Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E050505.704ON45145120140.0
NCAS0A031905.704ON3983426574e-81
TDEL0B021605.704ON3753736494e-80
KNAG0C066105.704ON3863686225e-76
SAKL0E14960g5.704ON3843566191e-75
KAFR0H002005.704ON3893685964e-72
TPHA0D046205.704ON4063695765e-69
AFR288C5.704ON4653505781e-68
ZYRO0G06556g5.704ON3793465623e-67
KLLA0A00550g5.704ON3803705321e-62
KLTH0E01012g5.704ON3863605321e-62
Kwal_55.196885.704ON3933485172e-60
CAGL0G02519g5.704ON3783514883e-56
Kpol_YGOB_Anc_5.7045.704ON2072012927e-30
SAKL0E02068g6.48ON558143950.005
Ecym_31386.48ON588128940.006
CAGL0L04554g6.48ON560130910.015
NDAI0K028706.48ON662124910.017
Smik_15.3496.48ON625128860.059
TPHA0F024906.48ON677143830.14
YOR171C (LCB4)6.48ON624124790.43
KLLA0F20504g6.48ON567138770.77
Skud_15.3336.48ON627128722.6
Suva_8.2246.48ON624124722.9
TDEL0A022702.451ON32263686.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E05050
         (451 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   780   0.0  
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    257   4e-81
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    254   4e-80
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   244   5e-76
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   243   1e-75
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      234   4e-72
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   226   5e-69
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   227   1e-68
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   221   3e-67
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   209   1e-62
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   209   1e-62
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   203   2e-60
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   192   3e-56
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   117   7e-30
SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} simila...    41   0.005
Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}...    41   0.006
CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa] ...    40   0.015
NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {...    40   0.017
Smik_15.349 Chr15 complement(608112..609989) [1878 bp, 625 aa] {...    38   0.059
TPHA0F02490 Chr6 (549495..551528) [2034 bp, 677 aa] {ON} Anc_6.4...    37   0.14 
YOR171C Chr15 complement(652010..653884) [1875 bp, 624 aa] {ON} ...    35   0.43 
KLLA0F20504g Chr6 complement(1902726..1904429) [1704 bp, 567 aa]...    34   0.77 
Skud_15.333 Chr15 complement(600768..602651) [1884 bp, 627 aa] {...    32   2.6  
Suva_8.224 Chr8 complement(402084..403958) [1875 bp, 624 aa] {ON...    32   2.9  
TDEL0A02270 Chr1 (412289..413257) [969 bp, 322 aa] {ON} Anc_2.45...    31   6.8  

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/451 (89%), Positives = 402/451 (89%)

Query: 1   MSTNGQEKNEKYLITIDNIHYSVKFTRKQNSDPSKYDSXXXXXXXXXXXXXXXXXXHNNN 60
           MSTNGQEKNEKYLITIDNIHYSVKFTRKQNSDPSKYDS                  HNNN
Sbjct: 1   MSTNGQEKNEKYLITIDNIHYSVKFTRKQNSDPSKYDSLQLIQKQQQQQQQQQQQLHNNN 60

Query: 61  IPTILTTSKDLILNSDYEKNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFEL 120
           IPTILTTSKDLILNSDYEKNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFEL
Sbjct: 61  IPTILTTSKDLILNSDYEKNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFEL 120

Query: 121 FKTTSKDSIKSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNI 180
           FKTTSKDSIKSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNI
Sbjct: 121 FKTTSKDSIKSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNI 180

Query: 181 LTIPMGTANAWSNSLNLNCPIDIFQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGK 240
           LTIPMGTANAWSNSLNLNCPIDIFQKFLLNKLTVSPF                 GKTGGK
Sbjct: 181 LTIPMGTANAWSNSLNLNCPIDIFQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGK 240

Query: 241 NTIYFFIVLSMGFHANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDK 300
           NTIYFFIVLSMGFHANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDK
Sbjct: 241 NTIYFFIVLSMGFHANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDK 300

Query: 301 SHIILNDSFSYFNLMNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGY 360
           SHIILNDSFSYFNLMNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGY
Sbjct: 301 SHIILNDSFSYFNLMNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGY 360

Query: 361 SNELGQKNIQNIDEDGIIYFPINDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNLLN 420
           SNELGQKNIQNIDEDGIIYFPINDKKFKIT              HNYELCCDGMLFNLLN
Sbjct: 361 SNELGQKNIQNIDEDGIIYFPINDKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNLLN 420

Query: 421 YQTNQGKQDKISFEIEANSNKISSFRIFALS 451
           YQTNQGKQDKISFEIEANSNKISSFRIFALS
Sbjct: 421 YQTNQGKQDKISFEIEANSNKISSFRIFALS 451

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  257 bits (657), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 204/342 (59%), Gaps = 32/342 (9%)

Query: 79  KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSI 138
           K+  +LI+IDS HSG GR  +NDFY  +MEPI  KLN+   L KTTSKDS+++FA+    
Sbjct: 53  KDTAQLIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKL-- 110

