STRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQER 1442
            + RAII +RQLY +GK++PLRFTGN+AT IEEHLEFEEQITWRSHVDEFVIE+I ++Q++
Sbjct: 1177 AARAIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKK 1236

Query: 1443 FKTKSIQN 1450
            F    +QN
Sbjct: 1237 FLQPFVQN 1244

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/1130 (43%), Positives = 658/1130 (58%), Gaps = 224/1130 (19%)

Query: 382  PPPPGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKIN 441
            PPP    + +   +Q  I+KLQ+IY++IV QE +LQ RC  LTTSQTT+LK+LW IY++N
Sbjct: 191  PPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLN 250

Query: 442  LDLINNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMD 501
             +LI NYINFI  ALL TQ  NDL +G+EI++IYRIE+RLWVYG ITFLDVLK+FSNFMD
Sbjct: 251  TELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMD 310

Query: 502  PEVCCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWY 561
            PEVCCQFI + FI++S +L DIP+KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY
Sbjct: 311  PEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY 370

Query: 562  NEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAF 621
             E+MK+ Y  GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF
Sbjct: 371  TESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAF 430

Query: 622  VERNNGN-------HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTP 674
            ++R++         HRN QLI+YLKHTEVMLLP+FLE++DLQ+VVL+YF+ KFG      
Sbjct: 431  IDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFG------ 484

Query: 675  QPQTSDNNNNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLK 734
                 D N N                                 DIF  +DMF QNP+ L+
Sbjct: 485  ----KDFNGN---------------------------------DIFDTKDMFCQNPESLR 507

Query: 735  YFFRHSGTFAQSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITA 794
            Y+FRH+  FA+S +LQL+GFG+PKNPFALLF+LPK+LK ++ K+ K+K+  T        
Sbjct: 508  YYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKSGATEVPQYRDP 567

Query: 795  NTSQTTTTTTNNNIVNMTDN--NINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNI 852
               Q ++ +   NI ++T N  +I TN +             + +D +N+IN+ S   +I
Sbjct: 568  FDDQISSESYFQNIDSLTSNFDDIPTNLN-------------IWLDSLNHINMTSIQCSI 614

Query: 853  NQLFDNNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLN 912
            + L                                                     KFL+
Sbjct: 615  HVL----------------------------------------------------TKFLH 622

Query: 913  GPILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVY 972
             P+++ALPH LTW+HFI++IL K+E ++       FW  FL+  +PWNS+VN  NVL+ Y
Sbjct: 623  APLVVALPHFLTWLHFIVAILKKLE-TVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCY 681

Query: 973  LLDNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKN 1032
            +LDNI+         L  +     S  L++++++FN+NENLPEIWKCWG+LWFD I   +
Sbjct: 682  MLDNIHP-------FLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAIKKCD 734

Query: 1033 INSDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVAN 1092
            +                                   +   G++DH   D PLDGI F   
Sbjct: 735  V-----------------------------------MEIPGVQDHLFFDSPLDGIVFDEK 759

Query: 1093 DEDGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTN 1152
            DE G  F+ RSIR I + K + + FP+LGLK++ +   +CR   I  ++ L NF FKL  
Sbjct: 760  DEIGERFWIRSIRTILILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLD- 818

Query: 1153 LYDPSLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPL 1212
                      + E+N  N+N NE D+L           +  +I+E IE +N +L+  P L
Sbjct: 819  ----------EYEENDHNDN-NELDEL----------YDTIEINEKIERVNRDLRATPNL 857

Query: 1213 SILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHL 1272
            S++ G ENIF Y GY RL  +   F +NG   S  IYS W                  ++
Sbjct: 858  SVVSG-ENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQW-----------------SNV 899

Query: 1273 VNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTF 1332
             N   +   + ++ D    + S   + K+ F    +   N  +  N             +
Sbjct: 900  GNGMVLDVSSESMYDAANNNLS-PHWEKIFFDRITTAGHNGDKNGNC----------SVY 948

Query: 1333 FVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQ 1392
            FV DATSWLRHFAHI+KL+KN  LKFA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQ
Sbjct: 949  FVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQ 1008

Query: 1393 LYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQNYN 1452
            LY E K++PLRFTGN+AT++EE+LEFEEQITW +HVDEFVI+AI +  + F+T+ + + N
Sbjct: 1009 LYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKN 1068

Query: 1453 ---------LYNDDDDDDDDTKTGTTTLSNT----SVGVDNNVNNSRNTN 1489
                     L  DDD+ D   K       NT    S+G    +N+   TN
Sbjct: 1069 KNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/1130 (43%), Positives = 668/1130 (59%), Gaps = 224/1130 (19%)

Query: 382  PPPPGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKIN 441
            PPP    + +   +Q  I+KLQ+IYK+IV QE +LQ RC  LTTSQTT+LK+LW IY++N
Sbjct: 191  PPPMIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLN 250

Query: 442  LDLINNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMD 501
             +LI NYINFI  ALL TQ  NDL +G+EI++IYRIE+RLWVYG ITFLDVLK+FSNFMD
Sbjct: 251  TELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMD 310

Query: 502  PEVCCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWY 561
            PEVCCQFI + FI++S +L DIP+KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY
Sbjct: 311  PEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY 370

Query: 562  NEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAF 621
             E+MK+ Y  GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF
Sbjct: 371  TESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAF 430

Query: 622  VERNNGN-------HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTP 674
            ++R++G+       HRN QLI+YLKHTEVMLLP+FLE++DLQ+VVL+YF+ KFG      
Sbjct: 431  IDRSSGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFG------ 484

Query: 675  QPQTSDNNNNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLK 734
                 D N N                                 D+F  +DMF QNP+ L+
Sbjct: 485  ----KDFNGN---------------------------------DVFDTKDMFCQNPESLR 507

Query: 735  YFFRHSGTFAQSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITA 794
            Y+FRH+  FA+S +LQL+GFG+PKNPFALLF+LPK+LK +KDK+ K+++  T T++    
Sbjct: 508  YYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATETSSYTDP 567

Query: 795  NTSQTTTTTTNNNI--VNMTDNNINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNI 852
               Q ++ +   NI  +N + N+I TN +             + +D +N+IN+ S   +I
Sbjct: 568  FDVQISSESYFQNIDALNSSFNDIPTNLN-------------IWLDSLNHINMTSIQCSI 614

Query: 853  NQLFDNNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLN 912
            + L                                                     KFL+
Sbjct: 615  HVL----------------------------------------------------TKFLH 622

Query: 913  GPILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVY 972
             P+++ALPH LTW+HFI++IL K+E  +   Q   FW  FL+  +PWNSIV   NVL+ Y
Sbjct: 623  APLVVALPHFLTWLHFIVAILKKLE-MVNSKQVVAFWIHFLRRTMPWNSIVTLGNVLVCY 681

Query: 973  LLDNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKN 1032
            +LDN++         L  +     S  L+++++++N+NENLPEIWKCWGTLWFD I   +
Sbjct: 682  MLDNLHP-------FLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIKKCD 734

Query: 1033 INSDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVAN 1092
            +                                   +   G++DH   D PLDGI F   
Sbjct: 735  V-----------------------------------MEIPGVQDHLFFDSPLDGIVFDEK 759

Query: 1093 DEDGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTN 1152
            DE G  F+ RS+R + L K + + FP+LGLK+S + S +CR   IP ++ L N  FKL +
Sbjct: 760  DEVGEKFWMRSVRAVLLLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKL-D 818

Query: 1153 LYDPSLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPL 1212
             YD               +N N+N++L+       ++ +  +I+E IE +N++ Q  P L
Sbjct: 819  AYD--------------EDNYNDNNELD-------DLYDTIEINEEIEAVNMDPQATPNL 857

Query: 1213 SILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHL 1272
            S++ G E+IF Y GY RL  +   F +NG   S  IYS W                  ++
Sbjct: 858  SVVSG-ESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW-----------------SNV 899

Query: 1273 VNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTF 1332
             N  T+     ++ D+   + S   + K+ F  K++  S  S       +         +
Sbjct: 900  GNGVTLDVSGESIYDVANNNLSL-HWEKIFFD-KIAAASKGSDENYNCTL---------Y 948

Query: 1333 FVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQ 1392
            FV DATSWLRHFAHI+KL+KN  LKFA+CLTTFQELR+LR SKD  VVEA+TR++IT+RQ
Sbjct: 949  FVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQ 1008

Query: 1393 LYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQNYN 1452
            LY E K++P+RFTGN+AT +EE+LEFEEQITW++HVDEFVI+AI +  +RF+ + + + N
Sbjct: 1009 LYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDEN 1068

Query: 1453 ---------LYNDDDDDDDDTKTGTTTLSNT----SVGVDNNVNNSRNTN 1489
                     L  DDD+ +   K       NT    S+G    +N+   TN
Sbjct: 1069 KNKGKEFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 82/220 (37%), Gaps = 56/220 (25%)

Query: 68  NNNITNSIGNIARP--------KRHSSNSYNNYKTIPFTKRRIAACTPININNNNDNYNN 119
           NNN T+ + ++ RP        KRHSS+S+N+     F KRR+                 
Sbjct: 22  NNNHTHIVSDM-RPTSAAFLHQKRHSSSSHNDTPESSFAKRRVPGIV------------- 67

