Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E050405.702ON1973197383850.0
NCAS0A032005.702ON1788163620220.0
SAKL0E14916g5.702ON1779174419470.0
TDEL0B021905.702ON1810161017510.0
ZYRO0G06600g5.702ON1820171917140.0
YKR095W (MLP1)5.702ON1875177716730.0
Suva_11.3315.702ON1898171216680.0
KLTH0E01056g5.702ON1771163016410.0
Skud_11.3345.702ON1885171116430.0
Smik_11.3585.702ON1878171815970.0
CAGL0G02497g5.702ON1780161415231e-178
Ecym_40185.702ON1769125014711e-171
Kwal_55.196975.702ON1760157114511e-168
AFR286W5.702ON1758160414411e-167
KLLA0A00594g5.702ON1748134012821e-145
TBLA0E017305.702ON1820161511111e-123
NCAS0G002305.702ON173515087994e-85
KAFR0D022205.702ON167412457405e-78
Skud_9.195.702ON168014916181e-63
KNAG0C065905.702ON165114126092e-62
Suva_9.395.702ON168212985189e-52
Kpol_1043.705.702ON13219414846e-48
YIL149C (MLP2)5.702ON167915624848e-48
KAFR0H002105.702ON145411274241e-40
NDAI0F002905.702ON15544733952e-37
KNAG0L021405.702ON16082123272e-29
TPHA0E002305.702ON12847052843e-24
Smik_9.205.702ON16821741742e-11
TPHA0D046105.702ON11831021671e-10
Kpol_2001.755.702ON1006641080.001
Skud_4.6255.414ON9473931030.004
Kpol_1031.155.414ON929250940.047
Kwal_56.226183.106ON740241860.33
ZYRO0C11066g5.267ON1918174850.55
NDAI0H023102.454ON60898840.60
YEL043W1.487ON956149840.69
Suva_5.261.487ON967356830.92
Smik_5.501.487ON958149782.9
Smik_4.7723.86ON1012125783.0
TDEL0E020805.416ON579115773.4
AER045C4.238ON1292237774.7
Skud_4.152.16ON790265765.7
AFR494W4.134ON85362757.0
NDAI0B042002.175ON28452738.0
Kpol_479.38.604ON795173748.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E05040
         (1973 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...  3234   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   783   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   754   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   679   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   664   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   649   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   647   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   636   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   637   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   619   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   591   e-178
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   571   e-171
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   563   e-168
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   559   e-167
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   498   e-145
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   432   e-123
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   312   4e-85
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   289   5e-78
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   242   1e-63
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   239   2e-62
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   204   9e-52
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   191   6e-48
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   191   8e-48
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   167   1e-40
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   156   2e-37
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   130   2e-29
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   114   3e-24
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...    72   2e-11
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    69   1e-10
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    46   0.001
Skud_4.625 Chr4 (1115049..1117892) [2844 bp, 947 aa] {ON} YDR356...    44   0.004
Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON} (38596....    41   0.047
Kwal_56.22618 s56 complement(207409..209631) [2223 bp, 740 aa] {...    38   0.33 
ZYRO0C11066g Chr3 (851369..857125) [5757 bp, 1918 aa] {ON} simil...    37   0.55 
NDAI0H02310 Chr8 (560510..562336) [1827 bp, 608 aa] {ON} Anc_2.4...    37   0.60 
YEL043W Chr5 (70478..73348) [2871 bp, 956 aa] {ON} Predicted cyt...    37   0.69 
Suva_5.26 Chr5 (46040..48943) [2904 bp, 967 aa] {ON} YEL043W (REAL)    37   0.92 
Smik_5.50 Chr5 (72674..75550) [2877 bp, 958 aa] {ON} YEL043W (REAL)    35   2.9  
Smik_4.772 Chr4 complement(1359469..1362507) [3039 bp, 1012 aa] ...    35   3.0  
TDEL0E02080 Chr5 complement(393303..395042) [1740 bp, 579 aa] {O...    34   3.4  
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    34   4.7  
Skud_4.15 Chr4 complement(23550..25922) [2373 bp, 790 aa] {ON} Y...    34   5.7  
AFR494W Chr6 (1327026..1329587) [2562 bp, 853 aa] {ON} Syntenic ...    33   7.0  
NDAI0B04200 Chr2 (1058568..1059422) [855 bp, 284 aa] {ON} Anc_2....    33   8.0  
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    33   8.2  

