Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E050705.706ON1556116147000.0
NCAS0A031705.706ON131937614561e-176
ZYRO0B16412g5.706ON137237613971e-167
TDEL0B021405.706ON114737613551e-163
Smik_11.3605.706ON118037513441e-161
YKR096W5.706ON119537513421e-161
Suva_11.3335.706ON118737513381e-160
Skud_11.3365.706ON118837513321e-159
KNAG0C066305.706ON128137713191e-156
SAKL0E15004g5.706ON119637612921e-154
Kwal_55.196785.706ON117837612821e-152
KAFR0H001805.706ON124137712841e-152
KLTH0E00968g5.706ON114837612611e-150
AFR290W5.706ON121737612651e-150
Kpol_1043.735.706ON126037812481e-147
CAGL0G02541g5.706ON129537312331e-144
Ecym_40155.706ON125737412221e-143
KLLA0A00528g5.706ON122937412111e-142
Suva_9.375.706ON111738311781e-138
YIL151C5.706ON111838211601e-136
Skud_9.175.706ON111838311561e-135
Smik_9.185.706ON111838211491e-134
TPHA0E001905.706ON136137811391e-131
CAGL0H06611g5.706ON128237610921e-125
TBLA0E017105.706ON152640910891e-123
TPHA0D046405.706ON9622111392e-07
NDAI0B051301.256ON82589801.4
Suva_14.3946.355ON639110755.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E05070
         (1556 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...  1815   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   565   e-176
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...   542   e-167
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...   526   e-163
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   522   e-161
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   521   e-161
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   520   e-160
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   517   e-159
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   512   e-156
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...   502   e-154
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   498   e-152
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...   499   e-152
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   490   e-150
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   491   e-150
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   485   e-147
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   479   e-144
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   475   e-143
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   471   e-142
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   458   e-138
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   451   e-136
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   449   e-135
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   447   e-134
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   443   e-131
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   425   e-125
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   424   e-123
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...    58   2e-07
NDAI0B05130 Chr2 complement(1254612..1257089) [2478 bp, 825 aa] ...    35   1.4  
Suva_14.394 Chr14 (676747..678666) [1920 bp, 639 aa] {ON} YNR038...    33   5.5  

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_5.706
            YIL151C
          Length = 1556

 Score = 1815 bits (4700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 928/1161 (79%), Positives = 928/1161 (79%)

Query: 396  QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
            QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA
Sbjct: 396  QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455

Query: 456  LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
            LLPTQSKNDLHIG            LWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA
Sbjct: 456  LLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515

Query: 516  ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
            ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY
Sbjct: 516  ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575

Query: 576  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635
            YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI
Sbjct: 576  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635

Query: 636  EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYX 695
            EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSD           IPY 
Sbjct: 636  EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPYS 695

Query: 696  XXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755
                                 IDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG
Sbjct: 696  SSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755

Query: 756  DPKNPFALLFELPKFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 815
            DPKNPFALLFELPKFL                                            
Sbjct: 756  DPKNPFALLFELPKFLKDRKDKKSKRKNSQTATTTTITANTSQTTTTTTNNNIVNMTDNN 815

Query: 816  XXXXXXXXXGNCPSKDGSMMSIDYXXXXXXXXXXXXXXQLFDNNYSNILCEEFFENIDLL 875
                     GNCPSKDGSMMSIDY              QLFDNNYSNILCEEFFENIDLL
Sbjct: 816  INTNNDNDNGNCPSKDGSMMSIDYINNINLNSNSSNINQLFDNNYSNILCEEFFENIDLL 875

Query: 876  QFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFIISILLK 935
            QFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFIISILLK
Sbjct: 876  QFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFIISILLK 935

Query: 936  IENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLIIXXXXXXXXX 995
            IENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII         
Sbjct: 936  IENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLIISLSNKYNSM 995

Query: 996  XXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXXXXXXXXXXXXG 1055
                      FFNQNENLPEIWKCWGTLWFDVICNKNINSD                  G
Sbjct: 996  SSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNNTTTTTKNNG 1055

Query: 1056 EDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFLCKSMIE 1115
            EDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFLCKSMIE
Sbjct: 1056 EDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFLCKSMIE 1115

Query: 1116 TFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTXXXXXXXXXXX 1175
            TFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQT           
Sbjct: 1116 TFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQNIENENENE 1175

Query: 1176 XXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQ 1235
                   KSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQ
Sbjct: 1176 NDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQ 1235

Query: 1236 SFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKNENVTVGDITPEDASF 1295
            SFHENGEIISGSIYSSWPIDYNKFKE        EHLVNDSTMKNENVTVGDITPEDASF
Sbjct: 1236 SFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTVGDITPEDASF 1295

Query: 1296 KEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFAHIYKLSKNGF 1355
            KEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFAHIYKLSKNGF
Sbjct: 1296 KEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFAHIYKLSKNGF 1355

Query: 1356 LKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEH 1415
            LKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEH
Sbjct: 1356 LKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEH 1415

Query: 1416 LEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQNYNLYNXXXXXXXXXXXXXXXLXXXX 1475
            LEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQNYNLYN               L    
Sbjct: 1416 LEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQNYNLYNDDDDDDDDTKTGTTTLSNTS 1475

Query: 1476 XXXXXXXXXXXXXXXXXELVTGFSSPTPLPIDVTADDKMNKNQXXXXXXXXXXXXXXXXX 1535
                             ELVTGFSSPTPLPIDVTADDKMNKNQ                 
Sbjct: 1476 VGVDNNVNNSRNTNVENELVTGFSSPTPLPIDVTADDKMNKNQINDIANANATSDIDIDI 1535

Query: 1536 XXXXXEGELFLLMKKISNMLF 1556
                 EGELFLLMKKISNMLF
Sbjct: 1536 DANDDEGELFLLMKKISNMLF 1556

 Score =  176 bits (447), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/226 (46%), Positives = 106/226 (46%)

Query: 1   MPQASSSTLRNLVRLPPXXXXXXXXXXXXXXXVDPAYXXXXXXXXXXXXXXXXXXXXXXX 60
           MPQASSSTLRNLVRLPP               VDPAY                       
Sbjct: 1   MPQASSSTLRNLVRLPPTNTATATATATNTTTVDPAYNNENNNNNNFDDNSINDGIINNT 60

Query: 61  XXXXXXXXXXXXXXXXXXARPKRHSSNSYNNYKTIPFTKRRIAACTPXXXXXXXXXXXXX 120
                             ARPKRHSSNSYNNYKTIPFTKRRIAACTP             
Sbjct: 61  NNTIDSINNNITNSIGNIARPKRHSSNSYNNYKTIPFTKRRIAACTPININNNNDNYNNN 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXLDYLXXXXXXXXXXXXAQYTPSKGTTXXXXXXXXXXKX 180
                                 LDYL            AQYTPSKGTT          K 
Sbjct: 121 ENMILMNNNNNNNNINNSFIDNLDYLSNTNNNTNMSTMAQYTPSKGTTISRRPSIIIRKQ 180

Query: 181 XXXXXXSHFTTATTIKSPSNHTSVNITPQASNYDPASEPPNSPYYL 226
                 SHFTTATTIKSPSNHTSVNITPQASNYDPASEPPNSPYYL
Sbjct: 181 QQQQQQSHFTTATTIKSPSNHTSVNITPQASNYDPASEPPNSPYYL 226

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1319

 Score =  565 bits (1456), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 277/376 (73%), Positives = 308/376 (81%), Gaps = 24/376 (6%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           +AL++KLQDIYK+IVKQEI+LQ+RCSQLTTSQTTDLKNLWTIYK+N+DLINNY+ FIT A
Sbjct: 298 EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LL +QS+ DLHIG            LWVYGTITFLDVLK+FSNFMDPEVCCQFI+HVFI+
Sbjct: 358 LLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           +S +L DIP KYSI WLQRLGDLSRMAIALYPSGFIDWKLSAE WY EAMKFTY+HGKLY
Sbjct: 418 LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635
           YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGN+RNLQLI
Sbjct: 478 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLI 537

Query: 636 EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYX 695
           EYLKH+EVMLLPTFLE+ +LQ VVL+YFQ KFGIL+ T  P TS+               
Sbjct: 538 EYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTI-PSTSE--------------- 581

Query: 696 XXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755
                                ID+FR++DMFIQNP+ LKYFFRH+  FA+SHILQLVGFG
Sbjct: 582 --------TISINTMNNNTRTIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFG 633

Query: 756 DPKNPFALLFELPKFL 771
           DPKNPFALLFELPK+L
Sbjct: 634 DPKNPFALLFELPKYL 649

 Score =  541 bits (1393), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 303/633 (47%), Positives = 387/633 (61%), Gaps = 73/633 (11%)

Query: 829  SKDGSMMSIDYXXXXXXXXXXXXXXQLFDNNYSN-ILCEEFFENIDLLQFPYKIPQTIEI 887
            + DGSMMSID                LF +N  N +  EEFF+NI+ L+F Y IP ++EI
Sbjct: 676  AGDGSMMSID-----NSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQLRFDYFIPNSLEI 730

Query: 888  WLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFIISILLKIENSITDNQSKI 947
            W+ SL +INLISLKCS+IVLKKFL+GP+LIALPHLL W +FIISILLK E  +T   SKI
Sbjct: 731  WMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILLKRE-GLTHEDSKI 789

Query: 948  FWYSFLKCIIPWNSIVNFLNVLMVYLLDNI--------NDENFK-LIIXXXXXXXXXXXX 998
            FW   LK I PWN I+NFLNVL+ Y LDNI        ND   K + +            
Sbjct: 790  FWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNVFILDLCNKYSTM 849

Query: 999  XXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXXXXXXXXXXXXGEDI 1058
                    FN+NE+LPE+WKCWGTLWFD I NKN                          
Sbjct: 850  GFADLLQHFNENEDLPEVWKCWGTLWFDTISNKN-------------------------- 883

Query: 1059 LNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRLIFLCKSMIETFP 1118
                 D D +   +GI+DH  LD P+DGIG+V  DE G NF+KR++R+IFL K + E F 
Sbjct: 884  ---GMDAD-SFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFD 939

Query: 1119 NLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTXXXXXXXXXXXXXX 1178
            +LGLK+S+      RN  +P + IL  F+FK                             
Sbjct: 940  SLGLKVSYNAGTEYRNNNVPMDNILKMFSFKWAG------------SNADYVDANLGDEL 987

Query: 1179 XXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQSFH 1238
                 +I++ I EF  I EPI E NLN ++ PPL  +  NE+IF+Y GYK+L  N +SF 
Sbjct: 988  EIYTNTIINRITEFVDIKEPIHETNLNFEI-PPLKSMIANEDIFDYTGYKKLEPNSRSFD 1046

Query: 1239 ENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKNENVTVGDITPEDASFKEF 1298
            +NGE  SGSIY++WP+DY++            +   ++T +  ++  G ++ ++ SF++ 
Sbjct: 1047 KNGEFSSGSIYTAWPMDYDQL-----ILAQNNNNNTNATDEMTDLFTGTLSIDELSFRQL 1101

Query: 1299 MKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKF 1358
             +  F  K +  S+ S            N+++T+FVFDATSWLRHFAHIYKL+ N  LKF
Sbjct: 1102 KRPEFRDKSTLLSSTSTE--------PFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKF 1153

Query: 1359 AVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEF 1418
            AVCLTTFQELRFLRKSKD NVVEASTRAIITMRQLY +G LLPLRFTGNVATDIEEHLEF
Sbjct: 1154 AVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEF 1213

Query: 1419 EEQITWRSHVDEFVIEAIIRSQERF-KTKSIQN 1450
            EEQITWRSHVDEFVIEA++++QE+F K+K+++N
Sbjct: 1214 EEQITWRSHVDEFVIEAVMKAQEKFVKSKTVEN 1246

 Score = 37.4 bits (85), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/24 (70%), Positives = 18/24 (75%)

Query: 80  RPKRHSSNSYNNYKTIPFTKRRIA 103
           R KRHSSNSY+N K  P  KRRIA
Sbjct: 53  RQKRHSSNSYSNAKNNPAVKRRIA 76

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W Hypothetical ORF
          Length = 1372

 Score =  542 bits (1397), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 266/376 (70%), Positives = 295/376 (78%), Gaps = 43/376 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           QAL+QKLQDIYK+IVKQEI+LQ+RCSQLTTSQTT+LKNLWTIYKIN DLINNY+ F+T A
Sbjct: 415 QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LLP+Q++ D+ IG            LWVYGTITFLD+ K+FSNFMDPEVCCQFI+HVFI+
Sbjct: 475 LLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           IS +L DIP KY I WLQRLGDLSRMAIALYPSGFIDWKLSAEHWY EAMKFTYSHGKLY
Sbjct: 535 ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635
           YHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQYMQLVIDNIYQRAFVERNNGNHRN QLI
Sbjct: 595 YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654

Query: 636 EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYX 695
           EYLKH+EVMLLP+FLES DLQ VVL+YF+ KFG  DS                       
Sbjct: 655 EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFG-CDSN---------------------- 691

