Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E050605.705ON86864388e-58
YKR095W-A (PCC1)5.705ON88852887e-35
Kpol_YGOB_1043.725.705ON88832703e-32
Smik_11.3595.705ON88832704e-32
Skud_11.3355.705ON94902696e-32
Suva_11.3325.705ON111802708e-32
NCAS0A031805.705ON88842689e-32
TDEL0B021505.705ON91842653e-31
ZYRO0B16368g5.705ON85862573e-30
TBLA0G010305.705ON89832523e-29
KAFR0H001905.705ON82842513e-29
Kwal_YGOB_Anc_5.7055.705ON88842365e-27
KLTH0E00990g5.705ON89832322e-26
SAKL0E14982g5.705ON89842272e-25
KLLA0A00539g5.705ON87842244e-25
KNAG0C066205.705ON101832246e-25
TPHA0E002005.705ON85782236e-25
Ecym_40165.705ON125772092e-22
AFR289W5.705ON81831904e-20
CAGL0G02535g5.705ON140771623e-15
YKL173W (SNU114)1.174ON100836603.7
Smik_11.561.174ON101036587.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E05060
         (86 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...   173   8e-58
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   115   7e-35
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   108   3e-32
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   108   4e-32
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   108   6e-32
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   108   8e-32
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   107   9e-32
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   106   3e-31
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   103   3e-30
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   101   3e-29
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   101   3e-29
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...    96   5e-27
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...    94   2e-26
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...    92   2e-25
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...    91   4e-25
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...    91   6e-25
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...    91   6e-25
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    85   2e-22
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    78   4e-20
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    67   3e-15
YKL173W Chr11 (122517..125543) [3027 bp, 1008 aa] {ON}  SNU114GT...    28   3.7  
Smik_11.56 Chr11 (107990..111022) [3033 bp, 1010 aa] {ON} YKL173...    27   7.1  

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score =  173 bits (438), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 86/86 (100%), Positives = 86/86 (100%)

Query: 1  MRTLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSI 60
          MRTLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSI
Sbjct: 1  MRTLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSI 60

Query: 61 DERVLRVGVSSVLDSIKTILETMDEL 86
          DERVLRVGVSSVLDSIKTILETMDEL
Sbjct: 61 DERVLRVGVSSVLDSIKTILETMDEL 86

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  115 bits (288), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 56/85 (65%), Positives = 72/85 (84%), Gaps = 4/85 (4%)

Query: 2  RTLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSID 61
          ++LD+TLE++IPF  ER ATIA +VLSPDPILKP+DFQV+Y    +   NV+LV+F+SID
Sbjct: 7  KSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDY----SSEKNVMLVQFRSID 62

Query: 62 ERVLRVGVSSVLDSIKTILETMDEL 86
          +RVLRVGVSS++DSIKTI+E MD L
Sbjct: 63 DRVLRVGVSSIIDSIKTIVEAMDVL 87

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  108 bits (270), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 68/83 (81%), Gaps = 4/83 (4%)

Query: 4  LDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDER 63
          +D+TL+  IPF   R A IA QVL PDPILKP+DFQV Y    + ++N+L++KF+SID+R
Sbjct: 9  MDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSY----SSNDNLLIMKFKSIDDR 64

Query: 64 VLRVGVSSVLDSIKTILETMDEL 86
          VLRVGVSSV+DS+KTI+ETMDEL
Sbjct: 65 VLRVGVSSVIDSVKTIIETMDEL 87

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  108 bits (270), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 52/83 (62%), Positives = 69/83 (83%), Gaps = 4/83 (4%)

Query: 4  LDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDER 63
          L +TLE+++PF  E+ A IA +VLSPDPILKP+DFQ++Y    +   NV+LV+F+SID+R
Sbjct: 9  LHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDY----SSEKNVMLVQFRSIDDR 64

Query: 64 VLRVGVSSVLDSIKTILETMDEL 86
          VLRVGVSSV+DSIKT++E MDEL
Sbjct: 65 VLRVGVSSVIDSIKTVVEAMDEL 87

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  108 bits (269), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 72/90 (80%), Gaps = 10/90 (11%)

Query: 3  TLDYTL------EIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVK 56
          +LDYTL      E++IPF  E  A+IA +VLSPDPILKP+DFQV+Y    +   N++LV+
Sbjct: 8  SLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDY----SSEKNIMLVR 63

Query: 57 FQSIDERVLRVGVSSVLDSIKTILETMDEL 86
          F+SID+RVLRVGVSSV+DSIKTI+ET+DEL
Sbjct: 64 FRSIDDRVLRVGVSSVIDSIKTIVETIDEL 93

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  108 bits (270), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (82%), Gaps = 4/80 (5%)