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score = 3234 bits (8385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1695/1973 (85%), Positives = 1695/1973 (85%)

Query: 1    MLGFQEPTTDSNKNPLSSATIAKVASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQ 60
            MLGFQEPTTDSNKNPLSSATIAKVASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQ
Sbjct: 1    MLGFQEPTTDSNKNPLSSATIAKVASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQ 60

Query: 61   IKISTELEVXXXXXXXXXXXXXXXXXXXXDSYESVCXXXXXXXXXXXXXXXXXXXNRDEL 120
            IKISTELEV                    DSYESVC                   NRDEL
Sbjct: 61   IKISTELEVTKKTNNTTIKKLKNELTELIDSYESVCKEKEDAYKKIAEEEEKKIDNRDEL 120

Query: 121  ESKLIQIHSLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLE 180
            ESKLIQIHSLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLE
Sbjct: 121  ESKLIQIHSLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLE 180

Query: 181  NENQDLKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLK 240
            NENQDLKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLK
Sbjct: 181  NENQDLKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLK 240

Query: 241  LQLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQ 300
            LQLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQ
Sbjct: 241  LQLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQ 300

Query: 301  QLIVVLQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELE 360
            QLIVVLQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELE
Sbjct: 301  QLIVVLQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELE 360

Query: 361  FKLRKSEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDL 420
            FKLRKSEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDL
Sbjct: 361  FKLRKSEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDL 420

Query: 421  ETELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVA 480
            ETELPT                             SLVSSELNQAQSRIQSIEQEIKLVA
Sbjct: 421  ETELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVA 480

Query: 481  KQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERL 540
            KQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERL
Sbjct: 481  KQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERL 540

Query: 541  TKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYN 600
            TKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSR             LTLQNYN
Sbjct: 541  TKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYN 600

Query: 601  SSLTAKIAALTKELETYKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQE 660
            SSLTAKIAALTKELETYKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQE
Sbjct: 601  SSLTAKIAALTKELETYKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQE 660

Query: 661  SKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKR 720
            SKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKR
Sbjct: 661  SKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKR 720

Query: 721  LNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRL 780
            LNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRL
Sbjct: 721  LNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRL 780

Query: 781  NEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSL 840
            NEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSL
Sbjct: 781  NEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSL 840

Query: 841  MEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKY 900
            MEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKY
Sbjct: 841  MEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKY 900

Query: 901  KAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEA 960
            KAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEA
Sbjct: 901  KAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEA 960

Query: 961  AFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTK 1020
            AFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTK
Sbjct: 961  AFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTK 1020

Query: 1021 GLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRT 1080
            GLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRT
Sbjct: 1021 GLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRT 1080

Query: 1081 EIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQ 1140
            EIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQ
Sbjct: 1081 EIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQ 1140

Query: 1141 ANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRAT 1200
            ANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRAT
Sbjct: 1141 ANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRAT 1200

Query: 1201 DLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVE 1260
            DLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVE
Sbjct: 1201 DLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVE 1260

Query: 1261 NLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLA 1320
            NLHDK                 KDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLA
Sbjct: 1261 NLHDKLLPLETELQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLA 1320

Query: 1321 EERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELL 1380
            EERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELL
Sbjct: 1321 EERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELL 1380

Query: 1381 SQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEE 1440
            SQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEE
Sbjct: 1381 SQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEE 1440

Query: 1441 NLNSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKXXXXXXX 1500
            NLNSEI              AHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMK       
Sbjct: 1441 NLNSEIKKLQEESSKLQEELAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKQSFEEEK 1500

Query: 1501 XXXXXXXXXXFKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEA 1560
                      FKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEA
Sbjct: 1501 IKFIEEQTTEFKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEA 1560

Query: 1561 EENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQ 1620
            EENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQ
Sbjct: 1561 EENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQ 1620

Query: 1621 EELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVS 1680
            EELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVS
Sbjct: 1621 EELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVS 1680