Query: 139 KTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQT--SKINLNILTIPMGTANAWSNSLN 196
              D TK  Y + FLSGDTTISEF N LP Q      +K +L+IL  P GT NA +NSL 
Sbjct: 111 ---DLTK-HYEIFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLG 166

Query: 197 LNCPIDIFQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGKNTIYFFIVLSMGFHAN 256
           L CP  IF  +L +  +++ F                       N I FF++LS+GFHAN
Sbjct: 167 LTCPTTIFSNYLTSNYSINNFPLYKAIFP-------------NGNEIVFFVILSLGFHAN 213

Query: 257 LLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMN 316
           LLH C     Y  LG+ERF++AS++IL+NY+L+LNI+IES    S I+ +  +SYF ++N
Sbjct: 214 LLH-CCEAPHYKKLGVERFRIASEDILANYDLDLNISIESPRGLSPIVPSREYSYFVVVN 272

Query: 317 TPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDG 376
           TPKLE  YIPSP S+PL++ LH++AY S    K +L+  I+KGY N +G      ++  G
Sbjct: 273 TPKLEAKYIPSPQSNPLRSQLHIIAYSSS-LPKDELMARILKGYENNIGDV----VNNTG 327

Query: 377 IIYFPINDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNL 418
           + Y PI D  F I                 ++LCCDG+LFNL
Sbjct: 328 VTYLPIED-NFIIKLNYSQEYSPSS----KFQLCCDGLLFNL 364

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  254 bits (649), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 154/373 (41%), Positives = 205/373 (54%), Gaps = 43/373 (11%)

Query: 79  KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSI 138
           +N   LI+IDS HSG GR  +ND Y I+M+PI   +NI   L KTTS+D+I S+A+   I
Sbjct: 44  QNQPNLIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDI 103

Query: 139 KTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSNSLNLN 198
               T      ++FLSGDT+ISEF NNLP   P     NL+IL+ PMG+ NAW++SL + 
Sbjct: 104 SQSHT------VLFLSGDTSISEFINNLPQGAPSA---NLSILSFPMGSGNAWASSLGIM 154

Query: 199 CPIDIFQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGKNTIYFFIVLSMGFHANLL 258
           CP+  F +F+  +++ SPF                        +I FFI+LSMGFHANL+
Sbjct: 155 CPVKTFGQFIRGEMSHSPFPLYKAVFPNGY-------------SIVFFIILSMGFHANLV 201

Query: 259 HLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTP 318
           H C   E Y  +G+E+F+LA   IL  Y L+L IT+ S        L  S+SYF L+NTP
Sbjct: 202 HACERPE-YQRMGIEKFQLAGSVILKEYELDLKITVNS--------LAASYSYFALINTP 252

Query: 319 KLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGII 378
            LE  Y PSP SDPLK  L++L Y S   +K Q +  +MKGY  ELG  +   +D D  I
Sbjct: 253 NLEPAYRPSPESDPLKEELYLLGYSSG-LSKDQFLTKVMKGY--ELGPSDKLPLDSD-TI 308

Query: 379 YFPINDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNLLNYQTNQGKQDKISFEIEAN 438
           Y P   K F +T              +  E+CCDG+L NL + Q +    +K S E    
Sbjct: 309 YVPFT-KGFDVT----LDFPLLESPRYKSEICCDGVLLNLQDLQADLEVSNKFSIEF--- 360

Query: 439 SNKISSFRIFALS 451
            N  S F I A+S
Sbjct: 361 LNHYSKFNIKAMS 373

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  244 bits (622), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 140/368 (38%), Positives = 209/368 (56%), Gaps = 36/368 (9%)

Query: 84  LIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKTKDT 143
           LI++DS HSG GR   ND    ++EP+L +L+ ++++ K+ +  S+  F N       D 
Sbjct: 53  LIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQL-----DP 107

Query: 144 TKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSNSLNLNCPIDI 203
           T+  Y ++F+SGDT++SEFFN +    P + + +L IL I MGT NA +NSLNLNCP++ 
Sbjct: 108 TQ-SYTILFVSGDTSVSEFFNGVGAGVP-SPRSSLTILPIAMGTGNALANSLNLNCPVEA 165

Query: 204 FQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGKNTIYFFIVLSMGFHANLLHLCSN 263
           F  FL  +L  + F                     G+ ++ FFIVLS+GFHANLLH   N
Sbjct: 166 FASFLRGELVTAEFPLYRAILPD------------GETSVVFFIVLSLGFHANLLHAAEN 213

Query: 264 DEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTPKLEYN 323
            EKY ++G+ERF+ AS +IL NY L   IT+    DK  +    S++YF L+N P LE +
Sbjct: 214 -EKYKSMGVERFQEASGDILQNYKLQEQITL----DKQGVA--GSYAYFALVNVPNLEAS 266