Query: 120 NENMILMNNNNNNNNINNSFIDNLDYLSNTNNNTNMSTMAQYTPSKGTTISRRPSIIIRK 179
                        + +   FID +         TN    AQ TPSK    SRRPS I RK
Sbjct: 68  -------------DPVGKGFIDGI---------TNSQISAQNTPSKTDDASRRPS-ISRK 104

Query: 180 QQQQQQQSHFTTATTIKSPSNHTSVNITPQASN--------YDPASEP---PNSPYYLTT 228
             +   Q   ++  T+  P +   VN T  A N        Y+  + P    + P   + 
Sbjct: 105 VMESTPQVKTSSIPTMDVPKSPYYVNRTMLARNMKVVSRDTYEDNANPQMRADEPLVASN 164

Query: 229 NSYSNMKNNNNANTTNTNNTIQPSPLPLPLPMDIPTNNSN 268
             YSN +  +    ++       +  P P+   +P+   N
Sbjct: 165 GIYSNSQPQSQVTLSDIRRAPVVAASPPPMIRQLPSAQPN 204

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/1114 (43%), Positives = 645/1114 (57%), Gaps = 220/1114 (19%)

Query: 396  QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
            Q  I+KLQ+IYK+IV QE +LQ RC  LTTSQTT+LK+LW IYK+N +LI NYINFI  A
Sbjct: 204  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITA 263

Query: 456  LLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
            LL TQ  NDL +G+EI++IYRIE+RLWVYG ITFLDVLKSFSNFMDPEVCCQFI++ FI 
Sbjct: 264  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFIC 323

Query: 516  ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
            IS +L DIP+KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 324  ISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 383

Query: 576  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGN------- 628
            YH++T+QQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R++GN       
Sbjct: 384  YHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETA 443

Query: 629  HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGA 688
            HRN QLI+YLKHTEVMLLP+FLE+LDLQ+VVL+YF+ KFG           D N N    
Sbjct: 444  HRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFG----------KDFNGN---- 489

Query: 689  NVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHI 748
                                         D+F  +DMF QNP+ L+Y+FRH+  FA+S I
Sbjct: 490  -----------------------------DVFSTKDMFCQNPESLRYYFRHAPAFAESQI 520

Query: 749  LQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNNI 808
            LQL+GFG+PKNPFALLF+LPK LK +KDK+ K+K+              Q ++ +   NI
Sbjct: 521  LQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKSGAAEIPHYRDPFDDQGSSESYFQNI 580

Query: 809  VNMTDNNINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLFDNNYSNILCEEF 868
              +         ++D  + P+  G  + +D +N IN+ S   +I  L           +F
Sbjct: 581  DTL---------NSDFNDPPTNIG--IWLDSLNYINMTSIQCSIQVL----------TKF 619

Query: 869  FENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHF 928
                  +  P+ +     IWL  +           I VLKK                   
Sbjct: 620  LHAPLAVALPHFL-----IWLHFI-----------IAVLKKL------------------ 645

Query: 929  IISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLIISL 988
                      +I   Q   FW  FL+  +PWNS+V F NVL+ Y+LDN++         L
Sbjct: 646  ---------ETINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVCYMLDNLHP-------FL 689

Query: 989  SNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNNTT 1048
              +     S  L++++++FN+NENLPE+WKCWG+LWFD +   ++               
Sbjct: 690  EKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAVKKCDV--------------- 734

Query: 1049 TTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIF 1108
                                +   G++DH   D PLDGI F   DE G  F+ RS+R I 
Sbjct: 735  --------------------MEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTIL 774

Query: 1109 LCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQNI 1168
              K + + FP+LGLK++ + S +CR   I  ++ L N  FKL    DP        E++ 
Sbjct: 775  TLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKL----DP-------YEEDA 823

Query: 1169 ENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLGYK 1228
             N+N NE D+L           +  +I+E IE +N++LQ  P LS++ G E+IF Y GY 
Sbjct: 824  FNDN-NELDEL----------YDTIEINELIETVNIDLQATPKLSVVSG-ESIFEYTGYT 871

Query: 1229 RLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTVGDI 1288
            RL  +   F +NG   S  IY+ W                  ++ N  T+   + ++ D 
Sbjct: 872  RLTQDYHCFDKNGGFNSAFIYTQW-----------------SNVGNGVTLDVSSESLYDS 914

Query: 1289 TPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFAHIY 1348
            T  D S   + K+ F  K+ T   N+    +  +         +FV DATSWLRHFAHI+
Sbjct: 915  TTNDLSL-HWAKILFD-KVFTIGKNTDDDGSCSV---------YFVIDATSWLRHFAHIF 963

Query: 1349 KLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNV 1408
            KL+KN  LKFA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY E K++P+RFTGN+
Sbjct: 964  KLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRFTGNI 1023

Query: 1409 ATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQNYN---------LYNDDDD 1459
            AT IEE+LEFEEQITW++HVDEFVI+AI +  + F+T+   + N         L  DDD+
Sbjct: 1024 ATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFAVLVTDDDN 1083

Query: 1460 DDDDTKTGTTTLSNT----SVGVDNNVNNSRNTN 1489
             +   K       NT    S+G    +N+   TN
Sbjct: 1084 MNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

 Score = 37.7 bits (86), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 66/170 (38%), Gaps = 36/170 (21%)

Query: 49  DNSINDGIINNTNNTIDSINNNITNSIGNIARPKRHSSNSYNNYKTIPFTKRRIAACTPI 108
           D+  N+   + ++N   S+ N++  +       KRHSS+S+N+     F KRR+      
Sbjct: 10  DDPSNETDYSRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPESSFAKRRVPGVV-- 67

Query: 109 NINNNNDNYNNNENMILMNNNNNNNNINNSFIDNLDYLSNTNNNTNMSTMAQYTPSKGTT 168
                                     +   FID +     T +  +M    Q  P K   
Sbjct: 68  ------------------------EPVGKGFIDGI-----TTSQISM----QNIPFKAED 94

Query: 169 ISRRPSIIIRKQQQQQQQSHFTTATTIKSPSNHTSVNITPQASNYDPASE 218
           ISRRPS I RK  +   Q H ++ + +  P +   VN T    N +  S+
Sbjct: 95  ISRRPS-ISRKAMETTPQLHTSSNSAMDIPKSPYYVNRTAITRNMEVVSK 143

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1130 (42%), Positives = 650/1130 (57%), Gaps = 224/1130 (19%)

Query: 382  PPPPGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKIN 441
            PPP    + +   +Q  I+KLQ+IYK+IV QE +LQ RC  LTTSQTT+LK+LW IY++N
Sbjct: 191  PPPVVRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLN 250

Query: 442  LDLINNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMD 501
             +LI NYINFI  ALL TQ  NDL +G+EI++IY +E+RLWVYG ITFLDVLK+FSNFMD
Sbjct: 251  TELIKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMD 310

Query: 502  PEVCCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWY 561
            PEVCCQFI + FI++S +L DIP+KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY
Sbjct: 311  PEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY 370

Query: 562  NEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAF 621
             E+MK+ Y  GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF
Sbjct: 371  TESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAF 430

Query: 622  VER-------NNGNHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTP 674
            ++R       N   H+N QLI+YLKHTEVMLLP+FLE++DLQ+VVL+YF+ KFG      
Sbjct: 431  IDRGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFG------ 484

Query: 675  QPQTSDNNNNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLK 734
                 D N N                                 D+F  +DMF QNP+ L+
Sbjct: 485  ----KDFNGN---------------------------------DVFDTKDMFCQNPESLR 507

Query: 735  YFFRHSGTFAQSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITA 794
            Y+FRH+  FA+S +LQL+GFG+PKNPFALLF+LPK+LK +KDK+ K+++S T T      
Sbjct: 508  YYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSSATETPQYRDP 567

Query: 795  NTSQTTTTTTNNNIVNMTDN--NINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNI 852
               + +  +   NI  ++ N  +I TN +             + ++ +N+IN+ S   +I
Sbjct: 568  FHDKKSPESYFQNIDALSSNFDDIPTNLN-------------IWLESLNHINMTSIQCSI 614

Query: 853  NQLFDNNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLN 912
            + L                   L  P+                        +I L  FL 
Sbjct: 615  HVL----------------TKFLHAPF------------------------VIALPHFL- 633

Query: 913  GPILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVY 972
                       TW++F+++IL ++E +I   Q   FW  FL+  +PWNS+V+  NVL+ Y
Sbjct: 634  -----------TWLYFLVAILKRLE-TINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCY 681

Query: 973  LLDNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKN 1032
            +LDN++         L  +  S  S  L+++++ FN+NENLPEIWKCWG+LWFD I   +
Sbjct: 682  MLDNLHP-------FLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIKKCD 734

Query: 1033 INSDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVAN 1092
            +                                   +   G++DH   D PLDGI F   
Sbjct: 735  V-----------------------------------MEIPGVQDHLFFDSPLDGIVFDEK 759

Query: 1093 DEDGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTN 1152
            DE G  F+ RS+R I L K + + FP+LGLK++ +   +CR   IPQ++ L  F FKL +
Sbjct: 760  DEIGERFWVRSVRAISLLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKL-D 818