Query: 1681 TDNETKYEGSDKKPVTINTNVVSDVGENNAERTPMNKFPRAIMNPLLSNGEHXXXXXXXX 1740
            TDNETKYEGSDKKPVTINTNVVSDVGENNAERTPMNKFPRAIMNPLLSNGEH        
Sbjct: 1681 TDNETKYEGSDKKPVTINTNVVSDVGENNAERTPMNKFPRAIMNPLLSNGEHLNLILNPS 1740

Query: 1741 XXXXXXXXXXRNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFTSPFQLSTTTAT 1800
                      RNV                                 PFTSPFQLSTTTAT
Sbjct: 1741 SSSLQPSPSNRNVGGTTTTTTTTNNNNNNNNNNKNKNNSGSGGNNNPFTSPFQLSTTTAT 1800

Query: 1801 IPQSVVQPTFSFGSNVNTXXXXXXXXXXXXXXXXEDLVYDXXXXXXXXXXXXXXXXXXXX 1860
            IPQSVVQPTFSFGSNVNT                EDLVYD                    
Sbjct: 1801 IPQSVVQPTFSFGSNVNTSGNSNADDNSNSNNAGEDLVYDSMRTSTSLASSESSARSSPE 1860

Query: 1861 XKNEDNNDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSQTKGLSFSLGNTPIATEEG 1920
             KNEDNND                               SSQTKGLSFSLGNTPIATEEG
Sbjct: 1861 SKNEDNNDENLGKKEQKEEEEREGNDEDNNNNNNNVSENSSQTKGLSFSLGNTPIATEEG 1920

Query: 1921 KGTEASLSLNLPMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDSNKRSKLE 1973
            KGTEASLSLNLPM                              SDSNKRSKLE
Sbjct: 1921 KGTEASLSLNLPMKRAVDEEAEEEKDREVRKGEDEDKEGKGDESDSNKRSKLE 1973

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/1636 (35%), Positives = 937/1636 (57%), Gaps = 96/1636 (5%)

Query: 117  RDELESKLIQIHSLEENVSELQSKKQELIKSLDDRITELNEYRHNIEL-LNNEKSKTRNK 175
            RD L ++L +I   +E    LQ + Q+ IK LD +I++ NE    + L L N+  ++  K
Sbjct: 112  RDNLRAELKEI---QEKFDNLQKQNQDTIKLLDRKISQ-NEVEKELTLKLTNQYRESTAK 167

Query: 176  ILQLENENQDLKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINE 235
               LE+E Q LK ND    T + +LSQ+L++I++ K  LE  L  K ++   Y      E
Sbjct: 168  CHDLEDEIQSLKYNDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAE 227

Query: 236  NQDLKLQLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKE 295
             Q L+ +++T++N    +KS N  L++    +S+ L + S+ ++ +    N +K   +KE
Sbjct: 228  IQTLRKKISTLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKE 287

Query: 296  LTLKQQLIVVLQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQER 355
            L+LKQ++I VLQ+Q+ +LQ                      D+TR +N  +  + + +ER
Sbjct: 288  LSLKQEMIDVLQTQVQKLQ---------------------DDYTRILNTKQPIVQNDEER 326

Query: 356  NVELE----------FKLRKS-EDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQS 404
            N+E+E           +L K  E+   ++  T S  L N   +  +D+D +KK+L  E+ 
Sbjct: 327  NLEVEELKQKLIETETQLNKELEERRNITMQTESSTLSN---QQQEDLDTIKKELIQERY 383

Query: 405  QRENFEKNLEEFMDDLETELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQ 464
            Q+E  +  +E F+ +LE ++PT                             + V++EL+ 
Sbjct: 384  QKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDA 443

Query: 465  AQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDE 524
             +   +S++ E K + KQR+DLA+QLQ+ L+H SV NDS GPL+ EEV+FI++I+  D+E
Sbjct: 444  LRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDIL--DNE 501

Query: 525  MHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXX 584
             +++ +D+Q+VISERL  F++I+ELQQKN++LLK+ RELA KLE +++ +Q+        
Sbjct: 502  SNEESSDSQQVISERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQ 561

Query: 585  XXXXXXXXXLTLQNYNSSLTAKIAALTKELETYKVLSNTEDSSTPADFDKQREQREIEHT 644
                     ++LQ+YN+ L  KI  L  EL+ YK L    D+    +  +  E    E+T
Sbjct: 562  AIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPKP-DTKVETEHLRLNE----ENT 616