Query: 324 YIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGIIYFPIN 383
           YIPSP SDP K+ LH+LAY S   N++QL++ IM GY N  G +    +  D    +   
Sbjct: 267 YIPSPQSDPFKHELHLLAYSSS-LNRKQLLERIMAGYKNRRGDE----LTADPYTTYKRI 321

Query: 384 DKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNLLNYQTNQGKQDKISFEIEANSNKIS 443
            + F+I                 +ELC DG L+NLL Y+++Q  Q++++ ++E   + + 
Sbjct: 322 SEGFEIKLQNKQEGPNDPA----FELCLDGQLYNLLQYKSDQ-HQEELTIQVELIDSALG 376

Query: 444 SFRIFALS 451
           SF I  + 
Sbjct: 377 SFDILVMG 384

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  243 bits (619), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 149/356 (41%), Positives = 204/356 (57%), Gaps = 41/356 (11%)

Query: 81  NTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKT 140
           N++LII+DS  SG+GR  + DF   +++PIL KL  + ++ KT S  SI  FA       
Sbjct: 52  NSELIILDSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREI---- 107

Query: 141 KDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSNSLNLNCP 200
            + +K  Y +IFLSGDT+ISEF N++P Q    SK  LNI  IPMGT NAW++SLNL CP
Sbjct: 108 -EPSK-SYTIIFLSGDTSISEFLNHIPTQN-SNSKHALNIYPIPMGTGNAWASSLNLKCP 164

Query: 201 IDIFQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGKNTIYFFIVLSMGFHANLLHL 260
           ++ FQKFL N L  S F                     G +TI FFI+LS+GFHANLLHL
Sbjct: 165 VESFQKFLKNDLIASKFPLYRASF------------PNGYSTI-FFIILSIGFHANLLHL 211

Query: 261 CSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTPKL 320
           C N  KY  +G+ERFK AS +I  NY+L   ++I +        ++  ++YF ++NTP L
Sbjct: 212 C-NHSKYKVMGVERFKAASAQIFKNYDLKYKVSIPNR-------VSGCYAYFAIINTPNL 263

Query: 321 EYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGIIYF 380
           E  Y PSPLSDPL + LH+L ++S      +LIK I +G + + G     +I + G+IY 
Sbjct: 264 EPTYKPSPLSDPLTSALHLLGFESS-LKSSELIKRITRGRTAQKG----DDIMDTGVIYE 318

Query: 381 PINDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNLLNYQTNQGKQD---KISF 433
            + +K F I                 +E+CCDG L NLL+ Q  +G  D   K+SF
Sbjct: 319 KL-EKDFDIVVEHSPSASDRI----KFEICCDGQLLNLLDMQGTEGSFDGTIKVSF 369

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  234 bits (596), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 142/368 (38%), Positives = 203/368 (55%), Gaps = 49/368 (13%)

Query: 84  LIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKTKDT 143
           +++IDS  SG GRNK N FY I+++PI     I+   FKTT   SI ++A     K+ D 
Sbjct: 55  VVVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYA-----KSLDL 109

Query: 144 TKIDYNLIFLSGDTTISEFFNNLPP--QQPQTSKINLNILTIPMGTANAWSNSLNLNCPI 201
           +K  Y +IF+SGDT+ISEF NNLPP  +     K  ++IL +PMGT NA+S+S+   CPI
Sbjct: 110 SK-SYTVIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPI 168

Query: 202 DIFQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGKNTIYFFIVLSMGFHANLLHLC 261
                FL N+   S F                     GK T+ FFI+LS+G HAN+LHLC
Sbjct: 169 QTLSSFLHNRTQPSHFPLYEVIF------------PNGK-TVIFFIILSLGLHANVLHLC 215

Query: 262 SNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTPKLE 321
            ND +Y   G ERFKLA +++++ Y+LN+ + I   +      L+ +FSYF L+NTP LE
Sbjct: 216 ENDPQYKKYGEERFKLAFEKVMTTYDLNVRLQIPELD------LSGAFSYFILINTPNLE 269

Query: 322 YNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGIIYFP 381
            +YIPSPLSDP    LHVL Y S   N + L+  + +GYSN+LG    + ++   ++Y P
Sbjct: 270 SSYIPSPLSDPFLEQLHVLGYSSS-LNNEDLLNYVTQGYSNKLGD---ELVESSNMVYKP 325

Query: 382 INDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNLLNY------------QTNQGKQD 429
           I+                     + Y++CCDG+LFNL +             +TN   +D
Sbjct: 326 ISRN------VSIVLTEDEESEKYKYDICCDGLLFNLRDMLPENPTKEDYVLKTNFKSRD 379

Query: 430 KISFEIEA 437
            + FE++ 
Sbjct: 380 SLPFEVQV 387

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  226 bits (576), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 139/369 (37%), Positives = 206/369 (55%), Gaps = 41/369 (11%)

Query: 81  NTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKT 140
           +++L++IDS  SG+GR  +NDFY  +M+P+  + N K +  +T  +DSIK  A  F    
Sbjct: 57  SSELVVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASK 116