Query: 1153 LYDPSLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPL 1212
             YD                     +    + + L  + E  +I+E I+ +NL+L+  P L
Sbjct: 819  AYD---------------------EGNNNDNNELDELYETIEINEKIDNVNLDLRATPNL 857

Query: 1213 SILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHL 1272
            S++ G E+IF Y GY RL  +   F +NG   S  IYS W                  ++
Sbjct: 858  SVVFG-ESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW-----------------SNV 899

Query: 1273 VNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTF 1332
             N   +   N  + D+T  D S   + K+ F    +   N  +  N             +
Sbjct: 900  GNGVPIDVSNEPIYDVTDNDLSL-HWEKIFFDRIAAAYKNCDENDNC----------TIY 948

Query: 1333 FVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQ 1392
            FV DATSWLRHFAHI+KL+KN  L FA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQ
Sbjct: 949  FVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQ 1008

Query: 1393 LYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSI---- 1448
            LY E K++P+RFTGN+AT +EE+LEFEEQITW++HVDEFVI+AI +  + F+T+ +    
Sbjct: 1009 LYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAEN 1068

Query: 1449 -----QNYNLYNDDDDDDDDTKTGTTTLSNT----SVGVDNNVNNSRNTN 1489
                 Q   L  DDD+ +   K       NT    S+G    +N+   TN
Sbjct: 1069 KNKNKQFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1118

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 64/159 (40%), Gaps = 45/159 (28%)

Query: 68  NNNITNSIGNIARP--------KRHSSNSYNNYKTIPFTKRRIAACTPININNNNDNYNN 119
           NNN + ++ ++ RP        KRHSS+S+N+     F KRR+                 
Sbjct: 22  NNNYSQTVTDM-RPTTTAFLHQKRHSSSSHNDTPESSFAKRRVPGVV------------- 67

Query: 120 NENMILMNNNNNNNNINNSFIDNLDYLSNTNNNTNMSTMAQYTPSKGTTISRRPSIIIRK 179
                          +   FID +         TN    AQ TPSK   +SRRPS I RK
Sbjct: 68  -------------EPVGKGFIDGV---------TNGQISAQNTPSKVDDVSRRPS-ISRK 104

Query: 180 QQQQQQQSHFTTATTIKSPSNHTSVNITPQASNYDPASE 218
             +   Q+   + +T+  P +   VN T  A N +  S+
Sbjct: 105 VMESTPQAKTASISTMDVPKSPYYVNRTAVARNMEVVSK 143

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/1140 (40%), Positives = 664/1140 (58%), Gaps = 204/1140 (17%)

Query: 394  SSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFIT 453
            S+QALI KLQDIYK I+ QE++LQ+ CS +T+SQTTDLK +W +YKIN++L+NNY+ FIT
Sbjct: 272  STQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFIT 331

Query: 454  NALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVF 513
             ALLP+QS+ DL IG+EII++Y+IERRLWVYGTITFLDVLK FSNFMDPE+CCQFI HVF
Sbjct: 332  TALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVF 391

Query: 514  IAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGK 573
            I+I+ + + IP K+SI W  RLGDLSRMA ALYP G  DWKLSAE+WY EAMK+TY  GK
Sbjct: 392  ISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGK 451

Query: 574  LYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQ 633
            LYYHM+TVQQN+L AF+NLGKSVFC++ F P+QQY+QLVIDNIYQRA++ R   +  N+Q
Sbjct: 452  LYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQ 511

Query: 634  LIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIP 693
            +++YLKH E+M+LP F+E+ +LQ +  VYF  KFG                         
Sbjct: 512  ILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFG------------------------- 546

Query: 694  YSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVG 753
                              + F   + F  + MF+QN + +K++FRHS  FAQ+HILQ+VG
Sbjct: 547  ------------------QDFVGNNFFDTRSMFVQNLESVKFYFRHSPLFAQAHILQVVG 588

Query: 754  FGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNNIVNMTD 813
            +G+  N FALL+ELPKF+KD +  + ++K                 + T  +N  ++   
Sbjct: 589  YGNIGNAFALLYELPKFIKDNEISRQRKK-----------------SKTGVDNMSIDTLS 631

Query: 814  NNINTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLFDNNYSNILCEEFFENID 873
              ++ N  +D G            +Y N++                          ENID
Sbjct: 632  FQVSGNEIHDVG------------EYFNSL--------------------------ENID 653

Query: 874  LLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFIISIL 933
                 + +P  ++IW++SL+  N   + C ++VL+KFL GP + ALPHLL W++F+IS+ 
Sbjct: 654  K---EFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVA 710

Query: 934  LKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLIISLSNKYN 993
             KIE ++ D  S+ FW  F++ I PWN+I+NFLNVL+ +L D  N ++  L+  L   Y+
Sbjct: 711  FKIE-TLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKD--NSDSCSLVNQLCETYS 767

Query: 994  SMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNNTTTTTKN 1053
             +   SL+E+L  F++NE LPE+W CWG+LWFD I NK   S+T++              
Sbjct: 768  QL---SLDEILTNFSENEELPEVWNCWGSLWFDTIKNK---SETSY-------------- 807

Query: 1054 NGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFLCKSM 1113
                           L+  GI+D   LD P DGI F   D++G  F+KR+ R++FL K  
Sbjct: 808  -------------SGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGY 854

Query: 1114 IETFPNLGLKISH------ETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQN 1167
             E F + GL++++      E  N     +  +N    +F FK    +DP+  ++P  E +
Sbjct: 855  AEKF-DQGLRLTNINSLNSEEENIFTKKQEKRNI---DFLFK----FDPTYDLLPIDEAS 906

Query: 1168 IENENENENDDLEFNK--SILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYL 1225
                          NK   + S   E     E I E N+ L   P LS++ G E+IF+Y+
Sbjct: 907  --------------NKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDG-ESIFDYV 951

Query: 1226 GYKRLNFNIQSFHENGEIISGSIYSSWP-----------------------IDYNKFKEQ 1262
            GYK+L      + +NG +  G+IYS+W                        +D +K  E 
Sbjct: 952  GYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEI 1011

Query: 1263 QQQQQQQEHLVNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKM 1322
            ++++   ++L  D + ++ +  + ++  E    ++  + +   K+     N +  +T   
Sbjct: 1012 REKRLFAKYLECDESQESSD-HLAEVEREGDETEDETEETNSRKVDKYYTNQRDLDTIFK 1070

Query: 1323 GVSINK------HRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKD 1376
             + IN       + T+F+FDAT+WLRHFAHIYK++ +G L F +CLTTFQELRFLR+S+D
Sbjct: 1071 TIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRD 1130

Query: 1377 GNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAI 1436
             NV+EA+TRA+I +R LYK  K++PLRF G +A+ IEEHLEFEEQITWRSHV+EFVIEA+
Sbjct: 1131 ENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAV 1190

Query: 1437 IRSQERFKTKSIQNYNLYNDDDDDDDDTKTGTTTLSNTSVGVDNNVNNSRNTNVENELVT 1496
             +SQE      + N +   D D ++ DT     T          N N S N+ V + LVT
Sbjct: 1191 AKSQENGMFDELHNESAKADFDAENMDTADSADTKQR------GNSNASTNSKVLSVLVT 1244

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1107 (44%), Positives = 659/1107 (59%), Gaps = 200/1107 (18%)

Query: 385  PGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDL 444
            P  S+  + SSQ L+QKLQDIYK IVKQEI+LQ+RC +LT SQTT+LKNLWTIY++N +L
Sbjct: 371  PSVSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSEL 430

Query: 445  INNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEV 504
            ++NYI FIT A+ PTQ ++D  IG+EIIEIY+IERRLWVYGTITFLD+LK+FSNFMDPEV
Sbjct: 431  VDNYITFITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEV 490

Query: 505  CCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEA 564
            CCQFI HVFI+IS +L DIP KY + W Q+LGDLSRMAIALYPS FIDWKLSAE WY  A
Sbjct: 491  CCQFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAA 550

Query: 565  MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER 624
            M+FTY HGKLYYHMSTVQQNTLEAFVNLGKS+FC+ TF PSQQY+QLVI NIYQRA+ + 
Sbjct: 551  MEFTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADS 610

Query: 625  NNGNH-RNLQ-LIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNN 682
            NN N+ RN Q L++Y+KH EV LLP F ES +LQ VVL+YF  KFG+          D N
Sbjct: 611  NNSNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGV----------DYN 660

Query: 683  NNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGT 742
            N++N                               ++F ++ MF+QN D  K F+R+S  
Sbjct: 661  NSSN-------------------------------NMFISRKMFVQNNDQFKCFYRYSAA 689

Query: 743  FAQSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQT----ATTTTITANTSQ 798
            FA+S ILQ+VG+G+ K+PF+LLFELPK+LKDRK+KK KRK         T   +      
Sbjct: 690  FAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILKITQPRLYHRWVG 749

Query: 799  TTTTTTNNNIVNMTDNNINTNNDNDN--GNCP-SKDGSMMSIDYINNINLNSNSSNINQL 855
            TT  T  NN V +T      N D  N     P S D    S+ Y N++++          
Sbjct: 750  TTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVSIKC-------- 801