Query: 645  QLVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQ 704
             L+KELETR+A+  +ES +    LN++I  +   ++    E   E+++++LAE+RLKL+Q
Sbjct: 617  DLIKELETRLATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQ 676

Query: 705  KSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIK 764
             S+ ++  ENE+LQKRL  L+++ ++QD+RT ET+   +  +  L+  +N+ N  Q+++ 
Sbjct: 677  NSLSLSKVENEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLN 736

Query: 765  LLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQ-------DKFNKELN 817
            +  ++E+ LK+++T +++E+N +K LV++LQ+LQ+ERE + ++T+       D   +EL 
Sbjct: 737  ISKTNEKSLKDDITIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELY 796

Query: 818  DLEGTCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKER 877
            D+     +  +++KE E N  S +E      D  ++K+ + ++E+  +EK  +EI E   
Sbjct: 797  DISEKLKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDEL--LEK-TNEIGELNY 853

Query: 878  ETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESY 937
            E K    +L K L+     +  YK  ++ +    ++ +LQ EL+  K  L+E+Y++ + Y
Sbjct: 854  EIK----KLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQY 909

Query: 938  RKDIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQ 997
            ++      + + +    V   +  F  +I  ++  ++ + D+ ++L  QI DLNNEL+ Q
Sbjct: 910  KQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQ 969

Query: 998  KKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQE 1057
             K + +EK   ++  NEL      +E+    YE KL +L  DLE+Q  YAN AQNNYEQE
Sbjct: 970  NKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQE 1029

Query: 1058 LQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFF 1117
            LQ HA ++KTISQLRE    YR ++  +  +AT  + LL +N+  W++QR  YE QI   
Sbjct: 1030 LQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHAL 1089

Query: 1118 KKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLN 1177
            KKRIE+ S QNK+LF+Q  L +++ +  N +SS       +  LVLSLRS+RD+LQ RL+
Sbjct: 1090 KKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSAT----PNEDLVLSLRSDRDILQTRLS 1145

Query: 1178 VTEAEEKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRES 1237
            VTE E K LR +L+S+  +   T  +L +I+++  N    +E+H  +M+QL QL+LLRES
Sbjct: 1146 VTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQLNLLRES 1205

Query: 1238 NITLRNETIELQSKNQHLQTEVENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERW 1297
            NITLRNE  + + K + LQ ++E L +K                  ++QL+   EE  RW
Sbjct: 1206 NITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRW 1265

Query: 1298 KQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNA 1357
            KQRSQDIL+K+++IDPVEHE L  E   L+  L +K KENEEL +RF ++KKQAHE+LN+
Sbjct: 1266 KQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNS 1325

Query: 1358 SKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEA 1417
            SK +Q +L  QI  LE +   + S LETE+    + E++     K S D+ +++SQLEEA
Sbjct: 1326 SKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEA 1385

Query: 1418 LMKSKDFETKFINSVESSKQIEENLNSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQ 1477
            L+ SK+FE KF  SV+SS +I  +LN  I               +E   T   ++ NV  
Sbjct: 1386 LLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNNEATVTGQPDLSNV-- 1443

Query: 1478 DTVDGGVSNDIVESMKXXXXXXXXXXXXXXXXXFKKKLQAEINKLKAEY---ETKQIEPV 1534
                       VE MK                 FK+KL  E+ +++A+    + K + P+
Sbjct: 1444 -----------VEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNVTPL 1492

Query: 1535 SIDENAIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNK 1594
              D +A R+Q E+EYE+   +RI++AEENLKRRIRLPTEEKIN VI K++ +LE E+  K
Sbjct: 1493 Q-DISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEK 1551

Query: 1595 VEARAKELLTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLE 1654
            V  RAKELL+ +E   F + +K +I++EL R  ++EL+  K KAF+EG+QQ +MKT+FLE
Sbjct: 1552 VNQRAKELLSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLE 1611

Query: 1655 KKITKLESDLQNAKSNTGATDNTIVSTDNETKYEGSDKKPVTINTNVVSDVGENNAERTP 1714
            KKI+KLES LQ + +          + +N+   E   K P   + N V    E    +  
Sbjct: 1612 KKISKLESQLQGSNA----------ANENKNDVEVLLKTPS--DENNVPSKQEETLSKPQ 1659