Query: 141 KDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQ------TSKINLNILTIPMGTANAWSNS 194
                 DY +IFLSGDT++SEF NNL   Q +       +K  +NI TIP+GT NA ++S
Sbjct: 117 ------DYTIIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASS 170

Query: 195 LNLNCPIDIFQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGKNTIYFFIVLSMGFH 254
           ++L+ P  +FQKFL N+L +  F                      K TI FFI+ SMGFH
Sbjct: 171 IHLSSPHQVFQKFLNNELIIKDFPLYTVTLP-------------NKKTIIFFIIFSMGFH 217

Query: 255 ANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNL 314
           ANLLH C +DE Y  +G ERF  AS+ I  NY+LN+ +T ++ ++     ++ +++YF +
Sbjct: 218 ANLLHACDSDE-YQKMGTERFAKASENIFKNYDLNIGLTTKNGSES----ISRNYAYFAI 272

Query: 315 MNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDE 374
           +NTP LE NY+PSP SD  KN LH+L Y +   + ++L+  IM GYS +  +K I N D 
Sbjct: 273 INTPNLELNYMPSPDSDVFKNELHLLGYDA-SLSTEKLVNKIMAGYSYKEREK-INNKD- 329

Query: 375 DGIIYFPINDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNLLNYQTNQGKQDKISFE 434
           +   Y+P+N     +               + Y++CCDG+L NL +     G        
Sbjct: 330 NLTYYYPVNLSGTGL-QIILETDSDKKLEKYKYDICCDGLLLNLDDINNQHGVA------ 382

Query: 435 IEANSNKIS 443
            E+N NKI+
Sbjct: 383 -ESNKNKIT 390

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  227 bits (578), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/350 (35%), Positives = 184/350 (52%), Gaps = 40/350 (11%)

Query: 74  NSDYEKNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFA 133
            ++       L+++DS  SG GR    DFYA +M P+L+ L+++ E  +T+S  S++  A
Sbjct: 127 GAEARAPGGPLVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELA 186

Query: 134 NNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSN 193
             F  +T +TT     ++ +SGDTTISEF N L       S   + +  +P+GTANAW++
Sbjct: 187 ETFP-RTSETT-----VLVMSGDTTISEFVNAL------GSGAGVTVYALPLGTANAWAH 234

Query: 194 SLNLNCPIDIFQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGKNTIYFFIVLSMGF 253
           S+ L  P    Q F+  ++   PF                        +I FFIVLS GF
Sbjct: 235 SVGLGTPAKALQAFVQGRVHAVPFPLYRARFPSGY-------------SIRFFIVLSAGF 281

Query: 254 HANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFN 313
           HANLLHLC NDE+Y  LG+ERF+ AS EIL  Y L  ++ + + +      L   ++YF 
Sbjct: 282 HANLLHLC-NDERYQRLGVERFREASTEILDRYALAEHVRVRAADGSEQ--LAGLYAYFA 338

Query: 314 LMNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNID 373
           L+NTP LE  Y+PSPLSDPL   LHVLA+++   ++ +L + +M GYS   G      + 
Sbjct: 339 LLNTPHLEETYVPSPLSDPLLKQLHVLAFEAE-LSRDKLNELLMAGYSTIRGSA----LS 393

Query: 374 EDGIIYFPINDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNLLNYQT 423
             G++Y  + D  F ++                 ELC DG L NL++ Q 
Sbjct: 394 APGLVYRNLGD-SFTLSIENGASDRVAN------ELCVDGHLLNLVDLQA 436

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  221 bits (562), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 132/346 (38%), Positives = 192/346 (55%), Gaps = 39/346 (11%)

Query: 78  EKNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFS 137
             +++ LI++DS  SG+GR + NDFY+I++ PIL +LN      KTTS DS+  FA +  
Sbjct: 45  RSDDSTLIVLDSLKSGIGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSL- 103

Query: 138 IKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSNSLNL 197
               D  + DY +  +SGDTTISEF NNLP +  + ++  L IL +PMGT NAW+NSL  
Sbjct: 104 ----DPLQ-DYEIWIISGDTTISEFCNNLPNK--KITRNPLRILPLPMGTGNAWANSLGF 156

Query: 198 NCPIDIFQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGKNTIYFFIVLSMGFHANL 257
           + PI  F+ +L + L                             +I FF++ S+GFHANL
Sbjct: 157 DSPITAFRNYLNHNLK-------------PRDIPLYRAALPNGYSIIFFMIFSLGFHANL 203

Query: 258 LHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNT 317
           LH C  D KY+ +G ERF++A+  IL +Y+L+L+I+++         L  S++YF L+NT
Sbjct: 204 LHAC-EDPKYAKMGAERFQIAAQSILESYSLDLDISLDG--------LRRSYAYFALINT 254

Query: 318 PKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGI 377
           P LE  Y PSP S+PL+  L +L Y S    +Q+L++ IM+GY N+       N D   +
Sbjct: 255 PNLEATYKPSPRSNPLERELRLLGYSSS-LGRQELVEKIMQGYQNKPNGDLPTNED---M 310