Query: 7   TLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDERVLR 66
           T E++IPF  E+ A IA +VLSPDPILKP+DFQ +Y    +  NNV+L +F+SID+RVLR
Sbjct: 35  TRELKIPFETEKQANIATRVLSPDPILKPQDFQADY----SSENNVMLARFRSIDDRVLR 90

Query: 67  VGVSSVLDSIKTILETMDEL 86
           VGVSSV+DSIKTI+ETMDEL
Sbjct: 91  VGVSSVIDSIKTIIETMDEL 110

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  107 bits (268), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 4/84 (4%)

Query: 3  TLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDE 62
          +LDY L + IPF   R A IA +VL PDPILKP+DFQVEYL      +N+L V F+ ID+
Sbjct: 8  SLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLS----QDNILAVHFRGIDD 63

Query: 63 RVLRVGVSSVLDSIKTILETMDEL 86
          RVLRVGVSSV+DSIKTI+ET+DEL
Sbjct: 64 RVLRVGVSSVIDSIKTIIETIDEL 87

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  106 bits (265), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 4/84 (4%)

Query: 3  TLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDE 62
          +L+++L++ IPF     A IA+QVL PDPILKP+DFQV+Y    T  +NVL+V FQSID+
Sbjct: 2  SLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDY----TTTDNVLVVGFQSIDD 57

Query: 63 RVLRVGVSSVLDSIKTILETMDEL 86
          RVLRVGVSSV+DSIKTI+ET+DEL
Sbjct: 58 RVLRVGVSSVIDSIKTIVETIDEL 81

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  103 bits (257), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (76%), Gaps = 4/86 (4%)

Query: 1  MRTLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSI 60
          M  LD+ L + IPFP +R + +A +VL PDPIL+PEDFQVEY        N+L + F+S+
Sbjct: 1  MNHLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEY----KSKGNLLEIDFKSV 56

Query: 61 DERVLRVGVSSVLDSIKTILETMDEL 86
          D+RVLRVGVSSV+DS+KTI+ET+DEL
Sbjct: 57 DDRVLRVGVSSVIDSVKTIVETIDEL 82

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  101 bits (252), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 4/83 (4%)

Query: 4  LDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDER 63
          +++TL + IPF   + A IA QVL PDPIL+P+DFQV+Y    T   N L+++FQSID+R
Sbjct: 10 MEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKY----TSKGNELVMEFQSIDDR 65

Query: 64 VLRVGVSSVLDSIKTILETMDEL 86
          VLRVGVSSV+DS+KTI+ET DEL
Sbjct: 66 VLRVGVSSVIDSVKTIIETFDEL 88

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  101 bits (251), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 4/84 (4%)

Query: 3  TLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDE 62
           LD+TL++ IPF + + A IA  VL PDPIL+P+DFQV Y       +NV + +F+SID+
Sbjct: 2  NLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSY----KARDNVFVAEFESIDD 57

Query: 63 RVLRVGVSSVLDSIKTILETMDEL 86
          RVLRVGVS+V+DS+KTI+ETMDEL
Sbjct: 58 RVLRVGVSNVIDSLKTIIETMDEL 81

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score = 95.5 bits (236), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 4/84 (4%)

Query: 3  TLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDE 62
           L YTL + +PF  ++ A  A QVL PDPILKP+DF VEY    T   N L V F+ +D+
Sbjct: 8  NLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEY----TSSANNLCVLFEGVDD 63

Query: 63 RVLRVGVSSVLDSIKTILETMDEL 86
          RVLRVGVSSV++SIKTI+ET+DE 
Sbjct: 64 RVLRVGVSSVIESIKTIVETIDEF 87

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score = 94.0 bits (232), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 48/83 (57%), Positives = 60/83 (72%), Gaps = 4/83 (4%)

Query: 4  LDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDER 63
          L YTL + +PF   + A  A +VL PDPILKP+DF VEY   A  HN  L V F+ +D+R
Sbjct: 9  LAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKA--HN--LCVSFEGVDDR 64

Query: 64 VLRVGVSSVLDSIKTILETMDEL 86
          VLRVGVSSV++SIKTI+ET+DE 
Sbjct: 65 VLRVGVSSVIESIKTIIETIDEF 87

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score = 92.0 bits (227), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 47/84 (55%), Positives = 60/84 (71%), Gaps = 4/84 (4%)

Query: 3  TLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDE 62
          +LD+ L + IP      A IA + L PDP+LKPEDFQVEY    +  +  L V F+SID+
Sbjct: 8  SLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEY----SAADYKLCVSFKSIDD 63

Query: 63 RVLRVGVSSVLDSIKTILETMDEL 86
          RVLRVGVSSV++S+KTI+ETMDE 
Sbjct: 64 RVLRVGVSSVIESVKTIIETMDEF 87

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score = 90.9 bits (224), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 66/84 (78%), Gaps = 4/84 (4%)