Query: 1715 MNKFPRAIMNPLLSNG 1730
            ++K    I NPLLS G
Sbjct: 1660 LSKI--QIANPLLSTG 1673

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/1744 (32%), Positives = 973/1744 (55%), Gaps = 50/1744 (2%)

Query: 7    PTTDSNKNPLSSATIAKVASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTE 66
            PTT S    +    +  ++SFL+     V TLD  +++ L+ + ++F  ++ + +K S  
Sbjct: 7    PTTPS---VIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVT 63

Query: 67   LEVXXXXXXXXXXXXXXXXXXXXDSYESVCXXXXXXXXXXXXXXXXXXXNRDELESKLIQ 126
            L+                     ++ ES+                       E+     Q
Sbjct: 64   LDELKSSSERRSEAFKLQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQ 123

Query: 127  IHSLEENVSELQSKKQELIKSLDDRITELNEYRHNI-ELLNNEKSKTRNKILQLENENQD 185
            +  L++     +S KQ++++ L+++I +L   +    +LL N K+  R ++L+LENE Q 
Sbjct: 124  LTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKT-LRKQVLELENEVQT 182

Query: 186  LKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNT 245
             K NDL  + +++RL+QE+  +     WLE+ L  K E+F SYR++  +E Q    +LN+
Sbjct: 183  FKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNS 242

Query: 246  VKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVV 305
            +++EL+  +S++  L+ R ++LS +L+D  T LK+++ S + +K    +E+TLKQ+LI +
Sbjct: 243  IRSELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDL 302

Query: 306  LQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFK--- 362
            L+ Q+   + E  +  + +VS++     +      E+ + K +L   + + V+LE     
Sbjct: 303  LEKQIESFKTELESARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETVDE 362

Query: 363  -LRKSEDYTAVSNSTSSDDLRNSL-AKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDL 420
             L    +  A + S  S D +NS+  K + DI +LKK+L  E+ Q+E  +  +E F+ +L
Sbjct: 363  LLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLEL 422

Query: 421  ETELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVA 480
            E ++P                                   EL   +S+I   E +I  + 
Sbjct: 423  EHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLV 482

Query: 481  KQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERL 540
            +QRSDLA+Q+Q  L+  SV NDS GPLT EE  FI+ II   +     E D Q++ISERL
Sbjct: 483  RQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSE--SPVEQDAQRIISERL 540

Query: 541  TKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYN 600
             +F+ ++ELQ+KNMELL + R LA KLE E+K  +++                LTLQ YN
Sbjct: 541  VRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYN 600

Query: 601  SSLTAKIAALTKELETYKVLSNTEDSS-TPADFDKQREQREIEHTQLVKELETRIASIIQ 659
             SL +++  + KE + +K+L++ + +S  P++ +    +  +   + +KELE  ++S+ +
Sbjct: 601  KSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTE 660

Query: 660  ESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQK 719
            ES +N  +LN++I +L       S+ L +E+S++ LAE+R KL+  +++MT  EN+ L+K
Sbjct: 661  ESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRK 720

Query: 720  RLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTR 779
            R +SL+  +++QD +T +TI SLI  +S+L+ ++++ N SQ+E  LL S +E LK E   
Sbjct: 721  RFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENES 780

Query: 780  LNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGS 839
            L+EE+N+M++L+T+LQTLQ+ERE LL  TQ  F  + N LE   +D  +KL    +    
Sbjct: 781  LSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISD 840

Query: 840  LMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEK 899
             +      +  +++K   L EE++N  ++ S  +   +  + +   L  +L+E    I+ 
Sbjct: 841  YISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQA 900

Query: 900  YKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKE 959
            + A +  E    +  +L++EL+  + +L ++YSQ E Y+   +   +S   I   +   +
Sbjct: 901  FNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSK 960

Query: 960  AAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVT 1019
            A + E+I  +   ++   D   +LK QI +LNNEL  QK  +E +  ++TRN  +L+   
Sbjct: 961  AEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQ 1020

Query: 1020 KGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYR 1079
              L+  K +YE K+  + +DL +Q  YAN AQ NYEQELQ HA+VSK IS LR + Q Y+
Sbjct: 1021 SELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYK 1080

Query: 1080 TEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTT 1139
            +E   L  +A +AK+ L ++++SW+KQ  +YE ++    +RIE+ + Q+K+L++Q    +
Sbjct: 1081 SETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLS 1140