Query: 696 XXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755
                                ++IF  + MF QNPD+L+YFFRH+  FA+SHILQLVGFG
Sbjct: 692 --------------------NVNIFDTRKMFCQNPDYLRYFFRHAPAFAESHILQLVGFG 731

Query: 756 DPKNPFALLFELPKFL 771
           DPKNPFALLFELP+FL
Sbjct: 732 DPKNPFALLFELPRFL 747

 Score =  439 bits (1129), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 250/581 (43%), Positives = 334/581 (57%), Gaps = 68/581 (11%)

Query: 866  EEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925
            E FF NI+ L+FPY +P  +EIW ESL  IN+ SLKCS++VL+KFL GP+++ALPH + W
Sbjct: 788  EGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLKGPLVVALPHFMPW 847

Query: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985
             +FIIS+  KI++ +    S+ FW  F+  I PWN+IV+FLNVL+ Y+LDN    +    
Sbjct: 848  TYFIISLAYKIKD-LNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYMLDNSWKSSL--- 903

Query: 986  IXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXXX 1045
                                +FN NE LPE+WKCWGTLWFD ICNK              
Sbjct: 904  --VDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKE------------- 948

Query: 1046 XXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIR 1105
                      ED           L ++GI++H  LD P+DGI F ANDE G NF+KR+ R
Sbjct: 949  ------QSHVED-----------LESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACR 991

Query: 1106 LIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIII--PQ 1163
            +IFL K + E FP +G+ +S     YCR   +    IL +F+FKL    D  L+ +  PQ
Sbjct: 992  IIFLFKGLAENFP-IGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQ 1050

Query: 1164 TXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFN 1223
                                  L N +E F   E     N+++   P LS++ G E+IF+
Sbjct: 1051 PSTTAIDLDH------------LKNTLEIF---EEASWENIHMDTIPMLSVIEG-ESIFD 1094

Query: 1224 YLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKNENV 1283
            Y GY+RL+ +  S+ +NGE +S S+Y+SW  + N             H  +  + ++   
Sbjct: 1095 YAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNN----TNNTGVIPAHGSDVDSQRDAVQ 1150

Query: 1284 TVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRH 1343
            +V ++   +   +      F   L  R    QT ++           T+FV D T+WLRH
Sbjct: 1151 SVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTAHSST---------TYFVLDTTTWLRH 1201

Query: 1344 FAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLR 1403
            F HIYKL+ +G LKFA+CLTTF ELRFLRK KD NVVEA+TRAIIT+RQLY EGKLLPLR
Sbjct: 1202 FGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLR 1261

Query: 1404 FTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK 1444
            FTGNVAT IEEHLEFEE+ITWRSHVDEFVIEA+ ++Q +F+
Sbjct: 1262 FTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQ 1302

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1147

 Score =  526 bits (1355), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 261/376 (69%), Positives = 287/376 (76%), Gaps = 43/376 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           QAL+QKLQDIYK+IVKQEI+LQ+RCSQLT SQTT+LK LW IYK+N DLINNY+ FIT A
Sbjct: 238 QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LLP QS  DL IG            LWVYGTITFLDVLK+FSNFMDPEVC QFI+HVFI+
Sbjct: 298 LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           IS +L DIP +Y+I W QRLGDLSRMAIALYPSGFIDWKLSAEHWY EAMK+ Y HGKLY
Sbjct: 358 ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635
           YHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQRAFVERNNGNHRN QLI
Sbjct: 418 YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLI 477

Query: 636 EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYX 695
           EYLKH+EVMLLP+FLES DLQ VVL+YF+ KFG +D+                       
Sbjct: 478 EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFG-MDTNEN-------------------- 516

Query: 696 XXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755
                                 +IF  + MF QNPD LKYFFRH+  FA+SHILQLVGFG
Sbjct: 517 ----------------------NIFDTRQMFDQNPDQLKYFFRHAPAFAESHILQLVGFG 554

Query: 756 DPKNPFALLFELPKFL 771
           DPKNPFALLFELP+ L
Sbjct: 555 DPKNPFALLFELPRCL 570

 Score =  442 bits (1136), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 250/578 (43%), Positives = 332/578 (57%), Gaps = 95/578 (16%)

Query: 866  EEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925
            ++FF+NID L  PY  P ++E+W  SLK +N+ SL CS+IVLKKFL GP+++ALPHLL W
Sbjct: 613  QQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEGPMVVALPHLLPW 672

Query: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985
             +FII+++ K+++ ITD  S+ FW   +  I PWN+IVNFLNVL+ Y LDNI+       
Sbjct: 673  AYFIIAVVSKVQH-ITDGASREFWLELVNRIFPWNTIVNFLNVLIAYTLDNIHPS----- 726

Query: 986  IXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXXX 1045
            +                    FN NE+LPE+WKCWG LWFD IC+K              
Sbjct: 727  LPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDK-------------- 772

Query: 1046 XXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIR 1105
                      + +  D+Y++       GI+DH  LD P+DGIGF  +DE GI F+KR+ R
Sbjct: 773  ----------DKVQMDSYES------AGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACR 816

Query: 1106 LIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTX 1165
            +IFL K + E F    L +S +   +CR T  P N +L +F FKL + +  S        
Sbjct: 817  VIFLFKRIAENF-QTRLVVSSQAQVHCRRTD-PMNHVLKSFCFKLRDTFYNS-------- 866

Query: 1166 XXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYL 1225
                              S+L N +E F   E   + N ++Q+ P LS+L  NE+IF Y+
Sbjct: 867  -----------------NSVLQNTIEVF---EEGSDANKDMQMTPQLSVLE-NESIFGYV 905

Query: 1226 GYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKNENVTV 1285
            GYKRL  ++  +   GE +S S+Y+SW  + +K  E        +   N++ +  E +  
Sbjct: 906  GYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSK-NEIPQSEPTQQQTANEADLFIEGI-- 962

Query: 1286 GDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFA 1345
                  + S  EF                   N       +N   TFFV DATSWLRHFA
Sbjct: 963  ------NTSLTEF-------------------NIDFPECKMNGKDTFFVLDATSWLRHFA 997

Query: 1346 HIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFT 1405
            H+YKL+ N  L+FA+CLTTFQELRFLRKSKD NVVEA+TRA+IT+RQLY E ++LPLRFT
Sbjct: 998  HVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRFT 1057

Query: 1406 GNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF 1443
            GNVAT IEEHLEFEEQITWRSHVDEFV EAI ++Q R 
Sbjct: 1058 GNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARL 1095

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
           (REAL)
          Length = 1180

 Score =  522 bits (1344), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 257/375 (68%), Positives = 288/375 (76%), Gaps = 43/375 (11%)

Query: 397 ALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNAL 456
           ALIQKLQ++Y++IVKQEI+LQ+RCSQLT SQTT+LK+LWTIYKIN +L+NNY+ FIT AL
Sbjct: 255 ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314

Query: 457 LPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAI 516
           LP+Q  +DL IG            LWVYGTITFLDVLK+FSNFMDPEVCCQFI+HVFI++
Sbjct: 315 LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374

Query: 517 SLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYY 576
           S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+TY+HGKLYY
Sbjct: 375 STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434

Query: 577 HMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLIE 636
           HMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN  LIE
Sbjct: 435 HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 494

Query: 637 YLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYXX 696
           YLKH+E MLLP+FLES DLQNVVL YF  KFGI                           
Sbjct: 495 YLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGI--------------------------- 527

Query: 697 XXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFGD 756
                                +IF  +DMFIQNPD  KYFFRH  +FAQSHILQ+VGFG+
Sbjct: 528 ----------------DANGCNIFNCEDMFIQNPDFFKYFFRHGPSFAQSHILQIVGFGE 571

Query: 757 PKNPFALLFELPKFL 771
           PKNPFA+LFELPK+L
Sbjct: 572 PKNPFAILFELPKYL 586

 Score =  408 bits (1049), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 244/580 (42%), Positives = 332/580 (57%), Gaps = 96/580 (16%)

Query: 867  EFFENIDLLQFPYKIPQ--TIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLT 924
            EFF +ID L+ P  +P   T E WLE+LK +N+ SLKC +IVL+KFL+GP+ +ALPH+L 
Sbjct: 638  EFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLP 696

Query: 925  WIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKL 984
            WI+FIISI LK  N + D  SK FW   +K + PW+++V F+NVL+ YLLDN   E    
Sbjct: 697  WIYFIISICLK-SNQLNDPISKEFWIVIIKRMFPWDTMVTFMNVLIAYLLDN---ETSNS 752

Query: 985  IIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXX 1044
            II                    FN+NE+LPEIW CWGTLWFD IC KN +S         
Sbjct: 753  IIGDLCNEYSKLNLSELLNS--FNENEDLPEIWGCWGTLWFDAICQKNTHS--------- 801

Query: 1045 XXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSI 1104
                                ++   + +GI D+  LD P DGI F   DE+G  F+KR+ 
Sbjct: 802  ------------------ISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRAC 843

Query: 1105 RLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQT 1164
            R+IFL + +  +FP LG+ + H+    C  + +  N IL +  +KL  L +    +    
Sbjct: 844  RIIFLFREVSRSFP-LGVIVRHDPLVNC--SSLQSNNILRDLVYKLEPLTNIRSSV---- 896

Query: 1165 XXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNY 1224
                                +LS +   F I E   EIN +L   P LS++ G +NIF+Y
Sbjct: 897  -------------------PVLSTLESIFDISEARSEINTDLHAVPELSVING-DNIFHY 936

Query: 1225 LGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKNENVT 1284
            +GYK+L  +   F +NGE +S S+Y+SW                  ++ N +     N++
Sbjct: 937  VGYKKLRPDYTCFDKNGEFLSASLYTSW------------------YVPNCNNNLETNIS 978

Query: 1285 VGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHF 1344
              +    +A F E MK S H +++                 I+   T+FVFDATSWLRH 
Sbjct: 979  YANERENEALFLECMK-SVHPEIAY--------------PEIDFKTTYFVFDATSWLRHS 1023

Query: 1345 AHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRF 1404
            A I+KL++N  L+FA+CLTTFQELRFLRKSKD NV+EA+TR IIT+RQLY E K+LPLRF
Sbjct: 1024 ARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRF 1083

Query: 1405 TGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK 1444
            TGNVAT IEE+LEFEEQITWR+HVDEFVIE+I+++QE+ +
Sbjct: 1084 TGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1123

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
           unknown function that may interact with ribosomes, based
           on co-purification experiments; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus
           and cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  521 bits (1342), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 256/375 (68%), Positives = 287/375 (76%), Gaps = 43/375 (11%)

Query: 397 ALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNAL 456
           ALIQKLQ++YK+IVKQEI+LQ+RCSQLT SQTT+LK+LWTIYKIN DL+NNY+ FIT AL
Sbjct: 274 ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333

Query: 457 LPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAI 516
           LP+Q  +DL IG            LWVYGTITFLDVLK+FSNFMDPEVCCQFI+HVF+++
Sbjct: 334 LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393

Query: 517 SLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYY 576
           S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+HGKLYY
Sbjct: 394 STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453

Query: 577 HMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLIE 636
           HMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN  LIE
Sbjct: 454 HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 513

Query: 637 YLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYXX 696
           YLKH+E MLLP+FLES DLQNVVL YF  KFGI                           
Sbjct: 514 YLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGI--------------------------- 546

Query: 697 XXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFGD 756
                                +IF  +DMF+QNPD  KYFFRH  +FAQSHILQ+VGFG+
Sbjct: 547 ----------------DANGCNIFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQIVGFGE 590

Query: 757 PKNPFALLFELPKFL 771
           PKNPFA+LFELPK+L
Sbjct: 591 PKNPFAILFELPKYL 605

 Score =  380 bits (975), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 235/589 (39%), Positives = 323/589 (54%), Gaps = 106/589 (17%)

Query: 864  LCEEFFENIDLLQFPYKIPQ--TIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPH 921
            L  EFF +ID L+ P  +P   T E WLE+LK +N+ SLKC IIVL+KFL+GP+ IALPH
Sbjct: 654  LLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPH 712

Query: 922  LLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDEN 981
            +L WI+FIISI LK  + ++D  SK FW   +K   PW+++V F+NVL+VYLLDN    +
Sbjct: 713  ILPWIYFIISICLK-SSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNS 771

Query: 982  FKLIIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXX 1041
                                     FN+ E LPEI  CWGTLWFD IC KN +S      
Sbjct: 772  I-----IGDLCDDYDKLSLSELLELFNEGEELPEILGCWGTLWFDTICEKNTHS------ 820

Query: 1042 XXXXXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYK 1101
                                   ++   + +GI+D+  LD P DGI F   DE+G  F+K
Sbjct: 821  ---------------------ISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWK 859

Query: 1102 RSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFK---LTNLYDPSL 1158
            R+ R IFL + +  +FP +G+ I ++   Y   +      IL +  FK   L N+++   
Sbjct: 860  RACRTIFLFRELSRSFP-IGVIIRNDPLIY--RSSFQNTNILGSLVFKLEPLCNIHNN-- 914

Query: 1159 IIIPQTXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGN 1218
              IP                      +L  +     I E   E N +L   P LS+  G 
Sbjct: 915  --IP----------------------VLGALESIIDISEARSENNTDLHAVPELSVNEG- 949