Query: 856  FDNNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPI 915
                 S I+ ++F     ++  P+ +P     W             C  I          
Sbjct: 802  -----SMIVWKKFLHAPFMIALPHTLP-----W-------------CYFI---------- 828

Query: 916  LIALPHLLTWIHFIISILLKIENS--ITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYL 973
                          ISI+L+++    +  N+   FW  F++ I PWNSIV FLNVL+ Y+
Sbjct: 829  --------------ISIVLQLDKHKNVAMNE---FWVEFVRRIFPWNSIVKFLNVLLAYM 871

Query: 974  LDNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNI 1033
            +DN  +++  ++  L   YNSM   SL+E+L +FN+NE LPE+WKC G+LWFD I  K  
Sbjct: 872  VDNCWEQS--ILNELCPFYNSM---SLDELLTYFNENEELPEVWKCRGSLWFDTIMEK-- 924

Query: 1034 NSDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVAND 1093
                + LN++ N        NG D   ++Y      +  G++D+   D P+DG  F  +D
Sbjct: 925  ----SNLNKDKNPEVI----NGSDFNINDY------KGNGVKDYKFFDFPIDGTDFDESD 970

Query: 1094 EDGINFYKRSIRLIFLCKSMIETFPNL-GLKISHETSNYCRNTK------IPQNFILNNF 1146
            E G  F+KR+ R+IFL K + E++  L GL +S+E   + R         + Q  +   F
Sbjct: 971  EIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELL--EF 1028

Query: 1147 AFKLTNLYDPSLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNL 1206
            +FKL                       N + D      +L +I+E F   E  +E+N + 
Sbjct: 1029 SFKL-----------------------NASSD----GVMLDDIIESF---ETPDEVNYDT 1058

Query: 1207 QLQPPLSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPID--YNKFKEQQQ 1264
               P LS++ G ++IF+Y+GYKR+  N  SF +NG+ IS S ++SW I    N+      
Sbjct: 1059 HKTPMLSMVDG-DSIFDYVGYKRVCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTC 1117

Query: 1265 QQQQQEHLV----NDSTMKNEN--------VTVGDITPEDASFKEFMKLSFHLKLSTRSN 1312
                 + +     NDS   + N        V      P+  + +EF     +        
Sbjct: 1118 SSITDDAISSGSGNDSAAASTNNDPMNELLVFNECFDPKYKTLEEFWSQEIY-------P 1170

Query: 1313 NSQTQNTHKMGVSINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLR 1372
            +SQT       +S+ + +T+F+ DATSWLRHFAHIYK++ +  LKFA+CLTTFQELR+LR
Sbjct: 1171 DSQT------NISL-QGKTYFILDATSWLRHFAHIYKIATSKILKFAICLTTFQELRYLR 1223

Query: 1373 KSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFV 1432
            KSKD NVVEA+TRAIIT+RQLY E  LLPLRFTGNVAT IEEHLEFEEQITWRSHVDEFV
Sbjct: 1224 KSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFV 1283

Query: 1433 IEAIIRSQERFKTKSIQNYNLYNDDDD 1459
            IEA+++++E+ +T  + + N+  D+ +
Sbjct: 1284 IEAVLKAEEK-RTDRLNDINMDTDEKE 1309

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1128 (42%), Positives = 642/1128 (56%), Gaps = 213/1128 (18%)

Query: 385  PGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDL 444
            P  ++T K SSQAL++KLQ+IY+ IV+QE +LQ RCSQLTTSQTTDLKNLW IYK+N +L
Sbjct: 272  PTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAEL 331

Query: 445  INNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEV 504
            I+NY  FIT ALLPTQ + DL IG+EIIE+YRIERRLWVYGTITFLDVLK+FSNFMDPEV
Sbjct: 332  IDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEV 391

Query: 505  CCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEA 564
            CCQFI +VFI+IS +L DIP K+SI WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY+EA
Sbjct: 392  CCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEA 451

Query: 565  MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER 624
            +K+T+ HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ER
Sbjct: 452  LKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER 511

Query: 625  NNGNHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNN 684
            N+G+HRN  L+EYLKHTEVMLLP+FLES +LQ+VVL +F+ KFG+               
Sbjct: 512  NSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVT-------------- 557

Query: 685  TNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFA 744
                                          + +D F  + +F+Q+ + LK+FFRH+  +A
Sbjct: 558  ------------------------------SNVDFFDPRLVFVQDSERLKHFFRHASLYA 587

Query: 745  QSHILQLVGFGDPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTT 804
            +SH+LQLVGFGDP+NPFALLFELPK LK+RKD++ KRK              S+++T+T 
Sbjct: 588  ESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRK--------------SKSSTST- 632

Query: 805  NNNIVNMTDNNINTNNDNDNG-NCPSK-----DGSMMSIDYINNINLNSNSSNINQLFDN 858
                        +T+ D+D     PS+     D +     + ++IN+   S +   +   
Sbjct: 633  ----------QYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAM 682

Query: 859  NYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIA 918
              S I+  +F     L   P+ +P                                    
Sbjct: 683  KCSMIVLRKFLHGPLLTALPHLLP------------------------------------ 706

Query: 919  LPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNIN 978
                  W +F+ +   ++  +I  ++ + FW + ++ + P+N+I+ FLNVL++Y ++N  
Sbjct: 707  ------WGYFLAATNSRV-ITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLY-MNNQT 758

Query: 979  DENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTT 1038
              NF         +      SL +++ +F +NE LPE+W+CWGTLWFD +  K+I     
Sbjct: 759  QANF----PFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHIT---- 810

Query: 1039 FLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGIN 1098
              N  + N+T                        G++DH  +D P+DGI F  NDE G  
Sbjct: 811  --NLTDINST------------------------GVKDHMFMDSPIDGISFDHNDESGEK 844

Query: 1099 FYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSL 1158
            F+KR  R+I L +++    P +GL+      N+             +  FK         
Sbjct: 845  FWKRCARVILLFRALALECP-VGLREISGGRNW------------RSLVFKF-------- 883

Query: 1159 IIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGN 1218
                            E    E+    L      F   E I  +NL+ Q   P   +  +
Sbjct: 884  ----------------EEPPSEWCDMYLEPFTLVFDTFEQISPVNLD-QRATPYCGMTPD 926

Query: 1219 ENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQ----QQQQQQEHLVN 1274
             +I    GY+ L  +   F+ NG++I+GS+Y+   ++ +          ++  +   LV 
Sbjct: 927  IDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRLLENGELV- 985

Query: 1275 DSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFV 1334
             ST + +  ++ D   E     EF++ + H K   R    Q      +    + H T+FV
Sbjct: 986  -STERRDYNSLID-REEQPIMDEFLRHT-HCKNDVRWE--QMLPRGDLHCFADTHVTYFV 1040

Query: 1335 FDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLY 1394
             DAT+WLRHF H+YKL+ N  LKFA+CLTTFQELRFLRKSKD +V+EA+TRA+IT+RQLY
Sbjct: 1041 LDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLY 1100

Query: 1395 KEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQNYNLY 1454
             E KLLPLRFTGNVA  +EEHLE EEQ+TWRSHVDEFVIEAI ++Q++F        N  
Sbjct: 1101 YERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKF--------NAL 1152

Query: 1455 NDDDD--DDDDTKTGTTTLSNTSVGVDNNVNNSRNTNVENELVTGFSS 1500
            NDD      D   TG     N    V +++N       +N  +  FS+
Sbjct: 1153 NDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQN--IKAFST 1198

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/1250 (41%), Positives = 708/1250 (56%), Gaps = 236/1250 (18%)

Query: 222  SPYYLTTNSYSNMKNNNNANTTNTNNTIQPSPLPLPLPMDIPTNNSNNNNNNNITRSNNN 281
            SP YL T S SN++    A T N N ++         P         + ++   TR+   
Sbjct: 95   SPSYLPTTSSSNLEA---AVTENENGSVN-------FPDICIERQRTDPHSVRYTRTEQG 144

Query: 282  N--PQSRYFSPSPLPPPLQQNHHQQQQTSHLNPISLSNSTSTSNPNINSSALNNNNNNNN 339
            N  PQS              NH      + +   S S    T + +    +   N++ ++
Sbjct: 145  NVRPQSH---------ESLSNHQHHTLPNSIQGGSSSAGLPTGDQDFREGSTPENSSRSS 195

Query: 340  NNTNTDNNNSNNNNSNNNKTTNNPHDDNNNNNNNNNNQQPPPPPPPGSSITTKTSSQALI 399
             +   DN  S    +++ ++ NN  ++NNN N N+    P   P          +SQAL+
Sbjct: 196  RHGPHDNQESKGYANSDERSNNNHENNNNNPNENSQAVSPSSSP----------TSQALV 245

Query: 400  QKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNALLPT 459
            QKLQDIY+ IVKQE++LQ+RC+QLTTSQTTDLKNLW IYKIN++LINNY+ FIT ALLP+
Sbjct: 246  QKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALLPS 305

Query: 460  QSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAISLI 519
            Q + DL IG+EI+ IYRIERRLWV+GTITFLDVLK+FSNFMDPEVCCQFI+HVFI+IS +
Sbjct: 306  QPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISISTM 365