Query: 1140 QANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRA 1199
            +     + +   + S E  N L+ SLR E+D+L+ +L V+  EEK+LR++L  IE D   
Sbjct: 1141 KGKPTSSEDLMPI-STETRN-LLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEG 1198

Query: 1200 TDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEV 1259
            + +EL K++         L+  + +M+QL QL+LLRESNITLRNE  +   +++ L+ E+
Sbjct: 1199 SRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAEL 1258

Query: 1260 ENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENL 1319
            + L+ K                 KD Q+S+ +EE+ERWKQRSQDIL KY+RIDP EH+ L
Sbjct: 1259 DALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKL 1318

Query: 1320 AEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKEL 1379
            A++ + LQ +++ KS ENEEL  RF++LK+QAHEKLNA+K +Q++LT Q+NDL+A K++L
Sbjct: 1319 ADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKL 1378

Query: 1380 LSQLETEKEGKLSLEKRLEVTMKN-SHDIVSIQSQLEEALMKSKDFETKFINSVESSKQI 1438
             + L ++KE   +LE ++    KN S +   +Q QLE +  K  + E K      SS  +
Sbjct: 1379 ENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALL 1438

Query: 1439 EENLNSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKXXXXX 1498
            E+ LN  I                EK  T +   G+   + V+   ++ IVE++K     
Sbjct: 1439 EKELNERIESLMNKIKLLEEDL--EKAKTESPNDGSQSSELVEN--TSKIVENLKIEFEE 1494

Query: 1499 XXXXXXXXXXXXFKKK--------LQAEINKLKAEYETKQIE-PVSIDENAIRKQIEEEY 1549
                         +++        L+A+  +L+ +  T++++ PV+IDE  I+K+ EEEY
Sbjct: 1495 EKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDE--IKKKWEEEY 1552

Query: 1550 EQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKEL-----LT 1604
            EQ TSQRI+E+ E LK+RIRLPTEEKINK+++K+R +LE EF+  V+ +A+E+      +
Sbjct: 1553 EQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSAS 1612

Query: 1605 GDEKNEFFDRMKKEIQ---EELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLE 1661
                 E  ++ K++++   +E+ +K++E++  +KK+AF+EG+QQ  MK++FLEKKI KLE
Sbjct: 1613 NSNSTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLE 1672

Query: 1662 SDLQNAKSNTGATDNTIVSTDNETKYEGSDKKPVTINTNVVSDVGENNAERTPMNKFPRA 1721
            + ++       A D+ I   DN +    ++  P T +   ++ +  N A   P    P  
Sbjct: 1673 TQIK-------AHDSAIPINDNSSAT-PAESGPTTQDVKQLTPILNNQAAILPGKPLP-- 1722

Query: 1722 IMNP 1725
              NP
Sbjct: 1723 -FNP 1725

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/1610 (33%), Positives = 881/1610 (54%), Gaps = 60/1610 (3%)

Query: 137  LQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQ 196
            L+S KQE++K L+++I+EL   +   + L N+    R ++++ +NE Q LK N L  +++
Sbjct: 135  LKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSE 194

Query: 197  LERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKST 256
            LE + Q++  + K   WLE+ +  K EQ   YR+++  E Q    ++  +KN+    KS+
Sbjct: 195  LEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSS 254

Query: 257  NCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRE 316
               L ++  E+S  L++    +K +    N +K    +E++LKQ+L+ +   QL   + E
Sbjct: 255  REFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEE 314

Query: 317  NGNELSLT---VSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAVS 373
                L LT    + T + + + +   R ++DL      ++E N E   +LR      AV 
Sbjct: 315  ----LRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHE---RLR----LQAVV 363

Query: 374  NSTSSD----DLRN----SLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELP 425
            N    D    DL +    S+ K Y DI VLKK+L  E+ Q+EN ++ +E F+ +LE ++P
Sbjct: 364  NEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVP 423

Query: 426  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVAKQRSD 485
                                             + EL  A  +I+ +E     + +QRSD
Sbjct: 424  VINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSD 483