Query: 1219 ENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTM 1278
            +NIF+Y+GYK+L  +   F +NGE +S S+Y++W +                   +++T 
Sbjct: 950  DNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTWYVPN-----------------SNNTN 992

Query: 1279 KNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDAT 1338
              +N+        +  F E +K  +                      I+   T+FVFDAT
Sbjct: 993  IEDNINYNSEKENEGLFLECIKSDYP--------------------EIDFKTTYFVFDAT 1032

Query: 1339 SWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGK 1398
            SWLRH A I+KL++N  L+FA+CLTTFQELRFLRKSKD NV+EA+TR IIT+RQLY E K
Sbjct: 1033 SWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENK 1092

Query: 1399 LLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKS 1447
            +LPLRFTGNVAT IEE+LEFEEQITWR+HVDEFVIE+++++QE+ ++ S
Sbjct: 1093 VLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESAS 1141

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187
           aa] {ON} YKR096W (REAL)
          Length = 1187

 Score =  520 bits (1338), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 255/375 (68%), Positives = 288/375 (76%), Gaps = 43/375 (11%)

Query: 397 ALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNAL 456
           ALIQKLQ++YK+IVKQEI+LQ+RCSQLT SQTT+LK+LWTIY+IN +L+NNY+ FIT AL
Sbjct: 267 ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTAL 326

Query: 457 LPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAI 516
           LP+Q ++DL IG            LWVYGTITFLDVLK+FSNFMDPEVCCQFI+HVF+++
Sbjct: 327 LPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 386

Query: 517 SLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYY 576
           S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+HGKLYY
Sbjct: 387 STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYY 446

Query: 577 HMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLIE 636
           HMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN  LIE
Sbjct: 447 HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 506

Query: 637 YLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYXX 696
           YLKH+E MLLP+FLES DLQNVVL YF  KFGI                           
Sbjct: 507 YLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGI--------------------------- 539

Query: 697 XXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFGD 756
                                +IF  +DMFIQNPD  KYFFRH+ +FAQSHILQ+VGFG+
Sbjct: 540 ----------------DANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGE 583

Query: 757 PKNPFALLFELPKFL 771
           PKNPFA+LFELPK L
Sbjct: 584 PKNPFAILFELPKHL 598

 Score =  391 bits (1004), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 240/579 (41%), Positives = 321/579 (55%), Gaps = 99/579 (17%)

Query: 867  EFFENIDLLQFPYKIPQ-TIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925
            EFF +ID L+ P      T E WLESLK +N+ SLKC +IVL+KFL+GP+ IALPH L W
Sbjct: 650  EFFNDIDTLRRPIVSSMLTNEAWLESLKFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPW 709

Query: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985
            I+FIISI LK  + ++D  SK FW   +K I PW+++V F+N+L+  +LDN   E    I
Sbjct: 710  IYFIISICLK-SSQLSDPISKEFWIVIVKRIFPWDTMVTFMNILIACVLDN---EMTSPI 765

Query: 986  IXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXXX 1045
            I                    F + E LPEIW CWGTLWFD IC KN NS          
Sbjct: 766  IGSLCDEYSDLNLAELLD--VFKEKEELPEIWGCWGTLWFDTICQKNTNS---------- 813

Query: 1046 XXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIR 1105
                               +D     +GI+D+  LD P+DGI F  NDE+G  F+KR+ R
Sbjct: 814  -----------------ISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACR 856

Query: 1106 LIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTX 1165
             IFL + +  +F  +G+ I++E+S     + +  N IL N ++KL  L      I     
Sbjct: 857  TIFLFRELSRSF-QIGVIINNESS--INRSSLQSNNILGNLSYKLEPLSTLGSSI----- 908

Query: 1166 XXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYL 1225
                                L+ +     + E   E N++L   P LS++ G  +IFNY 
Sbjct: 909  ------------------PTLNTLEGIIDVFETRSENNIDLHAVPELSVIKGG-SIFNYT 949

Query: 1226 GYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKNENVTV 1285
            GYK+L  N   F +NGE +S S+Y+SW                  ++ N S     N+  
Sbjct: 950  GYKKLCPNYTCFDKNGEFLSASLYTSW------------------YVPNGSNNPETNINS 991

Query: 1286 GDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFA 1345
                  +  F E +K          S++ +          I+ + T+FVFDATSWLRH A
Sbjct: 992  NCEKENEGQFLECLK----------SDDRE----------IDLNTTYFVFDATSWLRHSA 1031

Query: 1346 HIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFT 1405
             I+KL++N  LKFA+CLTTFQELRFLRKSKD NV+EA+TR IIT+RQLY E K+LPLRFT
Sbjct: 1032 RIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFT 1091

Query: 1406 GNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK 1444
            GNVAT IEE+LEFEEQITWR+HVDEFVIE+I+++QE+ +
Sbjct: 1092 GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1130

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
           [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  517 bits (1332), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 255/375 (68%), Positives = 288/375 (76%), Gaps = 43/375 (11%)

Query: 397 ALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNAL 456
           ALIQKLQ++YK+IVKQEI+LQ+RCSQLT SQTT+LK+LWTIY+IN +LINNY+ FIT AL
Sbjct: 268 ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTFITTAL 327

Query: 457 LPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAI 516
           LP+Q  +DL IG            LWVYGTITFLDVLK+FSNFMDPEVCCQFI+HVF+++
Sbjct: 328 LPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 387

Query: 517 SLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYY 576
           S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+HGKLYY
Sbjct: 388 STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 447

Query: 577 HMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLIE 636
           HMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN  LIE
Sbjct: 448 HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 507

Query: 637 YLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYXX 696
           YLKH+E MLLP+FLES DLQNVV+ YF  KFGI                           
Sbjct: 508 YLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGI--------------------------- 540

Query: 697 XXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFGD 756
                                +IF  +DMFIQNPD  KYFFRH+ +FAQSHILQ+VGFG+
Sbjct: 541 ----------------DANGCNIFNPEDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGE 584

Query: 757 PKNPFALLFELPKFL 771
           PKNPFA+LFELPK+L
Sbjct: 585 PKNPFAILFELPKYL 599

 Score =  393 bits (1009), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 243/581 (41%), Positives = 323/581 (55%), Gaps = 103/581 (17%)

Query: 867  EFFENIDLLQFPYKIPQ--TIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLT 924
            EFF +ID L+ P  +P   T E WLE+LK +N+ SLKC +IVL+KFL+GP+ IALPH+L 
Sbjct: 651  EFFNDIDTLRRPI-LPSMLTSEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILP 709

Query: 925  WIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKL 984
            WI+FII+  LK  N ++D  SK FW   +K + PW++IV F+NVL+ YLLDN   E    
Sbjct: 710  WIYFIIATCLK-SNQLSDPTSKDFWMIIVKRVFPWDTIVTFMNVLIAYLLDN---EALNP 765

Query: 985  IIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXX 1044
            II                    FN++E LPEIW CWGTLWFD IC KN +S         
Sbjct: 766  IIGELCSKYGTLNLAGLLES--FNESEELPEIWNCWGTLWFDTICQKNAHS--------- 814

Query: 1045 XXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSI 1104
                                +D   + +GI+D+  LD P DGI F   DE G  F+KR+ 
Sbjct: 815  ------------------ISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRAC 856

Query: 1105 RLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQT 1164
            R+IFL + +  TFP +G+ +S++    C +++   + IL N  +KL  L +         
Sbjct: 857  RIIFLFRELSRTFP-IGVIVSNDPLIKCSSSQ--SSIILRNLVYKLEPLSN--------- 904

Query: 1165 XXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNY 1224
                                IL+ +     I E   + N++L   P LS+  G +NIF+Y
Sbjct: 905  --------------IRSNTPILTALENSVDISEARSKNNIDLYAVPELSVNSG-DNIFHY 949

Query: 1225 LGYKRLNFNIQSFHENGEIISGSIYSSWPI-DYNKFKEXXXXXXXXEHLVNDSTMKNENV 1283
             GYK+L  +   F  NGE +S S+Y+ W + + N   E                + N ++
Sbjct: 950  TGYKKLRPDYTCFDRNGEFLSASLYTRWYLPNGNNISE---------------ALVNSDI 994

Query: 1284 TVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRH 1343
              GD   ED  F E MK                         I+   T+FVFDATSWLRH
Sbjct: 995  EKGD---EDL-FLECMKPD--------------------CPGIDFETTYFVFDATSWLRH 1030

Query: 1344 FAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLR 1403
             A I+KL++N  LKFA+CLTTFQELRFLRKSKD NV+EA+TR IIT+RQLY E K+LPLR
Sbjct: 1031 SARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLR 1090

Query: 1404 FTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK 1444
            FTGNVAT IEE+LEFEEQITWR+HVDEFVIE+I ++QE+ +
Sbjct: 1091 FTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLE 1131

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1281

 Score =  512 bits (1319), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 259/377 (68%), Positives = 286/377 (75%), Gaps = 44/377 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           QAL+QKLQDIYK+IVKQEI+LQ+RCSQLTTSQTT+LKNLWTIYKIN DLINNY  FIT A
Sbjct: 289 QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFITTA 348

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LLP+Q   D+ IG            LWVYGTITFLDVLK+FSNFMDPEVC QFI+HVFI+
Sbjct: 349 LLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFIS 408

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           +S IL DIP K++I WLQRLGDLSRMAIALYPSGFIDWKLSAEHWY EAMKFTYSHGKLY
Sbjct: 409 LSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 468

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERN-NGNHRNLQL 634
           YHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQR FV+RN  GN+RN  L
Sbjct: 469 YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRNPDL 528

Query: 635 IEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPY 694
           I+YLKH+EVMLLP+FL S DLQ VVL YFQ +FGI  S                      
Sbjct: 529 IDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSEN-------------------- 568

Query: 695 XXXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGF 754
                                  +IF  QDMF Q P  L++FFRH+  FA+SHILQLVGF
Sbjct: 569 -----------------------NIFDTQDMFFQPPSCLRFFFRHAPAFAESHILQLVGF 605

Query: 755 GDPKNPFALLFELPKFL 771
           G+PKNPFALLFELPK+L
Sbjct: 606 GNPKNPFALLFELPKYL 622

 Score =  450 bits (1158), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 263/609 (43%), Positives = 345/609 (56%), Gaps = 98/609 (16%)

Query: 867  EFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWI 926
            E+ +NI+ L++  + P  I  W++SL  IN+ SLKCS+IVLKKFL+GP+LIALPH L W 
Sbjct: 676  EYLDNIETLKYAIETPD-ICTWIKSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWT 734

Query: 927  HFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII 986
             FII+  +K+ N + + ++  FW   +K I PW++I +FLNVL+ Y+LDN    N  +I 
Sbjct: 735  VFIIACGIKV-NELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYG--NTTII- 790

Query: 987  XXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXXXX 1046
                                FN++E+LPE+WKCWGTLW+D ICNKN              
Sbjct: 791  --EELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTLWYDAICNKN-------------- 834

Query: 1047 XXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRL 1106
                           + D D T    GI DH  LD P+DGI F A DE G  F+KR++R+
Sbjct: 835  ---------------SVDAD-TFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRV 878

Query: 1107 IFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTXX 1166
            IFL K + + F + GLKISHE   YCRN K   +  L  F FKL +  +P+         
Sbjct: 879  IFLFKGISKKF-DFGLKISHEAGVYCRNEKAADS-PLRRFTFKLESYDEPTS-------- 928

Query: 1167 XXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLG 1226
                                S   EF  + E +  IN +    P LS++ G ENIF Y+G
Sbjct: 929  --------------------SKFNEFIPLCEEVSAINNDALATPSLSVVQG-ENIFEYMG 967

Query: 1227 YKRLNFNIQSFHENGEIISGSIYSSWPIDY-------------NKFKEXXXXXXXXEHLV 1273
            Y+ L  +  SF +NGEI+S SIY+SW ID              N   E           +
Sbjct: 968  YRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEAAAAASSATDNNAVSEGQGDLAANGTPI 1027

Query: 1274 NDSTMKNENVTVGDITP-------EDASFKEFMKLS-------FHLKLSTRSNNSQTQNT 1319
            + S       T   +T        E+  FK+FM L        +H  ++ +S     +N 
Sbjct: 1028 SASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKS--YLVKNL 1085

Query: 1320 HKMGV-SINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGN 1378
             +  V  +++ +TFF+FDATSWLRHFAHIYK++ NG LKF VCLTTFQELRFLRKSKD N
Sbjct: 1086 WESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDEN 1145

Query: 1379 VVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIR 1438
            VVEA+ RAIITMRQLY+E +LLPLRFTGNVA DIEEHLEFEEQITWRSHVDEFVIEA+++
Sbjct: 1146 VVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMK 1205

Query: 1439 SQERFKTKS 1447
            +Q++F T  
Sbjct: 1206 AQDKFTTAG 1214

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W Hypothetical ORF
          Length = 1196

 Score =  502 bits (1292), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 242/376 (64%), Positives = 286/376 (76%), Gaps = 43/376 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           QAL+QKLQDIY+ IVKQEI+LQ+RCSQLT SQTTD+KNLW IYK+N +LINNYI+FIT A
Sbjct: 244 QALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITTA 303