Query: 378 IYFPINDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNLLNYQT 423
           IY     K                   H +E+CCDG+L NLL+YQ+
Sbjct: 311 IY-----KSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQS 351

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  209 bits (532), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 137/370 (37%), Positives = 191/370 (51%), Gaps = 45/370 (12%)

Query: 65  LTTSKDLILNSDYEKNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTT 124
           L   + L+ N  +E +  +L+I+DS  SG GR+K+ DF   ++     ++ + + L KTT
Sbjct: 43  LLDDEKLLANKKFEYSG-ELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTT 101

Query: 125 SKDSIKSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIP 184
           SK S+   A++      D+T+  Y ++FLSGDT+ISEF NNLP      S     +L  P
Sbjct: 102 SKSSVIELASSI-----DSTR-QYTVLFLSGDTSISEFVNNLPLNHDCIS-----VLPFP 150

Query: 185 MGTANAWSNSLNLNCPIDIFQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGKNTIY 244
           MGT NAW++SL L  P  IF +F+  KL+ + F                         + 
Sbjct: 151 MGTGNAWASSLKLMDPAVIFSQFVNGKLSCNDFPLYR-------------ATFDNGYVLK 197

Query: 245 FFIVLSMGFHANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHII 304
           FFI+LS+GFHANLLHLC  DE Y  +G+ERF++AS  IL  Y L   ++I         I
Sbjct: 198 FFIILSLGFHANLLHLCEEDE-YQKMGIERFRVASQRILREYKLESRVSIPD-------I 249

Query: 305 LNDSFSYFNLMNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNEL 364
           L  SFSYF L+NT  LE  Y+PSP SDPL++ LHVLAY+S   ++ +  K +  GYSN  
Sbjct: 250 LEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSS-LDRVEFQKRVFMGYSN-- 306

Query: 365 GQKNIQNIDEDGIIYFPINDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNLLNYQTN 424
                 NI ++G  Y P       +                N+E+CCDG L NLL  +  
Sbjct: 307 --TKHSNILQNGTFYRP-------LPFCFNVEVLDDPSQKSNFEVCCDGQLLNLLELEGK 357

Query: 425 QGKQDKISFE 434
                 I  E
Sbjct: 358 NTPPSTIRIE 367

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  209 bits (532), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 129/360 (35%), Positives = 181/360 (50%), Gaps = 36/360 (10%)

Query: 70  DLILNSDYEKNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSI 129
           D  L+    +    ++I+DS  SG GR+  N+F   ++EP+ + L I  ++ +T   D+ 
Sbjct: 42  DASLDPQLTRGQKDILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAA 101

Query: 130 KSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTAN 189
               + F   T++T      LIFLSGDTTISEF N L  +  +  +  L+++ +P+GT N
Sbjct: 102 GQLGHTFQPSTENTI-----LIFLSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGN 156

Query: 190 AWSNSLNLNCPIDIFQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGKNTIYFFIVL 249
           AW+NSL L CP      FL  +LT   F                         + FFI+L
Sbjct: 157 AWANSLGLRCPAASLSCFLQGQLTPRKFPLYKATFPNGF-------------EMIFFIIL 203

Query: 250 SMGFHANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSF 309
           S+GFHANLLHLC   +++ +LG+ERFK+AS EIL  Y L   + +     +        +
Sbjct: 204 SIGFHANLLHLC-KQQRFQSLGVERFKIASLEILQKYPLEYRLQVSGLPTR-------DY 255

Query: 310 SYFNLMNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNI 369
           SYF L+NTP LE +Y PSP S+ L   LHVL Y S    +  L+  IMKGYSN  G    
Sbjct: 256 SYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSK-LQQASLVSKIMKGYSNRAG---- 310

Query: 370 QNIDEDGIIYFPINDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNLLNYQTNQGKQD 429
            +I  DG+IY P N                       +E+CCDG L N+L+ Q    K D
Sbjct: 311 DDISGDGVIYEPYNH-----ALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQPQDQKFD 365

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  203 bits (517), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/348 (35%), Positives = 184/348 (52%), Gaps = 40/348 (11%)

Query: 84  LIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKTKDT 143
           ++++DS  SG GR+ +NDF   +++P+ ++L + + + KT +++S+     NF    ++T
Sbjct: 57  ILVVDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNT 116

Query: 144 TKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSNSLNLNCPIDI 203
           T     +IFLSGDT+ISEF NNL  +Q  T +  +N+L +P+GT NAW+NSL        
Sbjct: 117 T-----VIFLSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATA 171

Query: 204 FQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGKNTIYFFIVLSMGFHANLLHLCSN 263
             +FL   L    F                         I FFI+LS+GFHANLLHLC +
Sbjct: 172 LAEFLQGFLKPKNFPLYKAIFPNGY-------------EIVFFIILSIGFHANLLHLC-D 217