Query: 520  LNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYYHMS 579
            L D+P K+S  W +RLGDLSRMAIALYPSGFIDWKLSAEHWY++A+   + HGKLYYHMS
Sbjct: 366  LGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYHMS 425

Query: 580  TVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLIEYLK 639
            TVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GNHRN  ++EYLK
Sbjct: 426  TVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEYLK 485

Query: 640  HTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPYSSSST 699
            H+EVMLL +FLES +LQ VVL +FQ KFG+                              
Sbjct: 486  HSEVMLLSSFLESPELQKVVLSFFQHKFGV------------------------------ 515

Query: 700  TTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFGDPKN 759
                  S+ NT       D F  +DMF+Q+ + +KYFFRH+  FA+SHILQ VGFGDPKN
Sbjct: 516  ------STSNT-------DFFNPRDMFLQDGERVKYFFRHAPAFAESHILQTVGFGDPKN 562

Query: 760  PFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNNIVNMTDNNINTN 819
            PFALLFELPKFLK+RK++K +RK+  + + T+I   TS  + +    N+           
Sbjct: 563  PFALLFELPKFLKERKERKERRKSKSSHSFTSI-ETTSHLSPSEYLENV----------- 610

Query: 820  NDNDNGNCPSKDGSMMSIDYINNINLNSNS-SNINQLFDNNYSNILCEEFFENIDLLQFP 878
                       D    + ++  ++ +   S S+IN +     S+I+ ++F     ++   
Sbjct: 611  -----------DSPRYAYEFPEDLAIWRESLSHIN-ITSARCSSIVFQKFLRGPLVVAVT 658

Query: 879  YKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFIISILLKIEN 938
            + +P +  +   +LK  +L S++     LK F              WI  +  I     N
Sbjct: 659  HMLPWSYFLLSLALKIDSLPSVE-----LKSF--------------WITLVRQIFPW--N 697

Query: 939  SITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKL--IISLSNKYNSMS 996
            SI D                      FLN+LM ++LDN    N+K   I +L  + +S+ 
Sbjct: 698  SIVD----------------------FLNMLMAFVLDN----NWKTSPIDTLCEQLDSVD 731

Query: 997  SSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNNTTTTTKNNGE 1056
            + SL E    F+++E+LPEIW+CWG LWFDVI +                     K+NGE
Sbjct: 732  ARSLVEH---FSEHEDLPEIWRCWGALWFDVIAD---------------------KSNGE 767

Query: 1057 --DILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFLCKSMI 1114
              D++N            G +DH   D P DGI F  +DE G  F+KR+ RLIF+ K + 
Sbjct: 768  DGDVINS-----------GSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIA 816

Query: 1115 ETFPNLGLKISHETSNYCRNTKIPQ--NFILNNFAFKLTNLYDPSLIIIPQTEQNIENEN 1172
            + F +LGL +    S +   ++ P      L NF+F            IP   Q      
Sbjct: 817  QEF-SLGLTL----SAFAPQSRRPMTAGHPLQNFSFNFEE--------IPAQSQ------ 857

Query: 1173 ENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLGYKRLNF 1232
                      +S + N +  F   E I   NL+  ++P  S+L G E+IF++ GY+++  
Sbjct: 858  ---------IQSFVRNQIPLF---EEIATGNLDPNIRPGQSMLEG-ESIFDFPGYRQMYA 904

Query: 1233 NIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTVGDITPED 1292
            +   F+++G +IS S+Y+S  ++    +       ++     DS  K EN  + ++   +
Sbjct: 905  DYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSN-KPENAQITELERLE 963

Query: 1293 ASF------KEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFAH 1346
              +       EF++ ++ +K      +    +    GVS      +FV DATSWLRHFAH
Sbjct: 964  RDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDS----GVS------YFVLDATSWLRHFAH 1013

Query: 1347 IYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTG 1406
            ++KL+ N  L+F +CLTTFQELRFLRKSKD +VVEA+TRA+IT+RQLY + KLLPLRFTG
Sbjct: 1014 VFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTG 1073

Query: 1407 NVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQNYNLYND 1456
            NVAT +EEHLEFEEQITWRSHVDEFVIEA+ ++Q++F+  + Q     +D
Sbjct: 1074 NVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHD 1123

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1050 (41%), Positives = 590/1050 (56%), Gaps = 180/1050 (17%)

Query: 398  LIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNALL 457
            L++KLQ+IYK IVKQE +LQ+RCS LTT QTTDLKNLW  YKIN +LI+NYI FIT ALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 458  PTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAIS 517
            P+QS++ L IG+EI+++YRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQFI++VFIA+S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 518  LILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYYH 577
             +L D+P KYSI WL+RLGDLSRMAIALYPSGF+DWKLSAEHWY E++KFT+ HGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 578  MSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLIEY 637
            MSTVQQNTLEAFVNLGKSVFC++ F PS QYMQLVIDNIYQRAF ER++  +R   +++Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 638  LKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPYSSS 697
            LKHTEVMLLP+FLES +LQNVV+ YFQ KFG+                            
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGV---------------------------- 555

Query: 698  STTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFGDP 757
                   SSS N          F    +FIQ+ + LK+FFRHS  F+QSHILQL GFGDP
Sbjct: 556  -------SSSGN---------FFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDP 599

Query: 758  KNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNNIVNMTDN-NI 816
            KNPFA+LFEL K LK RK++K ++K++++ +  ++      +    +  +  +  D+  +
Sbjct: 600  KNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKV 659

Query: 817  NTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLFDNNYSNILCEEFFENIDLLQ 876
                  D G          S+ YIN  ++                 I+   F     +  
Sbjct: 660  PYEFPLDLGVWKR------SLHYINVTSMKCGM-------------IVLRRFLYGPIVTA 700

Query: 877  FPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFIISILLKI 936
             P+ +P     WL  + +I +   + + + LKKF              WI FI       
Sbjct: 701  LPHVLP-----WLLFIISIQIRLDQVNDLTLKKF--------------WIVFI------- 734

Query: 937  ENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLIISLSNKYNSMS 996
                             + I PW+S++ F+N L+ Y +     +NF +   +S  Y  M+
Sbjct: 735  -----------------RRIFPWDSLITFMNTLIHYCMVT-GTKNFDIDAHMST-YLPMN 775

Query: 997  SSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNNTTTTTKNNGE 1056
                 E+L    +NENLPE W CWG+LWF+ I  K+ + D T                  
Sbjct: 776  R---EELLTSICENENLPECWSCWGSLWFNTISKKS-DLDVT------------------ 813

Query: 1057 DILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFLCKSMIET 1116
                       TL + G+ D   LD P +GI F  +DE G  +++R  R + L   + E 
Sbjct: 814  -----------TLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE- 861

Query: 1117 FPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQNIENENENEN 1176
                  +      + C+    P+     N  F+                      N++ N
Sbjct: 862  -----WEACDGYGHGCKKLN-PEATSWKNLVFRF---------------------NDDTN 894

Query: 1177 DDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQS 1236
            D L        N    F+  E I  +N +  LQ     +    +I N  G+K +  +   
Sbjct: 895  DQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFC 954

Query: 1237 FHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTVGDITPEDASFK 1296
            F++NG++I+ S+Y+  P++           Q  +    +  + N  + V D     ++  
Sbjct: 955  FNKNGDLITASLYTKGPLETANI-------QGGDDFNANKILDNGRLVVQDRLEYSSAID 1007

Query: 1297 EFMKLSFHLKLSTRSNNSQTQNTHKMG---VSINKHRTFFVFDATSWLRHFAHIYKLSKN 1353
            +  +      ++      +  N   +G      + + TFFV DAT+WLRHFAHIYKL+ +
Sbjct: 1008 KLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATS 1067

Query: 1354 GFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIE 1413
              LKFA+CLTTFQELRFLRKSKD +V+EA+TRA+I +RQLY E KLL LRFTGNVA  +E
Sbjct: 1068 SVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLE 1127

Query: 1414 EHLEFEEQITWRSHVDEFVIEAIIRSQERF 1443
            EHLE EEQ+TW+SHVDEFVI+AI ++Q++F
Sbjct: 1128 EHLEIEEQMTWKSHVDEFVIDAIAKAQDKF 1157

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1526

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/827 (48%), Positives = 536/827 (64%), Gaps = 117/827 (14%)

Query: 392  KTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINF 451
            K S+Q LIQKLQ+IYKLIV QE++LQD+C++L+TSQ+T LK LW+IYK+N DLINNYI F
Sbjct: 263  KKSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILF 322

Query: 452  ITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISH 511
            I  +L P+QS ND  IG+EI+EIY+IERRLW+YGTITFLD+LK+F+NFMDPE+  QFI+H
Sbjct: 323  ILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITH 382

Query: 512  VFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSH 571
            VF +IS +++D+P+ +   W QRLGDLSRMAIALYPS FIDWKLS+E+WY E+MKFT+SH
Sbjct: 383  VFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSH 442

Query: 572  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNH-- 629
            GKLYYH+STVQQN LEAFVNLGKSVFC +TF PSQ+YMQLVIDNIYQRAF+ERN+ +   
Sbjct: 443  GKLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSS 502

Query: 630  ------------------RNLQ---LIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFG 668
                              +N Q   LIEYLKH+EVMLLP FLE+  L+ VVL YF   FG
Sbjct: 503  NNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562