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LLP+Q + DL IG            LWVYGTITFLDVLK+FSNFMDPEVCCQFISHVF++
Sbjct: 304 LLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFMS 363

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           IS +L D+P +YSI WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY++A+ +TY HGKLY
Sbjct: 364 ISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKLY 423

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635
           YHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQYMQLVIDNIYQRAF ER+ G+ RN  ++
Sbjct: 424 YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFPIV 483

Query: 636 EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYX 695
           EYLKH+EVMLLP+FLES +LQ VVL +FQ +FG+  +                       
Sbjct: 484 EYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNN---------------------- 521

Query: 696 XXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755
                                +D F ++ +FIQ+ + L+YFF H+  FA+SHILQLVGFG
Sbjct: 522 ---------------------VDFFDHKQIFIQDGEKLRYFFSHAPAFAESHILQLVGFG 560

Query: 756 DPKNPFALLFELPKFL 771
           DP+NPFA+LFELPKFL
Sbjct: 561 DPRNPFAILFELPKFL 576

 Score =  396 bits (1018), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 240/596 (40%), Positives = 339/596 (56%), Gaps = 69/596 (11%)

Query: 858  NNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILI 917
            N  S+I  + +FENID  + PY  PQ I+IW +SL  +NL S++CS+ VLKKFL+ P+L 
Sbjct: 602  NGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLHAPLLT 661

Query: 918  ALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNI 977
            ALPHLL W HF++S+ ++I +S++ +  K FW  F++ I PWNS+V+FLN LM +LLDN 
Sbjct: 662  ALPHLLPWAHFLVSVAIRI-SSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNS 720

Query: 978  NDENFKLIIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDX 1037
             +     +                     F  +E LPE+WKCWGTLWFD I NK   S+ 
Sbjct: 721  RN-----MSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNK---SEL 772

Query: 1038 XXXXXXXXXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGI 1097
                                          ++++ GI DH  LD P+DGI F  +DE G+
Sbjct: 773  KA---------------------------SSVQSTGIRDHLFLDAPIDGICFDQDDESGL 805

Query: 1098 NFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPS 1157
             F+KR+ R+IF+ K M + F + G+++S    +  R+        L  F+FK   L    
Sbjct: 806  KFWKRACRVIFMFKGMAKEF-HYGIRVSDTPISTRRDVTTLH--ALKRFSFKFEEL---- 858

Query: 1158 LIIIPQTXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGG 1217
                PQ                     +      F ++ EPI  IN N +  P LS++ G
Sbjct: 859  ----PQ----------------EWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDG 898

Query: 1218 NENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDST 1277
             E+IF + GY+R+  +   F++NG++I+GS+Y+S  ++     +         H+ N   
Sbjct: 899  -ESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAI-QGGDDFNVKRHVENGVL 956

Query: 1278 MKNEN--VTVGDITPED-ASFKEFMKLSFHLKLSTRSNNSQTQNTH-KMGVSINKHRTFF 1333
            +   N  V   + TPE    + E   L+  +  +   +   ++  H  +  + + + T+F
Sbjct: 957  LAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYF 1016

Query: 1334 VFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQL 1393
            V DATSWLRHFAH+YKL+ N  LKFA+CLTTFQELRFLRKSKD +VVEA+TRA+IT RQL
Sbjct: 1017 VLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQL 1076

Query: 1394 YKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQ 1449
            Y E KLLPLRFTGN+AT +EEHLEFEEQITWRSHVDEFVIEA+ +SQ +FK  ++Q
Sbjct: 1077 YYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQ 1132

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
           YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  498 bits (1282), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 242/376 (64%), Positives = 281/376 (74%), Gaps = 43/376 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           QAL+QKLQDIY+ IVKQE++LQ+RC+QLTTSQTTDLKNLW IYKIN++LINNY+ FIT A
Sbjct: 242 QALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTA 301

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LLP+Q + DL IG            LWV+GTITFLDVLK+FSNFMDPEVCCQFI+HVFI+
Sbjct: 302 LLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 361

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           IS +L D+P K+S  W +RLGDLSRMAIALYPSGFIDWKLSAEHWY++A+   + HGKLY
Sbjct: 362 ISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLY 421

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635
           YHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GNHRN  ++
Sbjct: 422 YHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMV 481

Query: 636 EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYX 695
           EYLKH+EVMLL +FLES +LQ VVL +FQ KFG+  S                       
Sbjct: 482 EYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSN---------------------- 519

Query: 696 XXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755
                                 D F  +DMF+Q+ + +KYFFRH+  FA+SHILQ VGFG
Sbjct: 520 ---------------------TDFFNPRDMFLQDGERVKYFFRHAPAFAESHILQTVGFG 558

Query: 756 DPKNPFALLFELPKFL 771
           DPKNPFALLFELPKFL
Sbjct: 559 DPKNPFALLFELPKFL 574

 Score =  355 bits (912), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 223/595 (37%), Positives = 333/595 (55%), Gaps = 83/595 (13%)

Query: 861  SNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALP 920
            S++   E+ EN+D  ++ Y+ P+ + IW ESL +IN+ S +CS IV +KFL GP+++A+ 
Sbjct: 599  SHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVT 658

Query: 921  HLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDE 980
            H+L W +F++S+ LKI+ S+   + K FW + ++ I PWNSIV+FLN+LM ++LDN    
Sbjct: 659  HMLPWSYFLLSLALKID-SLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDN---- 713

Query: 981  NFKLIIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXX 1040
            N+K                       F+++E+LPEIW+CWG LWFDVI +K+   D    
Sbjct: 714  NWK-TSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDG--- 769

Query: 1041 XXXXXXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFY 1100
                            D++N            G +DH   D P DGI F  +DE G  F+
Sbjct: 770  ----------------DVINS-----------GSKDHPFWDLPGDGICFDEDDEVGEKFW 802

Query: 1101 KRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLII 1160
            KR+ RLIF+ K + + F +LGL +S       R   +     L NF+F    +   S I 
Sbjct: 803  KRACRLIFIFKGIAQEF-SLGLTLSAFAPQSRR--PMTAGHPLQNFSFNFEEIPAQSQI- 858

Query: 1161 IPQTXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNEN 1220
                                  +S + N +  F   E I   NL+  ++P  S+L G E+
Sbjct: 859  ----------------------QSFVRNQIPLF---EEIATGNLDPNIRPGQSMLEG-ES 892

Query: 1221 IFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKN 1280
            IF++ GY+++  +   F+++G +IS S+Y+S  ++    +              DS  K 
Sbjct: 893  IFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSN-KP 951

Query: 1281 ENVTVGDITPEDASF------KEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFV 1334
            EN  + ++   +  +       EF++ ++ +K               +  + +   ++FV
Sbjct: 952  ENAQITELERLERDWLDNCMNPEFIEQAYEMKFPF----------GDLSCNCDSGVSYFV 1001

Query: 1335 FDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLY 1394
             DATSWLRHFAH++KL+ N  L+F +CLTTFQELRFLRKSKD +VVEA+TRA+IT+RQLY
Sbjct: 1002 LDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLY 1061

Query: 1395 KEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQ 1449
             + KLLPLRFTGNVAT +EEHLEFEEQITWRSHVDEFVIEA+ ++Q++F+  + Q
Sbjct: 1062 SDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQ 1116

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1241

 Score =  499 bits (1284), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 250/377 (66%), Positives = 284/377 (75%), Gaps = 44/377 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           + LI+KLQ+IYK+IVKQE++LQ RCSQLTTSQTT+LKNLW+IYK+N DLINNYI FIT A
Sbjct: 282 RVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFITTA 341

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LLP+QS  D+ IG            LWVYGTITFLDVLK+FSNFMDPEVC QFI+HVFI+
Sbjct: 342 LLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFIS 401

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           +S +L D+P K+SI WLQRLGDLSRMAIALYPSGFIDWKLSAEHWY EAMKFTYSHGKLY
Sbjct: 402 LSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 461

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERN-NGNHRNLQL 634
           YHMSTVQQNTLEAFVNLGKSVFCQ+TFTPSQQYMQLVIDNIYQR FV+RN NGN RN  L
Sbjct: 462 YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRNSDL 521

Query: 635 IEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPY 694
           I+YLKH+EVMLLP+FLE+ DLQ VVL YF  +FG+                         
Sbjct: 522 IDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGV------------------------- 556

Query: 695 XXXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGF 754
                                  +IF  QDMF Q P  L+++FRH+  FA+SHILQLVGF
Sbjct: 557 ------------------DYNDNNIFETQDMFFQVPASLRFYFRHAPAFAESHILQLVGF 598

Query: 755 GDPKNPFALLFELPKFL 771
           G+PKNPFALLF+LP FL
Sbjct: 599 GNPKNPFALLFDLPNFL 615

 Score =  464 bits (1194), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 267/597 (44%), Positives = 348/597 (58%), Gaps = 80/597 (13%)

Query: 859  NYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIA 918
            N  NI+ E +F+NID L+ P   P  I +WL+SL+++N+ SLKCS+IVL+KFL GP+LIA
Sbjct: 655  NEGNIVTE-YFDNIDSLRLPIDHPN-ILVWLKSLEHLNMTSLKCSVIVLRKFLRGPLLIA 712

Query: 919  LPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNIN 978
            LPH+L W +FII+  LK ++S   +  K FW   ++ I+PWN++ +FLNVL+ Y+LDN  
Sbjct: 713  LPHVLPWTYFIIATFLKAQSSKNTSSVK-FWTIVMRRILPWNTLTSFLNVLLAYILDNF- 770

Query: 979  DENFKLIIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKN-INSDX 1037
               ++                      +FN+NENLPEIWKCWGTLWFDVI NK  +N+D 
Sbjct: 771  ---YQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDVISNKRALNAD- 826

Query: 1038 XXXXXXXXXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGI 1097
                                          T   +GIEDH  LD PLDGIGF   DE G 
Sbjct: 827  ------------------------------TFNGLGIEDHMFLDFPLDGIGFDELDETGE 856

Query: 1098 NFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPS 1157
            NF+ R++R++FL K + E     GL++S     +CR   I  N IL +F+FK+    + S
Sbjct: 857  NFWNRALRIVFLFKGIAENL-QTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESS 915

Query: 1158 LIIIPQTXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGG 1217
                P                        S I +   + E I+E NL+   +P LS++ G
Sbjct: 916  YSGQP-----------------------FSTINKLLPLFENIDETNLDFDARPMLSVVKG 952

Query: 1218 NENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPID---------YNKFKEXXXXXXX 1268
             ENIF Y+GYK+L  N  SF  NGE++S SIY++W ID          N++         
Sbjct: 953  -ENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDNDNSLNNSQGNQYTSNMQMTQQ 1011

Query: 1269 XEHLV--NDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSI 1326
               L+       +  N    + T +D +F+ +M      KL+   + +    T      I
Sbjct: 1012 QRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNPE---KLNKNMDQASIWTT--ANDEI 1066

Query: 1327 NKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRA 1386
            N++ T+FVFDATSWLRHFAHIYKLS N  L FAVCLTTFQELRFLRKSKD NVV A+ RA
Sbjct: 1067 NRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFLRKSKDENVVGAAARA 1126

Query: 1387 IITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF 1443
            IITMRQLY EGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEA++++Q +F
Sbjct: 1127 IITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVVKAQNKF 1183

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W Hypothetical ORF
          Length = 1148

 Score =  490 bits (1261), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 239/376 (63%), Positives = 279/376 (74%), Gaps = 43/376 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           QAL+QKLQDIY+ IVKQE++LQ+RCSQLT SQTTDLKNLW IYK+N +LINNY+ FIT A
Sbjct: 212 QALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTA 271

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LLP+Q + DL IG            LWV+GTITFLDVLK+FSNFMDPEVCCQFI+HVFI+
Sbjct: 272 LLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 331

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           IS +L D+P K++  WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + HGKLY
Sbjct: 332 ISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLY 391

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635
           YHMSTVQQNTLEAFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN GN RN  ++
Sbjct: 392 YHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLMV 451

Query: 636 EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYX 695
           EYLKH+EVMLL +FLES +LQ VVL +FQ KFGI  +                       
Sbjct: 452 EYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNN---------------------- 489

Query: 696 XXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755
                                 D F +Q +F+Q+ +  KYFFRH+  FA+SHILQ+VGFG
Sbjct: 490 ---------------------TDYFSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFG 528

Query: 756 DPKNPFALLFELPKFL 771
           +PKNPFALLFELPKFL
Sbjct: 529 NPKNPFALLFELPKFL 544

 Score =  344 bits (883), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 220/590 (37%), Positives = 323/590 (54%), Gaps = 85/590 (14%)

Query: 867  EFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWI 926
            E+ E++D  +F Y+ P  + IW +SL +IN  S+KCS +VL+KFL+GP++ A  HLL W 
Sbjct: 575  EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWA 634

Query: 927  HFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII 986
            +F++S+ ++I+  +   + K FW +  + + PWNSIVNFLN+++ + LDN    +     
Sbjct: 635  YFLLSLAIRIDE-LPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTS----- 688