Query: 3  TLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDE 62
          + +++L + IPF   + A +A++VL PDPI+KPEDFQV Y   +TQ +  L+  F+S+DE
Sbjct: 7  SFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTY---STQ-DTKLICDFESVDE 62

Query: 63 RVLRVGVSSVLDSIKTILETMDEL 86
          R+LRVGV+SV++SIKTI+ET+DEL
Sbjct: 63 RILRVGVNSVIESIKTIVETIDEL 86

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score = 90.9 bits (224), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 56/83 (67%), Gaps = 4/83 (4%)

Query: 4  LDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDER 63
          LD+TL + +PF   R A IA QVL PDPILKP+DF V Y          L  +F   D R
Sbjct: 11 LDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSY----AAQGPCLEARFCGRDAR 66

Query: 64 VLRVGVSSVLDSIKTILETMDEL 86
          VLRVGVSSV+DS+KTI+E++DEL
Sbjct: 67 VLRVGVSSVIDSLKTIIESLDEL 89

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score = 90.5 bits (223), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 61/78 (78%), Gaps = 4/78 (5%)

Query: 9  EIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDERVLRVG 68
          ++ IPF   + A+IA QVL PDP L+PE+F+V+Y    +   + L+V FQS+D+RVLRVG
Sbjct: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDY----SSQGSDLVVNFQSVDDRVLRVG 64

Query: 69 VSSVLDSIKTILETMDEL 86
          VS+V+DSIKTI+ET+DEL
Sbjct: 65 VSNVIDSIKTIIETIDEL 82

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 85.1 bits (209), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 43/77 (55%), Positives = 56/77 (72%), Gaps = 4/77 (5%)

Query: 10  IRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDERVLRVGV 69
           + +PF   + A IA++VL  DP+L+PEDF+V+Y     QH   LLV F SID R LRVGV
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDY---TIQHEK-LLVNFNSIDARSLRVGV 106

Query: 70  SSVLDSIKTILETMDEL 86
           SSV++SIKT++ETMDE 
Sbjct: 107 SSVIESIKTVVETMDEF 123

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 77.8 bits (190), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 54/83 (65%), Gaps = 4/83 (4%)

Query: 4  LDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDER 63
          +D+TL + +PF   R+A IA + L+PDP+L+PE+  V +       N    +K  +ID R
Sbjct: 1  MDHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLN----IKLAAIDAR 56

Query: 64 VLRVGVSSVLDSIKTILETMDEL 86
          VLRV  +S+ +++KT++ET DEL
Sbjct: 57 VLRVATNSIFEALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
           [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
           Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
           unknown function
          Length = 140

 Score = 67.0 bits (162), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 4/77 (5%)

Query: 9   EIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDERVLRVG 68
           ++ +PF   R A IAQ+VL PDPIL+PEDFQVEY   AT    VL + F++ID+RVLR  
Sbjct: 30  DLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKAT----VLDIHFKAIDDRVLRTY 85

Query: 69  VSSVLDSIKTILETMDE 85
                 SI  +L T D 
Sbjct: 86  AYQGSMSIFHLLGTDDS 102

>YKL173W Chr11 (122517..125543) [3027 bp, 1008 aa] {ON}
           SNU114GTPase component of U5 snRNP involved in mRNA
           splicing via spliceosome; binds directly to U5 snRNA;
           proposed to be involved in conformational changes of the
           spliceosome; similarity to ribosomal translocation
           factor EF-2
          Length = 1008

 Score = 27.7 bits (60), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 45  PATQHNNVLLVKFQSIDERVLRVGVSSVLDSIKTIL 80
           P T++N   ++   +I ER++ VGV   L S KT L
Sbjct: 114 PKTRYNRDYMLSMANIPERIINVGVIGPLHSGKTSL 149

>Smik_11.56 Chr11 (107990..111022) [3033 bp, 1010 aa] {ON} YKL173W
           (REAL)
          Length = 1010

 Score = 26.9 bits (58), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 45  PATQHNNVLLVKFQSIDERVLRVGVSSVLDSIKTIL 80
           P T++N   ++    I ER++ VGV   L S KT L
Sbjct: 115 PKTKYNRDYMLSMTDIPERIINVGVIGPLHSGKTSL 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,691,355
Number of extensions: 312193
Number of successful extensions: 963
Number of sequences better than 10.0: 25
Number of HSP's gapped: 944
Number of HSP's successfully gapped: 25
Length of query: 86
Length of database: 53,481,399
Length adjustment: 58
Effective length of query: 28
Effective length of database: 46,830,771
Effective search space: 1311261588
Effective search space used: 1311261588
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)