Query: 669  ILD--------STPQPQT-SDNNNNTNG-ANV-------NIPYSSSSTTTSSSSSSDNTT 711
             +         S P   T S +N + +G AN+       NIP SS+  T+ S        
Sbjct: 563  KIAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSES-------- 614

Query: 712  RSFTTIDIFRNQDMFIQ-NPDHLKYFFRHSGTFAQSHILQLVGFGDPKNPFALLFELPKF 770
                 I++F  +++F Q N D LKYFF++S TFA+SHILQL+GFGDPKNPFALLF+LPK+
Sbjct: 615  LQINAINLFNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKY 674

Query: 771  LKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNNIVNMTDNNINTNNDNDNGNCPSK 830
            LK+RK K+  + ++  +   T T   +  ++ T  ++ V+M      TN+D+ N   P+ 
Sbjct: 675  LKERKTKRKSKASNSNSNMNTNTTVNANISSNTIPSSDVSM---KYETNSDSSN---PTN 728

Query: 831  DGSMMSIDYINNINLNSNSSNINQLF-------------------------DNNYSNILC 865
              S +     +NI ++S++++                              D    N+  
Sbjct: 729  SKSSLYKSSNSNIVMSSSTTSFATAISTTNNSISSNMDVDTELQNNGMEDEDEMLDNLSP 788

Query: 866  EEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925
            ++FF N++ L+  + +P ++EIW ESLK IN+ISL CSIIVLKKFLNGP+ ++LPH+L W
Sbjct: 789  QDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLPW 848

Query: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985
             +FIIS+ L+IE S+ + +S+IFW  F++ I PWNSIV++LNV++  LLDN  + +  +I
Sbjct: 849  SYFIISLALRIE-SLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENS--MI 905

Query: 986  ISLSNKYNSMSSSSLNEMLKFFNQNE-NLPEIWKCWGTLWFDVICNKNINSDTTFLNQNN 1044
              L N Y   S+ +L+E+L  FN+NE  LPE+WKC+G+LWFDVI                
Sbjct: 906  TKLINNY---SNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAE-------------- 948

Query: 1045 NNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSI 1104
             N    +++  ++I               ++D   L+ P+DG+ F   +E+G NF+KRS 
Sbjct: 949  -NYQIYSRDCSKNI--------------SMKDTKCLNYPIDGLPFDEMEENGTNFWKRSC 993

Query: 1105 RLIFLCKSMIETFPNL-GLKISHETSNYCRNTKIPQNFILNNFAFKL 1150
            RLIFL K+MI  F    GL IS  TS YC  + IP N IL  FAFKL
Sbjct: 994  RLIFLFKTMITRFNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKL 1040

 Score =  227 bits (578), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 129/250 (51%), Positives = 160/250 (64%), Gaps = 13/250 (5%)

Query: 1203 NLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQ 1262
            N +L  +P LS++  NE++F Y GYKR   +  +F +NGE+IS S+Y+S  ID       
Sbjct: 1157 NTDLNCEPGLSLIE-NESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDTINGSSS 1215

Query: 1263 QQQQQQQEHLVNDSTMKNENVTVGDITPEDAS-------FKEFMKLS---FHLKLSTRSN 1312
                       ND +  + + T G    +++S        KE   +    F+  L     
Sbjct: 1216 NANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKILDPDYK 1275

Query: 1313 NSQTQNTHKM--GVSINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRF 1370
            N       +M    SI    T+FV DATSWLRHFAH+YKL+ NG LKFA+CLTTFQELRF
Sbjct: 1276 NIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRF 1335

Query: 1371 LRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDE 1430
            LRKSKD NV+EA+TRAIIT+RQLY E +LLPLRFTGN+AT IEEHLEFEEQITWRSHVDE
Sbjct: 1336 LRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDE 1395

Query: 1431 FVIEAIIRSQ 1440
            FVIEAI R+Q
Sbjct: 1396 FVIEAIKRAQ 1405

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W Hypothetical ORF
          Length = 1372

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/387 (72%), Positives = 315/387 (81%), Gaps = 43/387 (11%)

Query: 385 PGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDL 444
           P   + +K SSQAL+QKLQDIYK+IVKQEI+LQ+RCSQLTTSQTT+LKNLWTIYKIN DL
Sbjct: 404 PSVVVPSKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDL 463

Query: 445 INNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEV 504
           INNY+ F+T ALLP+Q++ D+ IGEEI+EIYRIERRLWVYGTITFLD+ K+FSNFMDPEV
Sbjct: 464 INNYVTFLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEV 523

Query: 505 CCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEA 564
           CCQFI+HVFI+IS +L DIP KY I WLQRLGDLSRMAIALYPSGFIDWKLSAEHWY EA
Sbjct: 524 CCQFITHVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEA 583

Query: 565 MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER 624
           MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQYMQLVIDNIYQRAFVER
Sbjct: 584 MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVER 643

Query: 625 NNGNHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNN 684
           NNGNHRN QLIEYLKH+EVMLLP+FLES DLQ VVL+YF+ KFG           D+NN 
Sbjct: 644 NNGNHRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFG----------CDSNN- 692

Query: 685 TNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFA 744
                                           ++IF  + MF QNPD+L+YFFRH+  FA
Sbjct: 693 --------------------------------VNIFDTRKMFCQNPDYLRYFFRHAPAFA 720

Query: 745 QSHILQLVGFGDPKNPFALLFELPKFL 771
           +SHILQLVGFGDPKNPFALLFELP+FL
Sbjct: 721 ESHILQLVGFGDPKNPFALLFELPRFL 747

 Score =  471 bits (1213), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 262/593 (44%), Positives = 349/593 (58%), Gaps = 92/593 (15%)

Query: 866  EEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925
            E FF NI+ L+FPY +P  +EIW ESL  IN+ SLKCS++VL+KFL GP+++ALPH + W
Sbjct: 788  EGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLKGPLVVALPHFMPW 847

Query: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985
             +FIIS+  KI++ +    S+ FW  F+  I PWN+IV+FLNVL+ Y+LD  N     L+
Sbjct: 848  TYFIISLAYKIKD-LNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYMLD--NSWKSSLV 904

Query: 986  ISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNN 1045
             SL  +Y+SM    L ++L +FN NE LPE+WKCWGTLWFD ICNK              
Sbjct: 905  DSLCGQYSSM---GLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKE------------- 948

Query: 1046 NTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIR 1105
                  +++ ED           L ++GI++H  LD P+DGI F ANDE G NF+KR+ R
Sbjct: 949  ------QSHVED-----------LESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACR 991

Query: 1106 LIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTE 1165
            +IFL K + E FP +G+ +S     YCR   +    IL +F+FKL    D  L+ +    
Sbjct: 992  IIFLFKGLAENFP-IGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPM---- 1046

Query: 1166 QNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYL 1225
                  N  +      +   L N +E F   E     N+++   P LS++ G E+IF+Y 
Sbjct: 1047 ------NPPQPSTTAIDLDHLKNTLEIF---EEASWENIHMDTIPMLSVIEG-ESIFDYA 1096

Query: 1226 GYKRLNFNIQSFHENGEIISGSIYSSW------------PIDYNKFKEQQQQQQ--QQEH 1271
            GY+RL+ +  S+ +NGE +S S+Y+SW            P   +    Q+   Q  Q+ H
Sbjct: 1097 GYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMH 1156

Query: 1272 LVNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRT 1331
            + N      E    G                F   L  R    QT ++           T
Sbjct: 1157 IFNQIM---EPGYCG---------------GFADDLFLRDALYQTAHSST---------T 1189

Query: 1332 FFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMR 1391
            +FV D T+WLRHF HIYKL+ +G LKFA+CLTTF ELRFLRK KD NVVEA+TRAIIT+R
Sbjct: 1190 YFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVR 1249

Query: 1392 QLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK 1444
            QLY EGKLLPLRFTGNVAT IEEHLEFEE+ITWRSHVDEFVIEA+ ++Q +F+
Sbjct: 1250 QLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQ 1302

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W Hypothetical ORF
          Length = 1148

 Score =  538 bits (1385), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 255/387 (65%), Positives = 300/387 (77%), Gaps = 43/387 (11%)

Query: 385 PGSSITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDL 444
           P +  T+  +SQAL+QKLQDIY+ IVKQE++LQ+RCSQLT SQTTDLKNLW IYK+N +L
Sbjct: 201 PAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTEL 260

Query: 445 INNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEV 504
           INNY+ FIT ALLP+Q + DL IG+EI+ IYRIERRLWV+GTITFLDVLK+FSNFMDPEV
Sbjct: 261 INNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEV 320

Query: 505 CCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEA 564
           CCQFI+HVFI+IS +L D+P K++  WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A
Sbjct: 321 CCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQA 380

Query: 565 MKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER 624
           +   + HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ER
Sbjct: 381 LSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER 440

Query: 625 NNGNHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNN 684
           N GN RN  ++EYLKH+EVMLL +FLES +LQ VVL +FQ KFGI               
Sbjct: 441 NGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGI--------------- 485

Query: 685 TNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFA 744
                                SS+NT       D F +Q +F+Q+ +  KYFFRH+  FA
Sbjct: 486 ---------------------SSNNT-------DYFSHQAIFLQDGERTKYFFRHAPAFA 517