Query: 987  XXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXXXX 1046
                                F+QNE+LPE+WKCWG LWFDVI +K+              
Sbjct: 689  SIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKS-------------- 734

Query: 1047 XXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRL 1106
                          D  D   T  +  ++DH   D P+DGI F  +DE G  F+KR+ RL
Sbjct: 735  --------------DVVDEGATYNS--VQDHMFGDMPVDGICFDEDDETGSRFWKRACRL 778

Query: 1107 IFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTXX 1166
            +F+ K + + F N+GL ++       R+  +     L NF FK     DP +        
Sbjct: 779  VFIFKGIAQEF-NMGLTLASVPLQSRRS--LAAGHPLQNFCFKFE---DPPV-------- 824

Query: 1167 XXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLG 1226
                             +++S  M  F   E I E NL+    P  S+L G +++F   G
Sbjct: 825  ------------DSESYALISTQMPAF---ENISERNLDPNAPPGQSMLEG-KSLFELPG 868

Query: 1227 YKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKNENVTVG 1286
            Y++L+ +   F++ G +I+ S+Y+S  ++               H  +D   +  + +  
Sbjct: 869  YRQLHADHTCFNKTGTLITCSLYTSGSLEKGPI-----------HGGDDFNTERYSRSDE 917

Query: 1287 DITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKM-------GVSINKHRTFFVFDATS 1339
                ++   KE  K+   + L T  N    + T+ M         + +   ++FV DATS
Sbjct: 918  LNKADNPQIKELDKME-RMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATS 976

Query: 1340 WLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKL 1399
            WLRHFAH+YKL+ NG L+FA+CLTTFQELRFLRKSKD +VVEA+TRA+IT+RQLY E +L
Sbjct: 977  WLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRL 1036

Query: 1400 LPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQ 1449
            LPLRFTGNVAT +EEHLEFEEQITWRSHVDEFVIEA+ ++Q +F+  + Q
Sbjct: 1037 LPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQ 1086

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  491 bits (1265), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 240/376 (63%), Positives = 284/376 (75%), Gaps = 44/376 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           QAL++KLQ+IY+ IV+QE +LQ RCSQLTTSQTTDLKNLW IYK+N +LI+NY  FIT A
Sbjct: 283 QALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMFITTA 342

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LLPTQ + DL IG            LWVYGTITFLDVLK+FSNFMDPEVCCQFI +VFI+
Sbjct: 343 LLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIYVFIS 402

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           IS +L DIP K+SI WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY+EA+K+T+ HGKLY
Sbjct: 403 ISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGHGKLY 462

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635
           YHMSTVQQNTL AFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN+G+HRN  L+
Sbjct: 463 YHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRNAHLV 522

Query: 636 EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYX 695
           EYLKHTEVMLLP+FLES +LQ+VVL +F+ KFG+  +                       
Sbjct: 523 EYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN----------------------- 559

Query: 696 XXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755
                                +D F  + +F+Q+ + LK+FFRH+  +A+SH+LQLVGFG
Sbjct: 560 ---------------------VDFFDPRLVFVQDSERLKHFFRHASLYAESHLLQLVGFG 598

Query: 756 DPKNPFALLFELPKFL 771
           DP+NPFALLFELPK L
Sbjct: 599 DPRNPFALLFELPKHL 614

 Score =  318 bits (815), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 215/594 (36%), Positives = 313/594 (52%), Gaps = 90/594 (15%)

Query: 857  DNNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPIL 916
            D++ +     EFFE ID  ++ YK P  I IW ESL   N+ ++KCS+IVL+KFL+GP+L
Sbjct: 639  DDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKFLHGPLL 698

Query: 917  IALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDN 976
             ALPHLL W +F+ +   ++  +I  ++ + FW + ++ + P+N+I+ FLNVL++Y+ + 
Sbjct: 699  TALPHLLPWGYFLAATNSRV-ITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLYMNNQ 757

Query: 977  IN-----DENFKLIIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNK 1031
                   DE F+  I                   +F +NE LPE+W+CWGTLWFD +  K
Sbjct: 758  TQANFPFDEYFEQFIDMSLADLVG----------YFCENEELPEVWECWGTLWFDALNTK 807

Query: 1032 NINSDXXXXXXXXXXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVA 1091
            +I +                       L D       + + G++DH  +D P+DGI F  
Sbjct: 808  HITN-----------------------LTD-------INSTGVKDHMFMDSPIDGISFDH 837

Query: 1092 NDEDGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLT 1151
            NDE G  F+KR  R+I L +++    P +GL+      N+             +  FK  
Sbjct: 838  NDESGEKFWKRCARVILLFRALALECP-VGLREISGGRNW------------RSLVFKFE 884

Query: 1152 NLYDPSLIIIPQTXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPP 1211
                PS                            L      F   E I  +NL+ Q   P
Sbjct: 885  E--PPS----------------------EWCDMYLEPFTLVFDTFEQISPVNLD-QRATP 919

Query: 1212 LSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKF--KEXXXXXXXX 1269
               +  + +I    GY+ L  +   F+ NG++I+GS+Y+   ++ +     +        
Sbjct: 920  YCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRLL 979

Query: 1270 EHLVNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKH 1329
            E+    ST + +  ++ D   E     EF++ + H K   R    Q      +    + H
Sbjct: 980  ENGELVSTERRDYNSLID-REEQPIMDEFLRHT-HCKNDVRWE--QMLPRGDLHCFADTH 1035

Query: 1330 RTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIIT 1389
             T+FV DAT+WLRHF H+YKL+ N  LKFA+CLTTFQELRFLRKSKD +V+EA+TRA+IT
Sbjct: 1036 VTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVIT 1095

Query: 1390 MRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF 1443
            +RQLY E KLLPLRFTGNVA  +EEHLE EEQ+TWRSHVDEFVIEAI ++Q++F
Sbjct: 1096 VRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKF 1149

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
           (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  485 bits (1248), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 238/378 (62%), Positives = 283/378 (74%), Gaps = 43/378 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           QAL+QKLQDIYK+I+KQE++LQ+RCSQLT SQTT++KNLW IYK+N DLINNY+ FIT A
Sbjct: 316 QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           L P+QSK+DL IG            LWVYGTITFLDVLK+FSNFMDPEVCCQFI+HVFI+
Sbjct: 376 LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           IS +L+DIP KY+I WLQ+LGDLSRMA+AL+PSGFIDWKLSAE WY  AM+++Y +GKLY
Sbjct: 436 ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERN-NGNHRNLQ- 633
           YHMSTVQQNTLEAFVNLGKSVFCQ TF PSQQY+QLVIDNIYQRAF +RN + N RN Q 
Sbjct: 496 YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555

Query: 634 LIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIP 693
           L++YLKH+EVMLLP F+ES DLQ VVL+YF  KFGI                        
Sbjct: 556 LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGI------------------------ 591

Query: 694 YXXXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVG 753
                                  + +F+ + MFIQN D LK++FRH+  FA++ ILQLVG
Sbjct: 592 -----------------DYNNNNVKMFQPRQMFIQNNDQLKFYFRHANAFAEAQILQLVG 634

Query: 754 FGDPKNPFALLFELPKFL 771
           +G+PKNPFALLF LPK+L
Sbjct: 635 YGNPKNPFALLFSLPKYL 652

 Score =  399 bits (1026), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 242/589 (41%), Positives = 325/589 (55%), Gaps = 81/589 (13%)

Query: 865  CEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLT 924
             E+FF NID L     +P +I +W +SLK  N  + KCS+IVL+KFLNGP+++ALPH+L 
Sbjct: 698  SEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILP 757

Query: 925  WIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKL 984
            W++F+ISI L+IE    D     FWY+F+K I PWNS+V FLNVL+ Y++DN  D +   
Sbjct: 758  WVYFLISIALQIE-KYQDTAMMEFWYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNS--- 813

Query: 985  IIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXX 1044
                                  FN NE+LPE+WKC G+LWFD+I  K             
Sbjct: 814  --PLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDIIDEKR------------ 859

Query: 1045 XXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSI 1104
                             N     +    GI+D+  LD P+DGI F  NDE GI F+KRS+
Sbjct: 860  -----------------NSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSV 902

Query: 1105 RLIFLCKSMIETFPNLG-LKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQ 1163
            R+IFL + ++E F   G L IS+      R   +  N  L  ++FKL    D  +     
Sbjct: 903  RVIFLFRGIVERFNGFGNLAISYNAPVINRRG-LGVNSHLVGYSFKLMAKSDDIMF---- 957

Query: 1164 TXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFN 1223
                                 ++SN        E I+  N +    P LS++ G ENIF 
Sbjct: 958  ------------------DDMLVSNF-------EEIDSNNSDFNAIPLLSMIYG-ENIFE 991

Query: 1224 YLGYKRLNFNIQSFHENGEIISGSIYSSWPI--DYNKFKEXXXXXXXXEHLVNDSTMKNE 1281
            Y+GYKR++ +  SF +NG++IS S Y++W I  D               +  +   M  +
Sbjct: 992  YVGYKRIHADYYSFDKNGDLISTSFYNTWSINQDTGVNGGPLSNNSSSSNAASSDPMNEK 1051

Query: 1282 NVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWL 1341
             +      PE  S  EF     +  +             K G+ + +  T+F+ DATSWL
Sbjct: 1052 ELFNKCFDPEYDSVDEFWNKEIYDDIG-----------RKFGMELYED-TYFILDATSWL 1099

Query: 1342 RHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLP 1401
            RHFAH+YK++ N  LKF++CLTTFQELRFLRKSKD NVVEA+TRAIIT+RQL+ EGKLLP
Sbjct: 1100 RHFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLP 1159

Query: 1402 LRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQN 1450
            LRFTGNVAT IEEHLEFEEQITWRSHVDEFVIEA+I+++ + K + + N
Sbjct: 1160 LRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETKRKEQEMHN 1208

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar
           to uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  479 bits (1233), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 230/373 (61%), Positives = 282/373 (75%), Gaps = 43/373 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           QAL+QKLQDIYK IV+QE++LQ++C+QLT+SQTTDL ++W+IY+IN++L+ NY+ FI+ A
Sbjct: 368 QALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTA 427

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LL +QS+ DL IG            LWVYGTITFLDVLK+FS+FMDPEVC QFI+HVFI+
Sbjct: 428 LLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFIS 487

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           IS +L DIP KYSI W+QRLGDLSRMAIALYPSGFIDWKLS+E+WYN+A+K+TY +GKLY
Sbjct: 488 ISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYGYGKLY 547

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635
           YHMST+QQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAF+ER + N RN QLI
Sbjct: 548 YHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQLI 607

Query: 636 EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYX 695
           EYLKH+EVMLLP F+ + +LQ VV+ YF+ KFG                           
Sbjct: 608 EYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGT-------------------------- 641

Query: 696 XXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755
                                ++IF+ +D+F+QNP++LKYFFRH+  FA+SHILQ VGFG
Sbjct: 642 -----------------DLHDLNIFQPRDIFLQNPENLKYFFRHAPAFAESHILQTVGFG 684

Query: 756 DPKNPFALLFELP 768
           D KNPFALLF+LP
Sbjct: 685 DSKNPFALLFDLP 697

 Score =  414 bits (1063), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 241/589 (40%), Positives = 343/589 (58%), Gaps = 81/589 (13%)

Query: 863  ILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHL 922
            I  +++F N++ +Q PY  P   +IWL+SL  +NL +++C +IVL+KFL+GP ++ALPHL
Sbjct: 736  ISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHL 795

Query: 923  LTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENF 982
            + W +FIIS+ LK E ++ D +S+ FW SF++ ++P NSIV+FLNVL+ Y LDN     +
Sbjct: 796  MVWTYFIISVCLKSE-TLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYALDN---SYY 851

Query: 983  KLIIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXX 1042
              +I                    FN NE LPE+WKCWGTLWFD I +K+          
Sbjct: 852  STLISSISEELDSMDLQELLTK--FNNNEELPEVWKCWGTLWFDAITDKS---------- 899

Query: 1043 XXXXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKR 1102
                               N DT+ +   +G+ DH   D P+DGI F + DE+G  F+KR
Sbjct: 900  -------------------NTDTN-SYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKR 939

Query: 1103 SIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLT-NLYDPSLIII 1161
            ++R+IFL K + ETF ++G+ +SH    YCR   +  N IL +F+FK+  +L + + + +
Sbjct: 940  ALRIIFLFKKIAETF-DIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQV 998

Query: 1162 PQTXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENI 1221
                                 ++ L  I+E   + E   E+N+ +   PP+S L  NENI
Sbjct: 999  E-------------------IENCLGAIIE---MTEMPNEVNITMDATPPMS-LQENENI 1035

Query: 1222 FNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKNE 1281
            F Y GYKR+   +Q+F +NGE+ S + Y+SW                 + +V  S    E
Sbjct: 1036 FEYTGYKRIAPELQNFDKNGELRSAANYTSW--------------YSAQEIVPKSAASPE 1081

Query: 1282 NVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWL 1341
            N   G      +  + F        + +   N + +N+  +   +N   T FV DATSWL
Sbjct: 1082 NSVAGS-----SPGRSFQSQDVEENIFSVFTNEE-ENSTSLLDGLNLETTSFVLDATSWL 1135