Query: 264 DEKYSNLGLERFKLASDEILSNYNLN--LNITIESCNDKSHIILNDSFSYFNLMNTPKLE 321
             ++  LG+ERF+LAS EI  +Y L+  L +T             + +SYF L+NTP LE
Sbjct: 218 QPRFKKLGVERFRLASKEIFEDYILDYPLQVTQRPL---------EHYSYFALINTPNLE 268

Query: 322 YNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGIIYFP 381
            NY PSP S+PL + LH+L Y S    +  LI  IMKGYSN+       +I+E+G+ Y  
Sbjct: 269 QNYKPSPKSNPLTSELHLLGYSSG-LPQPMLINRIMKGYSNQPE----TDINEEGVTY-- 321

Query: 382 INDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNLLNYQTNQGKQD 429
              + F                   +++CCDG L N+L+ Q   G  D
Sbjct: 322 ---QAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQQPAHGSFD 366

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  192 bits (488), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 118/351 (33%), Positives = 186/351 (52%), Gaps = 39/351 (11%)

Query: 68  SKDLILNSDYEKNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKD 127
           S D  L  D    +T++I+IDS  SG  RN  +D Y +++EP+   L ++++  KT S++
Sbjct: 38  STDCFLKFD---RDTQIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESEN 94

Query: 128 SIKSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGT 187
           SI+ FA   S ++       Y+++FLSGDT+ISEF N L     +++K  ++IL +P+G+
Sbjct: 95  SIRDFARRTSFQSG----FKYDILFLSGDTSISEFINALDTTILRSAKYRISILPVPLGS 150

Query: 188 ANAWSNSLNLNCPIDIFQKFLLNKLTVSPFXXXXXXXXXXXXXXXXXGKTGGKNTIYFFI 247
            NA + SL    P+     +L +    SP                   +     ++ FFI
Sbjct: 151 GNALATSLGFKTPLQALITYLNSNKKCSPL-------------PLYDAQLPNSTSMIFFI 197

Query: 248 VLSMGFHANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILND 307
           +LS+GFHANLLH C+ D KY ++G+ERF++AS  +  +Y+LN+ I +         + + 
Sbjct: 198 ILSLGFHANLLH-CAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNG-------LQSQ 249

Query: 308 SFSYFNLMNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQK 367
           S+SYF ++  P LE  Y PSP S  LK  LH+L YK+     + L   IM+GY N+ G  
Sbjct: 250 SYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAG-ICLEDLQDKIMRGYHNKDG-- 306

Query: 368 NIQNIDEDGIIYFPINDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNL 418
             ++I E G IY     K  +++              + Y++C DG L NL
Sbjct: 307 --EDIQEIGTIY-QCFQKNLELS-----IKTGHNAPKYRYDMCIDGYLLNL 349

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  117 bits (292), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 108/201 (53%), Gaps = 17/201 (8%)

Query: 243 IYFFIVLSMGFHANLLHLCSNDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSH 302
           IYFFI+LS+GFHA LLH CS  E    +G ERF+LA+ EIL  Y+L+LNI +     +  
Sbjct: 10  IYFFIILSLGFHATLLHACSRPELL-KMGTERFQLAAKEILETYDLDLNIKVNKSTRR-- 66

Query: 303 IILNDSFSYFNLMNTPKLEYNYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSN 362
                 ++YF ++NT  LE  Y PSP S+ L+N+L +L Y S   ++ +L+  IMKGY  
Sbjct: 67  ------YAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSS-KLSRAELVDKIMKGYII 119

Query: 363 ELGQKNIQNIDEDGIIYFPINDKKFKITXXXXXXXXXXXXXXHNYELCCDGMLFNLLNYQ 422
             G      I  D   Y+   D   +                H +E+CCDG+L +L+  +
Sbjct: 120 RKGDV----IKTDEYTYYETLDLS-QSGIDIIVDEKMNNSNTHKFEICCDGLLLDLM--E 172

Query: 423 TNQGKQDKISFEIEANSNKIS 443
            ++G+ D ++  I +  + +S
Sbjct: 173 KSKGRTDNLTIHINSVKDYLS 193

>SAKL0E02068g Chr5 (158331..160007) [1677 bp, 558 aa] {ON} similar
           to uniprot|Q12246 Saccharomyces cerevisiae YLR260W LCB5
           Minor sphingoid long-chain base kinase paralog of Lcb4p
           responsible for few percent of the total activity
           possibly involved in synthesis of long-chain base
           phosphates which function as signaling molecules and
           similar to YOR171c
          Length = 558

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 61/143 (42%), Gaps = 14/143 (9%)

Query: 60  NIPTILTTSKDL---ILNSDYE--KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKL 114
           +I ++ ++S D+   IL+  Y+  K N  +++I + H G GR   N  Y    +PIL   
Sbjct: 153 SIDSLASSSTDVVEEILDRSYKSTKRNKSILVIINPHGGKGR--ANKLYVSKAKPILIAS 210