Query: 745 QSHILQLVGFGDPKNPFALLFELPKFL 771
           +SHILQ+VGFG+PKNPFALLFELPKFL
Sbjct: 518 ESHILQMVGFGNPKNPFALLFELPKFL 544

 Score =  361 bits (926), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 223/590 (37%), Positives = 337/590 (57%), Gaps = 85/590 (14%)

Query: 867  EFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWI 926
            E+ E++D  +F Y+ P  + IW +SL +IN  S+KCS +VL+KFL+GP++ A  HLL W 
Sbjct: 575  EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWA 634

Query: 927  HFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII 986
            +F++S+ ++I+  +   + K FW +  + + PWNSIVNFLN+++ + LDN    +     
Sbjct: 635  YFLLSLAIRIDE-LPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTS----- 688

Query: 987  SLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNN 1046
            S+ N      S  +  ++  F+QNE+LPE+WKCWG LWFDVI +K+              
Sbjct: 689  SIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKS-------------- 734

Query: 1047 TTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRL 1106
                      D++++    +       ++DH   D P+DGI F  +DE G  F+KR+ RL
Sbjct: 735  ----------DVVDEGATYNS------VQDHMFGDMPVDGICFDEDDETGSRFWKRACRL 778

Query: 1107 IFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQ 1166
            +F+ K + + F N+GL ++       R+  +     L NF FK     DP          
Sbjct: 779  VFIFKGIAQEF-NMGLTLASVPLQSRRS--LAAGHPLQNFCFKFE---DPP--------- 823

Query: 1167 NIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLG 1226
             +++E+           +++S  M  F   E I E NL+    P  S+L G +++F   G
Sbjct: 824  -VDSES----------YALISTQMPAF---ENISERNLDPNAPPGQSMLEG-KSLFELPG 868

Query: 1227 YKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTVG 1286
            Y++L+ +   F++ G +I+ S+Y+S  ++            ++ +  +D   K +N  + 
Sbjct: 869  YRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFNTER-YSRSDELNKADNPQI- 926

Query: 1287 DITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKM-------GVSINKHRTFFVFDATS 1339
                     KE  K+   + L T  N    + T+ M         + +   ++FV DATS
Sbjct: 927  ---------KELDKME-RMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATS 976

Query: 1340 WLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKL 1399
            WLRHFAH+YKL+ NG L+FA+CLTTFQELRFLRKSKD +VVEA+TRA+IT+RQLY E +L
Sbjct: 977  WLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRL 1036

Query: 1400 LPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQ 1449
            LPLRFTGNVAT +EEHLEFEEQITWRSHVDEFVIEA+ ++Q +F+  + Q
Sbjct: 1037 LPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQ 1086

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
           similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  530 bits (1364), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 260/423 (61%), Positives = 307/423 (72%), Gaps = 54/423 (12%)

Query: 347 NNSNNNNSNNNKTTNNPHDDNNNNNNNNNNQQPPPPPPPGSSITTKTSSQALIQKLQDIY 406
              NNN   N+ + +N   DN +NN+N +    P  P          SSQ L++KLQ+IY
Sbjct: 282 REGNNNVGINSSSESNEDGDNGDNNHNVSTVAVPSKP----------SSQTLVEKLQEIY 331

Query: 407 KLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNALLPTQSKNDLH 466
           K IVKQE +LQ+RCSQLTTSQTTDLKNLW IYK+N +LI+NY  FIT ALLPTQ K DL 
Sbjct: 332 KNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFITTALLPTQPKADLL 391

Query: 467 IGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAISLILNDIPMK 526
           IG+EIIE+YRIERRLW+YGTITFLDVLK+FSNFMDPEVCCQFI +VFI+IS IL +IP  
Sbjct: 392 IGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVFISISNILGNIPPT 451

Query: 527 YSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYYHMSTVQQNTL 586
           +S+ WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+K+ + HGKLYYHMSTVQQNTL
Sbjct: 452 FSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGKLYYHMSTVQQNTL 511

Query: 587 EAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLIEYLKHTEVMLL 646
            AFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN+G+HR   ++EYLKHTEVMLL
Sbjct: 512 AAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSHIVEYLKHTEVMLL 571

Query: 647 PTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPYSSSSTTTSSSSS 706
           P+FLE+++ Q VVL +F  KFG                T  AN                 
Sbjct: 572 PSFLENVESQGVVLAFFDQKFG---------------ATGSAN----------------- 599

Query: 707 SDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFGDPKNPFALLFE 766
                        F    +F+Q+ + LK+FFRH+  +A+SHILQLVGFGDP+NPFALLFE
Sbjct: 600 ------------FFDPSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFE 647

Query: 767 LPK 769
           LPK
Sbjct: 648 LPK 650

 Score =  353 bits (907), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 226/588 (38%), Positives = 327/588 (55%), Gaps = 95/588 (16%)

Query: 867  EFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWI 926
            +FFE ++  +  Y+  Q + IW ESL  +N  S++CS++VL+KFLN  +L ALPHLL W 
Sbjct: 686  QFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWA 745

Query: 927  HFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDEN---FK 983
            +F++++ L++ ++I +  SK FW  F++ I PW SI NFLNVL++Y    IND+    F 
Sbjct: 746  YFLVAVGLRL-DAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLY----INDQKPTKFP 800

Query: 984  LIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQN 1043
            +   ++N  N      L E+L++F +NE+LPE+W CWGTLWFDVI +K+++         
Sbjct: 801  IDEYMANYINM----PLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVS--------- 847

Query: 1044 NNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRS 1103
                      N  DI            + G++DH  LD P+DGI F  +DE G  F+KR 
Sbjct: 848  ----------NLVDI-----------HSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRC 886

Query: 1104 IRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQ 1163
            +R+I L + +   FP  G    + + ++             +  FK      P+      
Sbjct: 887  VRVILLFRGIAYQFP-FGFTEFNGSDDW------------KSLVFKFNE--PPA------ 925

Query: 1164 TEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFN 1223
                            E+ +  L +  + +   E I  +N +LQ  P   ++ G  +I  
Sbjct: 926  ----------------EWKEQYLGSFSKEYGEFESISFVNTDLQSPPHKGMVLGT-DIRT 968

Query: 1224 YLGYKRLNFNIQSFHENGEIISGSIYSSW--------PIDYNKFKEQQQQQQQQEHLVND 1275
              GYK+L  +   F++NG++I+GS+Y+S         P D   F   ++  +  E LV  
Sbjct: 969  LQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLEN-ELLVTS 1027

Query: 1276 STMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVF 1335
                  N+   + TP      EF+K  +    ST S   Q      +    + H T+FV 
Sbjct: 1028 ERRDYNNLLDKEETP---IIDEFLKWRYS---STNSRWEQCLPRGDLQYFTDTHVTYFVL 1081

Query: 1336 DATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYK 1395
            DAT+WLRHF H+YKL+ +  LKFA+CLTTFQELRFLRKSKD +V+EA+TRA+IT+RQLY 
Sbjct: 1082 DATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYY 1141

Query: 1396 EGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF 1443
            E KLLPLRFTGNVA  +EEHLE EEQ+TWRSHVDEFVIEAI ++Q +F
Sbjct: 1142 ERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKF 1189

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score = 63.2 bits (152), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 97/218 (44%), Gaps = 41/218 (18%)

Query: 905  IVLKKFLNGPILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVN 964
            ++ KKFL   + I+ P +L W+ F IS+  ++ N +TD    + W   L+ ++PW+ IV 
Sbjct: 498  LLFKKFLMLNVAISQPFILPWLLFYISVASEVAN-VTDRHVLLLWKDLLQNLLPWDDIVT 556

Query: 965  FLN--VLMVYLLDNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGT 1022
            +LN  + MV    +IN +  + +I       ++ S SL ++L +     N  EI  C G 
Sbjct: 557  YLNESIDMVN-KHSINSKTLRALI------KNIKSCSLYDLLYYMMYESNFQEISMCEGF 609

Query: 1023 LWFDVICNKNINSDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDC 1082
            +WFD + +K   +  T    N +     + N  ED L   YD D                
Sbjct: 610  IWFDSLASKIKQASIT---TNESLMKFKSYNASEDSL--IYDDD---------------- 648

Query: 1083 PLDGIGFVANDEDGINFYKRSIRLIFLCKSMIETFPNL 1120
                      D+     + R++ +I L K++I  +P L
Sbjct: 649  ----------DQVYTKMWTRALLIILLIKNVINDYPEL 676

 Score = 63.2 bits (152), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 100/211 (47%), Gaps = 25/211 (11%)

Query: 434 LWTIYKINLDLINNYINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVL 493
           L  ++K++  +++ Y  FI  AL    ++ DL  G+E +   R+  RL  +     L+++
Sbjct: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 494 KSFSNFMDP----------EVCCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAI 543
           +++ N M            +   +FI    I I+ +L +IP+K+   W   +GDL+R+ +
Sbjct: 204 ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 544 ALYPSGFIDWKLSAEHWYN-----EAMKFTYSHGK----------LYYHMSTVQQNTLEA 588
            L       ++L++ H YN      A+ ++ ++GK           Y+++S VQ ++L  
Sbjct: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 589 FVNLGKSVFCQETFTPSQQYMQLVIDNIYQR 619
            V L K +  + T    +   QL ID I  +
Sbjct: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISK 354