Query: 1342 RHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLP 1401
            RH AHIYKL+ N FL F++CLTTFQELRFLRKSKD NV+EA+ RAII +RQLY +GK++P
Sbjct: 1136 RHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQLYSDGKVIP 1195

Query: 1402 LRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQN 1450
            LRFTGN+AT IEEHLEFEEQITWRSHVDEFVIE+I ++Q++F    +QN
Sbjct: 1196 LRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQN 1244

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
           similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  475 bits (1222), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 234/374 (62%), Positives = 274/374 (73%), Gaps = 44/374 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           Q L++KLQ+IYK IVKQE +LQ+RCSQLTTSQTTDLKNLW IYK+N +LI+NY  FIT A
Sbjct: 321 QTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFITTA 380

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LLPTQ K DL IG            LW+YGTITFLDVLK+FSNFMDPEVCCQFI +VFI+
Sbjct: 381 LLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVFIS 440

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           IS IL +IP  +S+ WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+K+ + HGKLY
Sbjct: 441 ISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGKLY 500

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635
           YHMSTVQQNTL AFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN+G+HR   ++
Sbjct: 501 YHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSHIV 560

Query: 636 EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYX 695
           EYLKHTEVMLLP+FLE+++ Q VVL +F  KFG   S                       
Sbjct: 561 EYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA---------------------- 598

Query: 696 XXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755
                                 + F    +F+Q+ + LK+FFRH+  +A+SHILQLVGFG
Sbjct: 599 ----------------------NFFDPSLIFVQDCERLKHFFRHASLYAESHILQLVGFG 636

Query: 756 DPKNPFALLFELPK 769
           DP+NPFALLFELPK
Sbjct: 637 DPRNPFALLFELPK 650

 Score =  187 bits (475), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 157/255 (61%), Gaps = 16/255 (6%)

Query: 1197 EPIEEINLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSW---- 1252
            E I  +N +LQ  P   ++ G + I    GYK+L  +   F++NG++I+GS+Y+S     
Sbjct: 943  ESISFVNTDLQSPPHKGMVLGTD-IRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEG 1001

Query: 1253 ----PIDYNKFKEXXXXXXXXEHLVNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLS 1308
                P D   F          E LV        N+   + TP      EF+K  +    S
Sbjct: 1002 GSGVPNDSEDFGSTKRLLEN-ELLVTSERRDYNNLLDKEETP---IIDEFLKWRYS---S 1054

Query: 1309 TRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQEL 1368
            T S   Q      +    + H T+FV DAT+WLRHF H+YKL+ +  LKFA+CLTTFQEL
Sbjct: 1055 TNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQEL 1114

Query: 1369 RFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHV 1428
            RFLRKSKD +V+EA+TRA+IT+RQLY E KLLPLRFTGNVA  +EEHLE EEQ+TWRSHV
Sbjct: 1115 RFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHV 1174

Query: 1429 DEFVIEAIIRSQERF 1443
            DEFVIEAI ++Q +F
Sbjct: 1175 DEFVIEAIDKAQSKF 1189

 Score =  174 bits (440), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 93/252 (36%), Positives = 140/252 (55%), Gaps = 36/252 (14%)

Query: 867  EFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWI 926
            +FFE ++  +  Y+  Q + IW ESL  +N  S++CS++VL+KFLN  +L ALPHLL W 
Sbjct: 686  QFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWA 745

Query: 927  HFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII 986
            +F++++ L+++ +I +  SK FW  F++ I PW SI NFLNVL++Y    IND+      
Sbjct: 746  YFLVAVGLRLD-AIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLY----INDQK-PTKF 799

Query: 987  XXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXXXX 1046
                               +F +NE+LPE+W CWGTLWFDVI +K++++           
Sbjct: 800  PIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSN----------- 848

Query: 1047 XXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRL 1106
                        L D + T       G++DH  LD P+DGI F  +DE G  F+KR +R+
Sbjct: 849  ------------LVDIHST-------GVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRV 889

Query: 1107 IFLCKSMIETFP 1118
            I L + +   FP
Sbjct: 890  ILLFRGIAYQFP 901

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W
          Length = 1229

 Score =  471 bits (1211), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 234/374 (62%), Positives = 274/374 (73%), Gaps = 44/374 (11%)

Query: 398 LIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNALL 457
           L++KLQ+IYK IVKQE +LQ+RCS LTT QTTDLKNLW  YKIN +LI+NYI FIT ALL
Sbjct: 284 LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 458 PTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIAIS 517
           P+QS++ L IG            LWVYGTITFLDVLK+FSNFMDPEVCCQFI++VFIA+S
Sbjct: 344 PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 518 LILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLYYH 577
            +L D+P KYSI WL+RLGDLSRMAIALYPSGF+DWKLSAEHWY E++KFT+ HGKLYYH
Sbjct: 404 NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 578 MSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLIEY 637
           MSTVQQNTLEAFVNLGKSVFC++ F PS QYMQLVIDNIYQRAF ER++  +R   +++Y
Sbjct: 464 MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 638 LKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYXXX 697
           LKHTEVMLLP+FLES +LQNVV+ YFQ KFG+  S                         
Sbjct: 524 LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG------------------------ 559

Query: 698 XXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFGDP 757
                               + F    +FIQ+ + LK+FFRHS  F+QSHILQL GFGDP
Sbjct: 560 --------------------NFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDP 599

Query: 758 KNPFALLFELPKFL 771
           KNPFA+LFEL K L
Sbjct: 600 KNPFAMLFELSKHL 613

 Score =  288 bits (736), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 196/584 (33%), Positives = 294/584 (50%), Gaps = 80/584 (13%)

Query: 866  EEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925
            E+FF  ID  + PY+ P  + +W  SL  IN+ S+KC +IVL++FL GPI+ ALPH+L W
Sbjct: 648  EDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPW 707

Query: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985
            + FIISI ++++  + D   K FW  F++ I PW+S++ F+N L+ Y +     +NF + 
Sbjct: 708  LLFIISIQIRLDQ-VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCM-VTGTKNFDID 765

Query: 986  IXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXXX 1045
                                   +NENLPE W CWG+LWF+ I  K+             
Sbjct: 766  AHMSTYLPMNREELLTSIC----ENENLPECWSCWGSLWFNTISKKS------------- 808

Query: 1046 XXXXXXXXXGEDILNDNYDTD-KTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSI 1104
                              D D  TL + G+ D   LD P +GI F  +DE G  +++R  
Sbjct: 809  ------------------DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRIC 850

Query: 1105 RLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLII--IP 1162
            R + L   + E     G        + C+    P+     N  F+  +  +  L +   P
Sbjct: 851  RTLLLFNIITEWEACDGY------GHGCKKLN-PEATSWKNLVFRFNDDTNDQLSVELYP 903

Query: 1163 QTXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIF 1222
            +                             F+  E I  +N +  LQ     +    +I 
Sbjct: 904  EENESFP-----------------------FEKFEIISNLNCSDNLQDGSKSMIPGVSIE 940

Query: 1223 NYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKNEN 1282
            N  G+K +  +   F++NG++I+ S+Y+  P++    +         +    +  + N  
Sbjct: 941  NLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQ-------GGDDFNANKILDNGR 993

Query: 1283 VTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMG---VSINKHRTFFVFDATS 1339
            + V D     ++  +  +      ++      +  N   +G      + + TFFV DAT+
Sbjct: 994  LVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATT 1053

Query: 1340 WLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKL 1399
            WLRHFAHIYKL+ +  LKFA+CLTTFQELRFLRKSKD +V+EA+TRA+I +RQLY E KL
Sbjct: 1054 WLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKL 1113

Query: 1400 LPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF 1443
            L LRFTGNVA  +EEHLE EEQ+TW+SHVDEFVI+AI ++Q++F
Sbjct: 1114 LALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKF 1157

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
           YIL151C (REAL)
          Length = 1117

 Score =  458 bits (1178), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 229/383 (59%), Positives = 275/383 (71%), Gaps = 50/383 (13%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           Q  I+KLQ+IYK+IV QE +LQ RC  LTTSQTT+LK+LW IYK+N +LI NYINFI  A
Sbjct: 204 QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITA 263

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LL TQ  NDL +G            LWVYG ITFLDVLKSFSNFMDPEVCCQFI++ FI 
Sbjct: 264 LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFIC 323

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           IS +L DIP+KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 324 ISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 383

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGN------- 628
           YH++T+QQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R++GN       
Sbjct: 384 YHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETA 443

Query: 629 HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXX 688
           HRN QLI+YLKHTEVMLLP+FLE+LDLQ+VVL+YF+ KFG                    
Sbjct: 444 HRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFG-------------------- 483

Query: 689 XXXIPYXXXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHI 748
                                        D+F  +DMF QNP+ L+Y+FRH+  FA+S I
Sbjct: 484 -----------------------KDFNGNDVFSTKDMFCQNPESLRYYFRHAPAFAESQI 520

Query: 749 LQLVGFGDPKNPFALLFELPKFL 771
           LQL+GFG+PKNPFALLF+LPK L
Sbjct: 521 LQLIGFGNPKNPFALLFQLPKHL 543

 Score =  402 bits (1033), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 234/592 (39%), Positives = 326/592 (55%), Gaps = 98/592 (16%)

Query: 856  FDNNYSNILCEEFFENIDLLQFPYKIPQT-IEIWLESLKNINLISLKCSIIVLKKFLNGP 914
            FD+  S+   E +F+NID L   +  P T I IWL+SL  IN+ S++CSI VL KFL+ P
Sbjct: 567  FDDQGSS---ESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSIQVLTKFLHAP 623

Query: 915  ILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLL 974
            + +ALPH L W+HFII++L K+E +I   Q   FW  FL+  +PWNS+V F NVL+ Y+L
Sbjct: 624  LAVALPHFLIWLHFIIAVLKKLE-TINSEQVTAFWIHFLRRTMPWNSMVTFSNVLVCYML 682

Query: 975  DNINDENFKLIIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNIN 1034
            DN++                           +FN+NENLPE+WKCWG+LWFD +   ++ 
Sbjct: 683  DNLHP-------FLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAVKKCDV- 734

Query: 1035 SDXXXXXXXXXXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDE 1094
                                              +   G++DH   D PLDGI F   DE
Sbjct: 735  ----------------------------------MEIPGVQDHLFFDSPLDGIVFDKKDE 760

Query: 1095 DGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLY 1154
             G  F+ RS+R I   K + + FP+LGLK++ + S +CR   I  ++ L N  FKL    
Sbjct: 761  IGEKFWIRSVRTILTLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKL---- 816

Query: 1155 DPSLIIIPQTXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSI 1214
            DP                           + L  + +  +I+E IE +N++LQ  P LS+
Sbjct: 817  DP------------------YEEDAFNDNNELDELYDTIEINELIETVNIDLQATPKLSV 858

Query: 1215 LGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVN 1274
            + G E+IF Y GY RL  +   F +NG   S  IY+ W                  ++ N
Sbjct: 859  VSG-ESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW-----------------SNVGN 900

Query: 1275 DSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFV 1334
              T+   + ++ D T  D S   + K+ F  K+ T   N+    +  +         +FV
Sbjct: 901  GVTLDVSSESLYDSTTNDLSL-HWAKILFD-KVFTIGKNTDDDGSCSV---------YFV 949

Query: 1335 FDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLY 1394
             DATSWLRHFAHI+KL+KN  LKFA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY
Sbjct: 950  IDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLY 1009

Query: 1395 KEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTK 1446
             E K++P+RFTGN+AT IEE+LEFEEQITW++HVDEFVI+AI +  + F+T+
Sbjct: 1010 DEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTE 1061

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
           Putative protein of unknown function, predicted to
           contain a PINc domain
          Length = 1118

 Score =  451 bits (1160), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 223/382 (58%), Positives = 275/382 (71%), Gaps = 50/382 (13%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           Q  I+KLQ+IYK+IV QE +LQ RC  LTTSQTT+LK+LW IY++N +LI NYINFI  A
Sbjct: 205 QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LL TQ  NDL +G            LWVYG ITFLDVLK+FSNFMDPEVCCQFI + FI+
Sbjct: 265 LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           +S +L DIP+KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 325 VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGN------- 628
           YH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R++G+       
Sbjct: 385 YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIA 444

Query: 629 HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXX 688
           HRN QLI+YLKHTEVMLLP+FLE++DLQ+VVL+YF+ KFG                    
Sbjct: 445 HRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFG-------------------- 484

Query: 689 XXXIPYXXXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHI 748
                                        D+F  +DMF QNP+ L+Y+FRH+  FA+S +
Sbjct: 485 -----------------------KDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQL 521

Query: 749 LQLVGFGDPKNPFALLFELPKF 770
           LQL+GFG+PKNPFALLF+LPK+
Sbjct: 522 LQLIGFGNPKNPFALLFQLPKY 543

 Score =  409 bits (1051), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 232/591 (39%), Positives = 326/591 (55%), Gaps = 95/591 (16%)

Query: 863  ILCEEFFENIDLLQFPY-KIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPH 921
            I  E +F+NID L   +  IP  + IWL+SL +IN+ S++CSI VL KFL+ P+++ALPH
Sbjct: 572  ISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPH 631