Query: 115 NIKFELFKTTSKDSIKSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTS 174
               E+ +TT        A N  I   D       +   SGD    E  N L  +  +  
Sbjct: 211 QCTVEILETTYHRHAIDIAQNIDIDKYDV------IACASGDGIPHEVLNGLYRRADRAK 264

Query: 175 KIN-LNILTIPMGTANAWSNSLN 196
             N + I  +P G+ NA S S +
Sbjct: 265 AFNKVAITQLPCGSGNAMSVSCH 287

>Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR256W
          Length = 588

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 53/128 (41%), Gaps = 11/128 (8%)

Query: 72  ILNSDYE--KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSI 129
           IL   Y+  K N  +++I + H G GR   N  Y    +PIL       E+F+T+  +  
Sbjct: 189 ILERSYKNTKRNKSILVIINPHGGRGR--ANKIYVTKAKPILIASGCYVEVFQTSYPEHA 246

Query: 130 KSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKIN-LNILTIPMGTA 188
              A    I   D       +   SGD    E  N L  ++ +    N + +  +P G+ 
Sbjct: 247 IEIARTMDIDKYDV------IACASGDGIPYEVLNGLYRREDRAKAFNKVAVTQLPCGSG 300

Query: 189 NAWSNSLN 196
           NA S S +
Sbjct: 301 NAMSVSCH 308

>CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YOR171c LCB4
          Length = 560

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 11/130 (8%)

Query: 70  DLILNSDYE--KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKD 127
           +LI+   Y+  K N  +++I + H G G  K    +   +EPIL      FEL +T    
Sbjct: 154 ELIIEKSYQNVKRNRSILVIINPHGGKG--KAMHIFKKRIEPILIASECSFELMETKYSR 211

Query: 128 SIKSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKIN-LNILTIPMG 186
                A    ++  DT      +   SGD    E  N L  ++ +    N + +  +P G
Sbjct: 212 HATDIAREIDLEEFDT------IACASGDGVPYEVINGLYMREDKVDAFNKITVTQLPCG 265

Query: 187 TANAWSNSLN 196
           + NA S S +
Sbjct: 266 SGNAMSISCH 275

>NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {ON}
           Anc_6.48 YLR260W
          Length = 662

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 54/124 (43%), Gaps = 11/124 (8%)

Query: 72  ILNSDYE--KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSI 129
           I+N  Y+       ++II + H G G  K +  +    +PILS  N KFE+  TT     
Sbjct: 249 IMNRSYKNVSQQRSILIIINPHGGKG--KASKLFNKWSKPILSTSNCKFEIINTTYSSHA 306

Query: 130 KSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKIN-LNILTIPMGTA 188
              A     K+ D +K D  +   SGD    E  N L  +  +    N L I  IP G+ 
Sbjct: 307 TDIA-----KSLDISKYDI-IACASGDGIPYEVINGLYQRPDRVDAFNKLTITQIPCGSG 360

Query: 189 NAWS 192
           NA S
Sbjct: 361 NAMS 364

>Smik_15.349 Chr15 complement(608112..609989) [1878 bp, 625 aa] {ON}
           YOR171C (REAL)
          Length = 625

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 53/128 (41%), Gaps = 11/128 (8%)

Query: 72  ILNSDYE--KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSI 129
           IL   YE  K N  +++I + H G G  K    +    +PIL++   K E+  T      
Sbjct: 217 ILEKSYENSKRNRSILVIINPHGGKGTAKT--LFLTKAQPILAESGCKIEIAYTKYARHA 274

Query: 130 KSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKIN-LNILTIPMGTA 188
              A +  I+  DT      +   SGD    E  N L  +  +    N L +  +P G+ 
Sbjct: 275 IDIAKDLDIRKYDT------IACASGDGIPYEVINGLYRRSDRVEAFNKLAVTQLPCGSG 328

Query: 189 NAWSNSLN 196
           NA S S +
Sbjct: 329 NAMSISCH 336

>TPHA0F02490 Chr6 (549495..551528) [2034 bp, 677 aa] {ON} Anc_6.48
           YOR171C
          Length = 677

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 63/143 (44%), Gaps = 14/143 (9%)

Query: 60  NIPTILTTSKDL---ILNSDYE--KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKL 114
           +I +IL    DL   ILN  Y+  + N K++ I +   G G  K+   Y    +PIL+  
Sbjct: 262 DIESILPLEHDLVTEILNRSYQGTRRNRKILAIINEFGGKGNAKK--LYFSKAKPILAAS 319

Query: 115 NIKFELFKTTSKDSIKSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTS 174
             K ++  T       + A    I   DT      ++  SGD    E  N L  ++ + +
Sbjct: 320 RCKVDIVFTEYTGHAINVAKEMDINKYDT------IVCASGDGIPYEIINGLYQRKDRAA 373