>Kpol_324.1 s324 (1..16356) [16356 bp, 5451 aa] {ON} (1..16356) [16356
            nt, 5452 aa]
          Length = 5451

 Score = 37.0 bits (84), Expect = 0.51,   Method: Composition-based stats.
 Identities = 42/218 (19%), Positives = 89/218 (40%), Gaps = 40/218 (18%)

Query: 185  QQSHFTTATTIKSPSNHTSVNITPQASNYDPA--------SEPPNSPYYLTTNSYSNMKN 236
            + ++ T  T      N  + NI+   ++ DPA        S PP S    TTN      +
Sbjct: 5213 ETTNLTDNTATHITPNDPADNISTHITSTDPADNTTSTTSSVPPASVASETTNP----TD 5268

Query: 237  NNNANTTNTNNTIQPSPLPLPLPMDIPTNNSNNNNNNNITRSNNNNPQSRYFSPSPLPPP 296
            N + + T+T++    + +   +P     + + N  +N  T   +N+P    F+       
Sbjct: 5269 NTSTHITSTDSARHTTVITSSVPPSSAASETTNLTDNTATHITSNDPTDNIFT------- 5321

Query: 297  LQQNHHQQQQTSHLNPISLSNSTSTSNPNINSSALNNNNNNNNNNTNTDNNNSNNNNSNN 356
                        H+     +++T+++  ++  +++ +   N  +NT T   +++  ++  
Sbjct: 5322 ------------HITSTDPADNTTSTTSSVPPASVASETTNPTDNTATHITSTDKADNTT 5369

Query: 357  NKTTNNPHDDNNNNNNNNNNQQPPPPPPPGSSITTKTS 394
            + T++ P         N+N Q      P GSS+T  +S
Sbjct: 5370 STTSSVP---------NSNTQSVTTLVPSGSSMTAVSS 5398

>TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.251
           YKL145W
          Length = 468

 Score = 35.4 bits (80), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 29/54 (53%)

Query: 304 QQQTSHLNPISLSNSTSTSNPNINSSALNNNNNNNNNNTNTDNNNSNNNNSNNN 357
           +Q+ S  +P+ ++  T     N +    N+ +NN+ NNT  D+ N NNN   +N
Sbjct: 87  RQRLSSEHPLQVARCTKIIKANSDLENSNSMDNNSTNNTPLDDTNHNNNIDEDN 140

 Score = 35.0 bits (79), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 22/32 (68%), Gaps = 4/32 (12%)

Query: 341 NTNTDNNNSNNNNSNNNKTTNNPHDDNNNNNN 372
           N++ +N+NS +NNS NN     P DD N+NNN
Sbjct: 108 NSDLENSNSMDNNSTNN----TPLDDTNHNNN 135

>Ecym_3207 Chr3 complement(393631..395553) [1923 bp, 640 aa] {ON}
           similar to Ashbya gossypii AAL051C
          Length = 640

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 46/102 (45%), Gaps = 4/102 (3%)

Query: 235 KNNNNANTTNTNNTIQPSPLPLPLPMDIPTNNSNNNNNNNITRSNNNNPQSRYFSPSPLP 294
           +N    +   +N  I+   +P    MDI    SNN N++ +  S  +N  S  + P P  
Sbjct: 490 QNPRKESHLGSNTLIKDHIIPNSAYMDI---VSNNENHDVLLISTPDNSSSVIYHPQPYI 546

Query: 295 PPLQQNHHQQQQTSHL-NPISLSNSTSTSNPNINSSALNNNN 335
            PL        ++ HL +PIS  + T  S  N+  S LN+ N
Sbjct: 547 SPLNGRSELHSKSLHLVDPISPKSQTLCSEKNVEVSQLNSKN 588

>Skud_13.70 Chr13 complement(122945..127570) [4626 bp, 1541 aa] {ON}
            YML072C (REAL)
          Length = 1541

 Score = 34.7 bits (78), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 4/60 (6%)

Query: 196  KSPSNHTSVNITPQAS-NYDPASEPPNSPYYLTTNSYSNMKN-NNNANTTNTNNTIQPSP 253
            KSPSN    + TP+AS +YDP+   PN+ Y    N  S +K  +NN+++ N  +T   +P
Sbjct: 1335 KSPSNFNGASATPRASLDYDPSV--PNTSYAAVQNGSSAVKQVDNNSSSGNKKDTPSSTP 1392

>YOL112W Chr15 (106710..108188) [1479 bp, 492 aa] {ON}
            MSB4GTPase-activating protein of the Ras superfamily that
            acts primarily on Sec4p, localizes to the bud site and
            bud tip, has similarity to Msb3p; msb3 msb4 double
            mutation causes defects in secretion and actin
            organization
          Length = 492

 Score = 33.9 bits (76), Expect = 3.3,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 29/55 (52%)

Query: 1231 NFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTV 1285
            NF+   F + G  IS   Y  W  +YN++ E+++++ +   L N   + N+N  V
Sbjct: 78   NFDRYGFSKKGYFISQEEYDKWWTEYNRYTERRKKKWENFLLKNKIELHNDNPLV 132

>NDAI0B05130 Chr2 complement(1254612..1257089) [2478 bp, 825 aa] {ON}
            Anc_1.256
          Length = 825

 Score = 34.3 bits (77), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 1343 HFAHIYKLSKNGFLKFAVCLTTFQELRF------LRKSKDGNVVEASTRAIITMRQLYKE 1396
            H + I KLSKN      V +    +         LRK + G V++   +  I  R+ +KE
Sbjct: 529  HLSKIKKLSKNMVKSLKVKMNNRYKFNMVLDDLDLRKRRPGPVLDRLVKKSIDRRKRHKE 588

Query: 1397 GKLLPLRFTGNVATDIEEHLEFEEQITWR 1425
            G LL +         +++ ++F+E +T R
Sbjct: 589  GNLLKILLEELDPASLKDDIKFDENVTNR 617

>TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 33.9 bits (76), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 25/56 (44%)

Query: 329 SALNNNNNNNNNNTNTDNNNSNNNNSNNNKTTNNPHDDNNNNNNNNNNQQPPPPPP 384
           S +    +++N   NTD  +  +  SN N+T   P  D    + N  N   PP PP
Sbjct: 5   STIVEQEHSSNLLDNTDITSVASTPSNKNETDITPEGDPKTESENATNIAAPPSPP 60

>Kpol_1020.37 s1020 complement(79930..81597) [1668 bp, 555 aa] {ON}
           complement(79930..81597) [1668 nt, 556 aa]
          Length = 555

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 2/68 (2%)

Query: 310 LNPISLSNSTSTSNPNINSSALNNNNNNNNNNTNTDNNNSNNNNSNNNKTTNNPHDDNNN 369
            N I +          ++   LN + N N N+ +T+++N  NN+SN+  T+N  H  N+N
Sbjct: 89  FNKIDVDQDGKIKPSEVSKYLLNLSRNCNGNSGDTNHDNIANNDSNS--TSNKVHGKNHN 146

Query: 370 NNNNNNNQ 377
           N+N + N+
Sbjct: 147 NSNQDKNE 154

>CAGL0L11220g Chr12 (1197228..1198547) [1320 bp, 439 aa] {ON}
           similar to uniprot|P33441 Saccharomyces cerevisiae
           YML062c MFT1 mitochondrial fusion target protein
          Length = 439

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 12/84 (14%)

Query: 662 YFQTKFGILDST----PQPQTSDNNNNTNGANVNIPYSSSSTTTSSSSSSDNTTRSFTTI 717
           Y Q +FG    T      P+ + +NN+ NG    +P  ++ST+++   ++D+++R+ +  
Sbjct: 175 YLQDRFGKASKTGNFKKHPRNTGSNNDHNGE--ALP-ETTSTSSTDKGNTDDSSRNDSIT 231

Query: 718 DIFRNQ-----DMFIQNPDHLKYF 736
           DI R Q     D F + P  LK+ 
Sbjct: 232 DIDREQTLTAFDDFSKGPAELKHI 255

>Suva_14.394 Chr14 (676747..678666) [1920 bp, 639 aa] {ON} YNR038W
           (REAL)
          Length = 639

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 47/110 (42%), Gaps = 12/110 (10%)

Query: 877 FPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFIISILLKI 936
             Y IP      +++L    +  L+C IIV  K L   +   L  L      I+SI  K+
Sbjct: 252 LAYSIP-----VVQTLSKRQINRLRCLIIVPTKLLINQVYTTLAKLTQGTSLIVSI-AKL 305

Query: 937 ENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII 986
           ENS+ D  SK         I     +V+ LN      + +IN +N K +I
Sbjct: 306 ENSLKDEHSKFLNLEPDILITTPGRLVDHLN------MKSINLKNLKFLI 349

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 216,918,426
Number of extensions: 13881613
Number of successful extensions: 687552
Number of sequences better than 10.0: 7716
Number of HSP's gapped: 348005
Number of HSP's successfully gapped: 27916
Length of query: 1556
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1433
Effective length of database: 39,377,481
Effective search space: 56427930273
Effective search space used: 56427930273
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 73 (32.7 bits)