Query: 922  LLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDEN 981
             LTW+HFI++IL K+E  +   Q   FW  FL+  +PWNSIV   NVL+ Y+LDN++   
Sbjct: 632  FLTWLHFIVAILKKLE-MVNSKQVVAFWIHFLRRTMPWNSIVTLGNVLVCYMLDNLHP-- 688

Query: 982  FKLIIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXX 1041
                                    ++N+NENLPEIWKCWGTLWFD I   ++        
Sbjct: 689  -----FLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIKKCDV-------- 735

Query: 1042 XXXXXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYK 1101
                                       +   G++DH   D PLDGI F   DE G  F+ 
Sbjct: 736  ---------------------------MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWM 768

Query: 1102 RSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIII 1161
            RS+R + L K + + FP+LGLK+S + S +CR   IP ++ L N  FKL + YD      
Sbjct: 769  RSVRAVLLLKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKL-DAYDED---- 823

Query: 1162 PQTXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENI 1221
                                  + L ++ +  +I+E IE +N++ Q  P LS++ G E+I
Sbjct: 824  -----------------NYNDNNELDDLYDTIEINEEIEAVNMDPQATPNLSVVSG-ESI 865

Query: 1222 FNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKNE 1281
            F Y GY RL  +   F +NG   S  IYS W                  ++ N  T+   
Sbjct: 866  FEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW-----------------SNVGNGVTLDVS 908

Query: 1282 NVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWL 1341
              ++ D+   + S   + K+ F  K++  S  S       +         +FV DATSWL
Sbjct: 909  GESIYDVANNNLSL-HWEKIFFD-KIAAASKGSDENYNCTL---------YFVIDATSWL 957

Query: 1342 RHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLP 1401
            RHFAHI+KL+KN  LKFA+CLTTFQELR+LR SKD  VVEA+TR++IT+RQLY E K++P
Sbjct: 958  RHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIP 1017

Query: 1402 LRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQNYN 1452
            +RFTGN+AT +EE+LEFEEQITW++HVDEFVI+AI +  +RF+ + + + N
Sbjct: 1018 MRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDEN 1068

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
           YIL151C (REAL)
          Length = 1118

 Score =  449 bits (1156), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 224/383 (58%), Positives = 273/383 (71%), Gaps = 50/383 (13%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           Q  I+KLQ+IY++IV QE +LQ RC  LTTSQTT+LK+LW IY++N +LI NYINFI  A
Sbjct: 205 QTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LL TQ  NDL +G            LWVYG ITFLDVLK+FSNFMDPEVCCQFI + FI+
Sbjct: 265 LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           +S +L DIP+KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 325 VSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER-------NNGN 628
           YH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R       N   
Sbjct: 385 YHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETA 444

Query: 629 HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXX 688
           HRN QLI+YLKHTEVMLLP+FLE++DLQ+VVL+YF+ KFG                    
Sbjct: 445 HRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFG-------------------- 484

Query: 689 XXXIPYXXXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHI 748
                                        DIF  +DMF QNP+ L+Y+FRH+  FA+S +
Sbjct: 485 -----------------------KDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQL 521

Query: 749 LQLVGFGDPKNPFALLFELPKFL 771
           LQL+GFG+PKNPFALLF+LPK+L
Sbjct: 522 LQLIGFGNPKNPFALLFQLPKYL 544

 Score =  401 bits (1031), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 230/591 (38%), Positives = 322/591 (54%), Gaps = 95/591 (16%)

Query: 863  ILCEEFFENIDLLQFPYK-IPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPH 921
            I  E +F+NID L   +  IP  + IWL+SL +IN+ S++CSI VL KFL+ P+++ALPH
Sbjct: 572  ISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPH 631

Query: 922  LLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDEN 981
             LTW+HFI++IL K+E ++       FW  FL+  +PWNS+VN  NVL+ Y+LDNI+   
Sbjct: 632  FLTWLHFIVAILKKLE-TVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCYMLDNIHP-- 688

Query: 982  FKLIIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXX 1041
                                    +FN+NENLPEIWKCWG+LWFD I   ++        
Sbjct: 689  -----FLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAIKKCDV-------- 735

Query: 1042 XXXXXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYK 1101
                                       +   G++DH   D PLDGI F   DE G  F+ 
Sbjct: 736  ---------------------------MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWI 768

Query: 1102 RSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIII 1161
            RSIR I + K + + FP+LGLK++ +   +CR   I  ++ L NF FKL    +      
Sbjct: 769  RSIRTILILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEE------ 822

Query: 1162 PQTXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENI 1221
                                  + L  + +  +I+E IE +N +L+  P LS++ G ENI
Sbjct: 823  ----------------NDHNDNNELDELYDTIEINEKIERVNRDLRATPNLSVVSG-ENI 865

Query: 1222 FNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKNE 1281
            F Y GY RL  +   F +NG   S  IYS W    N              +++ S+    
Sbjct: 866  FEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVGNGM------------VLDVSSESMY 913

Query: 1282 NVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWL 1341
            +    +++P       + K+ F    +   N  +  N             +FV DATSWL
Sbjct: 914  DAANNNLSPH------WEKIFFDRITTAGHNGDKNGNCS----------VYFVIDATSWL 957

Query: 1342 RHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLP 1401
            RHFAHI+KL+KN  LKFA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY E K++P
Sbjct: 958  RHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIP 1017

Query: 1402 LRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQNYN 1452
            LRFTGN+AT++EE+LEFEEQITW +HVDEFVI+AI +  + F+T+ + + N
Sbjct: 1018 LRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKN 1068

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
           YIL151C (REAL)
          Length = 1118

 Score =  447 bits (1149), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 222/382 (58%), Positives = 272/382 (71%), Gaps = 50/382 (13%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           Q  I+KLQ+IYK+IV QE +LQ RC  LTTSQTT+LK+LW IY++N +LI NYINFI  A
Sbjct: 205 QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LL TQ  NDL +G            LWVYG ITFLDVLK+FSNFMDPEVCCQFI + FI+
Sbjct: 265 LLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           +S +L DIP+KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 325 VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER-------NNGN 628
           YH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R       N   
Sbjct: 385 YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETA 444

Query: 629 HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXX 688
           H+N QLI+YLKHTEVMLLP+FLE++DLQ+VVL+YF+ KFG                    
Sbjct: 445 HKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFG-------------------- 484

Query: 689 XXXIPYXXXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHI 748
                                        D+F  +DMF QNP+ L+Y+FRH+  FA+S +
Sbjct: 485 -----------------------KDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQL 521

Query: 749 LQLVGFGDPKNPFALLFELPKF 770
           LQL+GFG+PKNPFALLF+LPK+
Sbjct: 522 LQLIGFGNPKNPFALLFQLPKY 543

 Score =  401 bits (1030), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 231/584 (39%), Positives = 321/584 (54%), Gaps = 95/584 (16%)

Query: 866  EEFFENIDLLQFPYK-IPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLT 924
            E +F+NID L   +  IP  + IWLESL +IN+ S++CSI VL KFL+ P +IALPH LT
Sbjct: 575  ESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLT 634

Query: 925  WIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKL 984
            W++F+++IL ++E +I   Q   FW  FL+  +PWNS+V+  NVL+ Y+LDN++      
Sbjct: 635  WLYFLVAILKRLE-TINSKQVIAFWIHFLRRTMPWNSMVSLANVLVCYMLDNLHP----- 688

Query: 985  IIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXX 1044
                                  FN+NENLPEIWKCWG+LWFD I   ++           
Sbjct: 689  --FLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIKKCDV----------- 735

Query: 1045 XXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSI 1104
                                    +   G++DH   D PLDGI F   DE G  F+ RS+
Sbjct: 736  ------------------------MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSV 771

Query: 1105 RLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQT 1164
            R I L K + + FP+LGLK++ +   +CR   IPQ++ L  F FKL + YD         
Sbjct: 772  RAISLLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKL-DAYDEGNNND--- 827

Query: 1165 XXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNY 1224
                               + L  + E  +I+E I+ +NL+L+  P LS++ G E+IF Y
Sbjct: 828  ------------------NNELDELYETIEINEKIDNVNLDLRATPNLSVVFG-ESIFEY 868

Query: 1225 LGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEXXXXXXXXEHLVNDSTMKNENVT 1284
             GY RL  +   F +NG   S  IYS W                  ++ N   +   N  
Sbjct: 869  TGYTRLAPDYHCFDKNGGFNSAFIYSQW-----------------SNVGNGVPIDVSNEP 911

Query: 1285 VGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHF 1344
            + D+T  D S   + K+ F    +   N  +  N             +FV DATSWLRHF
Sbjct: 912  IYDVTDNDLSL-HWEKIFFDRIAAAYKNCDENDNC----------TIYFVVDATSWLRHF 960

Query: 1345 AHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRF 1404
            AHI+KL+KN  L FA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY E K++P+RF
Sbjct: 961  AHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRF 1020

Query: 1405 TGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSI 1448
            TGN+AT +EE+LEFEEQITW++HVDEFVI+AI +  + F+T+ +
Sbjct: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERM 1064

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1361

 Score =  443 bits (1139), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 222/378 (58%), Positives = 268/378 (70%), Gaps = 43/378 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           Q L+QKLQDIYK IVKQEI+LQ+RC +LT SQTT+LKNLWTIY++N +L++NYI FIT A
Sbjct: 382 QVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFITTA 441

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           + PTQ ++D  IG            LWVYGTITFLD+LK+FSNFMDPEVCCQFI HVFI+
Sbjct: 442 IHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHVFIS 501

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           IS +L DIP KY + W Q+LGDLSRMAIALYPS FIDWKLSAE WY  AM+FTY HGKLY
Sbjct: 502 ISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHGKLY 561

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNH-RNLQ- 633
           YHMSTVQQNTLEAFVNLGKS+FC+ TF PSQQY+QLVI NIYQRA+ + NN N+ RN Q 
Sbjct: 562 YHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRNDQL 621

Query: 634 LIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIP 693
           L++Y+KH EV LLP F ES +LQ VVL+YF  KFG+                        
Sbjct: 622 LVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGV------------------------ 657

Query: 694 YXXXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVG 753
                                   ++F ++ MF+QN D  K F+R+S  FA+S ILQ+VG
Sbjct: 658 -----------------DYNNSSNNMFISRKMFVQNNDQFKCFYRYSAAFAESQILQIVG 700

Query: 754 FGDPKNPFALLFELPKFL 771
           +G+ K+PF+LLFELPK+L
Sbjct: 701 YGNLKSPFSLLFELPKYL 718

 Score =  392 bits (1006), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 248/615 (40%), Positives = 348/615 (56%), Gaps = 87/615 (14%)

Query: 858  NNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILI 917
            NN   +  EEFFENID + +P  +P +++IW  SL+  N +S+KCS+IV KKFL+ P +I
Sbjct: 757  NNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVSIKCSMIVWKKFLHAPFMI 816

Query: 918  ALPHLLTWIHFIISILLKIE--NSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLD 975
            ALPH L W +FIISI+L+++   ++  N+   FW  F++ I PWNSIV FLNVL+ Y++D
Sbjct: 817  ALPHTLPWCYFIISIVLQLDKHKNVAMNE---FWVEFVRRIFPWNSIVKFLNVLLAYMVD 873

Query: 976  NINDENFKLIIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNK-NIN 1034
            N  +++                        +FN+NE LPE+WKC G+LWFD I  K N+N
Sbjct: 874  NCWEQSI-----LNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWFDTIMEKSNLN 928

Query: 1035 SDXXXXXXXXXXXXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDE 1094
             D                  G D   ++Y      +  G++D+   D P+DG  F  +DE
Sbjct: 929  KD-----------KNPEVINGSDFNINDY------KGNGVKDYKFFDFPIDGTDFDESDE 971

Query: 1095 DGINFYKRSIRLIFLCKSMIETFPNL-GLKISHETSNYCR-------NTKIPQNFILNNF 1146
             G  F+KR+ R+IFL K + E++  L GL +S+E   + R       NT   +   L  F
Sbjct: 972  IGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQE---LLEF 1028

Query: 1147 AFKLTNLYDPSLIIIPQTXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNL 1206
            +FKL    D  +                           L +I+E F   E  +E+N + 
Sbjct: 1029 SFKLNASSDGVM---------------------------LDDIIESF---ETPDEVNYDT 1058

Query: 1207 QLQPPLSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPID--YNKFKEXXX 1264
               P LS++ G ++IF+Y+GYKR+  N  SF +NG+ IS S ++SW I    N+      
Sbjct: 1059 HKTPMLSMVDG-DSIFDYVGYKRVCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTC 1117

Query: 1265 XXXXXEHLV----NDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSN--NSQTQN 1318
                 + +     NDS   + N    D   E   F E     F  K  T     + +   
Sbjct: 1118 SSITDDAISSGSGNDSAAASTN---NDPMNELLVFNE----CFDPKYKTLEEFWSQEIYP 1170

Query: 1319 THKMGVSINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGN 1378
              +  +S+ + +T+F+ DATSWLRHFAHIYK++ +  LKFA+CLTTFQELR+LRKSKD N
Sbjct: 1171 DSQTNISL-QGKTYFILDATSWLRHFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHN 1229