Query: 175 KIN-LNILTIPMGTANAWSNSLN 196
             + L I  +P G+ANA S S +
Sbjct: 374 AFSKLAITQLPCGSANAMSVSCH 396

>YOR171C Chr15 complement(652010..653884) [1875 bp, 624 aa] {ON}
           LCB4Sphingoid long-chain base kinase, responsible for
           synthesis of long-chain base phosphates, which function
           as signaling molecules, regulates synthesis of ceramide
           from exogenous long-chain bases, localizes to the Golgi
           and late endosomes
          Length = 624

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 49/124 (39%), Gaps = 11/124 (8%)

Query: 72  ILNSDYE--KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSI 129
           IL   YE  K N  +++I + H G G  K  + +     PIL +   K E+  T      
Sbjct: 215 ILEKSYENSKRNRSILVIINPHGGKGTAK--NLFLTKARPILVESGCKIEIAYTKYARHA 272

Query: 130 KSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKIN-LNILTIPMGTA 188
              A +  I   DT      +   SGD    E  N L  +  +    N L +  +P G+ 
Sbjct: 273 IDIAKDLDISKYDT------IACASGDGIPYEVINGLYRRPDRVDAFNKLAVTQLPCGSG 326

Query: 189 NAWS 192
           NA S
Sbjct: 327 NAMS 330

>KLLA0F20504g Chr6 complement(1902726..1904429) [1704 bp, 567 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of
           long-chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 567

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 54/138 (39%), Gaps = 11/138 (7%)

Query: 62  PTILTTSKDLILNSDYE--KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFE 119
           P + T   + ILN  Y+  K N  +++I + H G G  K N  +    +PIL     K  
Sbjct: 155 PNMGTDVAEEILNRSYKNTKRNKSILVIINPHGGKG--KANKLFLSKAKPILLASGCKIV 212

Query: 120 LFKTTSKDSIKSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKIN-L 178
           + +TT        A N  I   D           SGD    E  N L  +  +      L
Sbjct: 213 VKETTYHLHAVDIAKNLDIDEYDVVAC------ASGDGIPHEIMNGLFLRSDRAKAFQKL 266

Query: 179 NILTIPMGTANAWSNSLN 196
            I  +P G+ NA S S +
Sbjct: 267 AITQLPCGSGNAMSISCH 284

>Skud_15.333 Chr15 complement(600768..602651) [1884 bp, 627 aa] {ON}
           YOR171C (REAL)
          Length = 627

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 50/128 (39%), Gaps = 11/128 (8%)

Query: 72  ILNSDYE--KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSI 129
           IL   YE  + N  +++I + H G G  K    +     PIL +   K E+  T      
Sbjct: 219 ILEKSYENSRRNRSILVIINPHGGKGTAKT--LFLTKASPILVESGCKIEIAYTKYARHA 276

Query: 130 KSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKIN-LNILTIPMGTA 188
              A +  I   DT      +   SGD    E  N L  +  +    N + +  +P G+ 
Sbjct: 277 IDIARDLDISKYDT------IACASGDGIPYEVINGLFRRPDRVDAFNKVAVTQLPCGSG 330

Query: 189 NAWSNSLN 196
           NA S S +
Sbjct: 331 NAMSISCH 338

>Suva_8.224 Chr8 complement(402084..403958) [1875 bp, 624 aa] {ON}
           YOR171C (REAL)
          Length = 624

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 49/124 (39%), Gaps = 11/124 (8%)

Query: 72  ILNSDYE--KNNTKLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSI 129
           IL   YE  K N  +++I + + G G+ K    +     PIL +   K E+  T      
Sbjct: 220 ILEKSYENSKRNRNVLVIINPYGGKGKAKT--LFLTKARPILLESGCKIEIAYTKYARHA 277

Query: 130 KSFANNFSIKTKDTTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKIN-LNILTIPMGTA 188
              A +  I   DT      +   SGD    E  N L  +  +    N L +  +P G+ 
Sbjct: 278 IDIAKDLDISKYDT------IACASGDGIPYEVINGLYRRPDRVEAFNKLAVTQLPCGSG 331

Query: 189 NAWS 192
           NA S
Sbjct: 332 NAMS 335

>TDEL0A02270 Chr1 (412289..413257) [969 bp, 322 aa] {ON} Anc_2.451
           YKL120W
          Length = 322

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 11/63 (17%)

Query: 64  ILTTSKDLILNSDYEKNNTKLIIIDSTHSGLGRNKENDFYAIIMEP---ILSKL-NIKFE 119
           I  T+K  +LN D  K+ T L +  ST SGLG        A++M P   IL+++ N K +
Sbjct: 210 IYNTAKHFLLNHDIMKDGTGLHLTASTISGLG-------VAVVMNPWDVILTRIYNQKGD 262

Query: 120 LFK 122
           L+K
Sbjct: 263 LYK 265

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,606,275
Number of extensions: 2385301
Number of successful extensions: 8040
Number of sequences better than 10.0: 63
Number of HSP's gapped: 8282
Number of HSP's successfully gapped: 63
Length of query: 451
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 338
Effective length of database: 40,524,141
Effective search space: 13697159658
Effective search space used: 13697159658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)