Query: 1379 VVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIR 1438
            VVEA+TRAIIT+RQLY E  LLPLRFTGNVAT IEEHLEFEEQITWRSHVDEFVIEA+++
Sbjct: 1230 VVEAATRAIITLRQLYHENNLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLK 1289

Query: 1439 SQERFKTKSIQNYNL 1453
            ++E+ +T  + + N+
Sbjct: 1290 AEEK-RTDRLNDINM 1303

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar
           to uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  425 bits (1092), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 205/376 (54%), Positives = 260/376 (69%), Gaps = 43/376 (11%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           QALI KLQDIYK I+ QE++LQ+ CS +T+SQTTDLK +W +YKIN++L+NNY+ FIT A
Sbjct: 274 QALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTA 333

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           LLP+QS+ DL IG            LWVYGTITFLDVLK FSNFMDPE+CCQFI HVFI+
Sbjct: 334 LLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFIS 393

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           I+ + + IP K+SI W  RLGDLSRMA ALYP G  DWKLSAE+WY EAMK+TY  GKLY
Sbjct: 394 IANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLY 453

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635
           YHM+TVQQN+L AF+NLGKSVFC++ F P+QQY+QLVIDNIYQRA++ R   +  N+Q++
Sbjct: 454 YHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQIL 513

Query: 636 EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDXXXXXXXXXXXIPYX 695
           +YLKH E+M+LP F+E+ +LQ +  VYF  KFG                           
Sbjct: 514 DYLKHNEIMVLPNFMENFELQRMAYVYFSEKFG--------------------------- 546

Query: 696 XXXXXXXXXXXXXXXXXXXXXIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755
                                 + F  + MF+QN + +K++FRHS  FAQ+HILQ+VG+G
Sbjct: 547 ----------------QDFVGNNFFDTRSMFVQNLESVKFYFRHSPLFAQAHILQVVGYG 590

Query: 756 DPKNPFALLFELPKFL 771
           +  N FALL+ELPKF+
Sbjct: 591 NIGNAFALLYELPKFI 606

 Score =  347 bits (889), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 215/610 (35%), Positives = 326/610 (53%), Gaps = 93/610 (15%)

Query: 867  EFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWI 926
            E+F +++ +   + +P  ++IW++SL+  N   + C ++VL+KFL GP + ALPHLL W+
Sbjct: 644  EYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWV 703

Query: 927  HFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII 986
            +F+IS+  KIE ++ D  S+ FW  F++ I PWN+I+NFLNVL+ +L DN   ++  L+ 
Sbjct: 704  YFLISVAFKIE-TLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKDN--SDSCSLVN 760

Query: 987  XXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGTLWFDVICNKNINSDXXXXXXXXXX 1046
                                F++NE LPE+W CWG+LWFD I NK+  S           
Sbjct: 761  QLCETYSQLSLDEILTN---FSENEELPEVWNCWGSLWFDTIKNKSETSY---------- 807

Query: 1047 XXXXXXXXGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRL 1106
                                  L+  GI+D   LD P DGI F   D++G  F+KR+ R+
Sbjct: 808  --------------------SGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRI 847

Query: 1107 IFLCKSMIETFPNLGLKISH------ETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLII 1160
            +FL K   E F + GL++++      E  N     +  +N    +F FK    +DP+  +
Sbjct: 848  LFLFKGYAEKF-DQGLRLTNINSLNSEEENIFTKKQEKRNI---DFLFK----FDPTYDL 899

Query: 1161 IPQTXXXXXXXXXXXXXXXXXXKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNEN 1220
            +P                      + S   E     E I E N+ L   P LS++ G E+
Sbjct: 900  LPIDEASNKYF------------QVYSLFTEKLPAFESISENNIILDAVPQLSVIDG-ES 946

Query: 1221 IFNYLGYKRLNFNIQSFHENGEIISGSIYSSWP-----------------------IDYN 1257
            IF+Y+GYK+L      + +NG +  G+IYS+W                        +D +
Sbjct: 947  IFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDDS 1006

Query: 1258 KFKEXXXXXXXXEHLVNDSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQ 1317
            K  E        ++L  D + ++ +  + ++  E    ++  + +   K+     N +  
Sbjct: 1007 KNFEIREKRLFAKYLECDESQESSD-HLAEVEREGDETEDETEETNSRKVDKYYTNQRDL 1065

Query: 1318 NTHKMGVSINK------HRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFL 1371
            +T    + IN       + T+F+FDAT+WLRHFAHIYK++ +G L F +CLTTFQELRFL
Sbjct: 1066 DTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFL 1125

Query: 1372 RKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEF 1431
            R+S+D NV+EA+TRA+I +R LYK  K++PLRF G +A+ IEEHLEFEEQITWRSHV+EF
Sbjct: 1126 RRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEF 1185

Query: 1432 VIEAIIRSQE 1441
            VIEA+ +SQE
Sbjct: 1186 VIEAVAKSQE 1195

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  424 bits (1089), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 226/409 (55%), Positives = 277/409 (67%), Gaps = 33/409 (8%)

Query: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455
           Q LIQKLQ+IYKLIV QE++LQD+C++L+TSQ+T LK LW+IYK+N DLINNYI FI  +
Sbjct: 267 QNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTS 326

Query: 456 LLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515
           L P+QS ND  IG            LW+YGTITFLD+LK+F+NFMDPE+  QFI+HVF +
Sbjct: 327 LSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFES 386

Query: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575
           IS +++D+P+ +   W QRLGDLSRMAIALYPS FIDWKLS+E+WY E+MKFT+SHGKLY
Sbjct: 387 ISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLY 446

Query: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER----------- 624
           YH+STVQQN LEAFVNLGKSVFC +TF PSQ+YMQLVIDNIYQRAF+ER           
Sbjct: 447 YHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSNNAG 506

Query: 625 ---------NNGNHRNLQ---LIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILD- 671
                     +   +N Q   LIEYLKH+EVMLLP FLE+  L+ VVL YF   FG +  
Sbjct: 507 SSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAI 566

Query: 672 -------STPQPQTSDXXXXXXXXXXXIPYXXXXXXX-XXXXXXXXXXXXXXXIDIFRNQ 723
                  S P   T+            I                         I++F  +
Sbjct: 567 QSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLFNFR 626

Query: 724 DMFIQ-NPDHLKYFFRHSGTFAQSHILQLVGFGDPKNPFALLFELPKFL 771
           ++F Q N D LKYFF++S TFA+SHILQL+GFGDPKNPFALLF+LPK+L
Sbjct: 627 NIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675

 Score =  226 bits (576), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 160/250 (64%), Gaps = 13/250 (5%)

Query: 1203 NLNLQLQPPLSILGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEX 1262
            N +L  +P LS++  NE++F Y GYKR   +  +F +NGE+IS S+Y+S  ID       
Sbjct: 1157 NTDLNCEPGLSLIE-NESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDTINGSSS 1215

Query: 1263 XXXXXXXEHLVNDSTMKNENVTVGDITPEDAS-------FKEFM---KLSFHLKLSTRSN 1312
                       ND +  + + T G    +++S        KE     K  F+  L     
Sbjct: 1216 NANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKILDPDYK 1275

Query: 1313 NSQTQNTHKM--GVSINKHRTFFVFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRF 1370
            N       +M    SI    T+FV DATSWLRHFAH+YKL+ NG LKFA+CLTTFQELRF
Sbjct: 1276 NIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTTFQELRF 1335

Query: 1371 LRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDE 1430
            LRKSKD NV+EA+TRAIIT+RQLY E +LLPLRFTGN+AT IEEHLEFEEQITWRSHVDE
Sbjct: 1336 LRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITWRSHVDE 1395

Query: 1431 FVIEAIIRSQ 1440
            FVIEAI R+Q
Sbjct: 1396 FVIEAIKRAQ 1405

 Score =  213 bits (543), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 173/295 (58%), Gaps = 45/295 (15%)

Query: 862  NILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPH 921
            N+  ++FF N++ L+  + +P ++EIW ESLK IN+ISL CSIIVLKKFLNGP+ ++LPH
Sbjct: 785  NLSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPH 844

Query: 922  LLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDEN 981
            +L W +FIIS+ L+IE S+ + +S+IFW  F++ I PWNSIV++LNV++  LLDN  + +
Sbjct: 845  MLPWSYFIISLALRIE-SLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENS 903

Query: 982  F--KLIIXXXXXXXXXXXXXXXXXXXFFNQNE-NLPEIWKCWGTLWFDVICNKNINSDXX 1038
               KLI                     FN+NE  LPE+WKC+G+LWFDVI          
Sbjct: 904  MITKLI-------NNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIA--------- 947

Query: 1039 XXXXXXXXXXXXXXXXGEDILNDNYD--TDKTLRAMGIEDHTILDCPLDGIGFVANDEDG 1096
                                  +NY   +    + + ++D   L+ P+DG+ F   +E+G
Sbjct: 948  ----------------------ENYQIYSRDCSKNISMKDTKCLNYPIDGLPFDEMEENG 985

Query: 1097 INFYKRSIRLIFLCKSMIETFPNL-GLKISHETSNYCRNTKIPQNFILNNFAFKL 1150
             NF+KRS RLIFL K+MI  F    GL IS  TS YC  + IP N IL  FAFKL
Sbjct: 986  TNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRSDIPNNHILRTFAFKL 1040

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON}
           Anc_5.706 YIL151C
          Length = 962

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 95/211 (45%), Gaps = 25/211 (11%)

Query: 434 LWTIYKINLDLINNYINFITNALLPTQSKNDLHIGXXXXXXXXXXXXLWVYGTITFLDVL 493
           L  ++K++  +++ Y  FI  AL    ++ DL  G            L  +     L+++
Sbjct: 144 LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 494 KSFSNFM----------DPEVCCQFISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAI 543
           +++ N M          + +   +FI    I I+ +L +IP+K+   W   +GDL+R+ +
Sbjct: 204 ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 544 ALYPSGFIDWKLSAEHWYN-----EAMKFTYSHGK----------LYYHMSTVQQNTLEA 588
            L       ++L++ H YN      A+ ++ ++GK           Y+++S VQ ++L  
Sbjct: 264 LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 589 FVNLGKSVFCQETFTPSQQYMQLVIDNIYQR 619
            V L K +  + T    +   QL ID I  +
Sbjct: 324 IVTLSKCLCIENTNVYQKSMAQLAIDKIISK 354

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 10/129 (7%)

Query: 905  IVLKKFLNGPILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVN 964
            ++ KKFL   + I+ P +L W+ F IS+  ++ N +TD    + W   L+ ++PW+ IV 
Sbjct: 498  LLFKKFLMLNVAISQPFILPWLLFYISVASEVAN-VTDRHVLLLWKDLLQNLLPWDDIVT 556

Query: 965  FLN--VLMVYLLDNINDENFKLIIXXXXXXXXXXXXXXXXXXXFFNQNENLPEIWKCWGT 1022
            +LN  + MV    +IN +  + +I                   +     N  EI  C G 
Sbjct: 557  YLNESIDMVN-KHSINSKTLRALI------KNIKSCSLYDLLYYMMYESNFQEISMCEGF 609

Query: 1023 LWFDVICNK 1031
            +WFD + +K
Sbjct: 610  IWFDSLASK 618

>NDAI0B05130 Chr2 complement(1254612..1257089) [2478 bp, 825 aa] {ON}
            Anc_1.256
          Length = 825

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 1343 HFAHIYKLSKNGFLKFAVCLTTFQELRF------LRKSKDGNVVEASTRAIITMRQLYKE 1396
            H + I KLSKN      V +    +         LRK + G V++   +  I  R+ +KE
Sbjct: 529  HLSKIKKLSKNMVKSLKVKMNNRYKFNMVLDDLDLRKRRPGPVLDRLVKKSIDRRKRHKE 588

Query: 1397 GKLLPLRFTGNVATDIEEHLEFEEQITWR 1425
            G LL +         +++ ++F+E +T R
Sbjct: 589  GNLLKILLEELDPASLKDDIKFDENVTNR 617

>Suva_14.394 Chr14 (676747..678666) [1920 bp, 639 aa] {ON} YNR038W
           (REAL)
          Length = 639

 Score = 33.5 bits (75), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 47/110 (42%), Gaps = 12/110 (10%)

Query: 877 FPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWIHFIISILLKI 936
             Y IP      +++L    +  L+C IIV  K L   +   L  L      I+SI  K+
Sbjct: 252 LAYSIP-----VVQTLSKRQINRLRCLIIVPTKLLINQVYTTLAKLTQGTSLIVSI-AKL 305

Query: 937 ENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII 986
           ENS+ D  SK         I     +V+ LN      + +IN +N K +I
Sbjct: 306 ENSLKDEHSKFLNLEPDILITTPGRLVDHLN------MKSINLKNLKFLI 349

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 118,661,650
Number of extensions: 4581331
Number of successful extensions: 11921
Number of sequences better than 10.0: 31
Number of HSP's gapped: 12028
Number of HSP's successfully gapped: 125
Length of query: 1556
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1433
Effective length of database: 39,377,481
Effective search space: 56427930273
Effective search space used: 56427930273
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 73 (32.7 bits)