Query: 486  LANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKD 545
            LA Q+QF L + ++ NDS GPLT +EV FI+ II  ++E    E+D+Q +I+ERL +FKD
Sbjct: 484  LARQVQFLLFNGTLQNDSRGPLTADEVAFIKKII--ENENPSNESDSQSIITERLVEFKD 541

Query: 546  IIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYNSSLTA 605
            I  LQ++N ELLKT R LA +LEEE+K                     +TLQ  NS + +
Sbjct: 542  IATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIES 601

Query: 606  KIAALTKELETYK-VLSNTEDS-STPADFDKQREQREIEHTQLVKELETRIASIIQESKE 663
            K++ + KE + YK +LS T  S     D D+ ++ +E  + +L+K LE +++++  E+ +
Sbjct: 602  KVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQE--NQELIKSLEDKLSTLTTETSK 659

Query: 664  NANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNS 723
            N  +LN +I  L +    ++I   +E+S++ LAE+RLKLLQ +++MT  EN  L +R + 
Sbjct: 660  NNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHE 719

Query: 724  LRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEE 783
            L++++ +Q+ R  ET+N  I  +S+L+ +E +      E  LL SS + L+ E+ +++ E
Sbjct: 720  LQSILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVE 779

Query: 784  KNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLMEE 843
            +NS+ L+VT+LQTLQSERE+LL  +Q      +  LE   ++L+ ++  +++N     E+
Sbjct: 780  RNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEIS-SKDNEIKASED 838

Query: 844  TTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKER---ETKWENTRLTKQLKEKTELIEKY 900
                +  + Q+K  + E  S+  K   E+  K     + + E   L K+++E    I  Y
Sbjct: 839  AKRAQTKWFQEK--IDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASY 896

Query: 901  KAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEA 960
            K  +D          L+K+L+    EL  +YSQ E +++      +++ +++ +   +  
Sbjct: 897  KTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTE 956

Query: 961  AFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTK 1020
            A K    +    K  +    + LK  ID LNNE  +QK   E+EK    +    LE    
Sbjct: 957  ALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEH 1016

Query: 1021 GLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRT 1080
             L Q K++Y+ KL  L KDLE+Q  YAN AQ NYE+ELQ HA VSK ISQLR + Q  R+
Sbjct: 1017 SLGQVKKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRS 1076

Query: 1081 EIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQ 1140
            EI +L  S   AK +L   + SW  Q+ E +  I+  K++++  S QNK+LF Q +L ++
Sbjct: 1077 EIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSK 1136

Query: 1141 ANDE-DNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRA 1199
            +  E +N        + G ++L++SLR ERD+L+ +L V++ EEKLL ++  ++E +   
Sbjct: 1137 SEREFEN------KLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAE 1190

Query: 1200 TDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEV 1259
               +L K++E   N+ D+ +QH+ +M QL Q++LLRESN+TLRN     Q KN  LQ+E+
Sbjct: 1191 ARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSEL 1250

Query: 1260 ENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENL 1319
             +L  K                 KD+++ +  +E++RWK+RS DIL ++++IDP E+  L
Sbjct: 1251 NHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKL 1310

Query: 1320 AEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKEL 1379
             EE + L+ +LE KSKEN +L +RF +LKKQAHEKLNASKI+Q +L+ ++N+L+  K ++
Sbjct: 1311 EEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKM 1370

Query: 1380 LSQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIE 1439
               L+  +   L+LEK L      S +   ++ +L++AL + K+ E K   +V SS+ + 
Sbjct: 1371 EEILKETQTKVLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLT 1430

Query: 1440 ENLNSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKXXXXXX 1499
              LN EI                EK   ST E           G+SN +VESMK      
Sbjct: 1431 SQLNEEINSLKEQVRIFK-----EKENDSTLEGSQ--------GLSN-VVESMKKAFEEE 1476

Query: 1500 XXXXXXXXXXXFKKKLQAEINKLKAEYETKQIEPVSI-DENAIRKQIEEEYEQATSQRIK 1558
                       + KK + E  KL +E  +   EPVS  D N+++KQ EEEYE  + QRI+
Sbjct: 1477 KIKFIQEKTEEYNKKFEEEKAKLSSENGSP-AEPVSAPDVNSLKKQWEEEYEAISQQRIQ 1535

Query: 1559 EAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKE 1618
            EAEENLK+RIR+PTEE+I KV+DKR+T+LE EFQ +++    +   GD K    + +KK+
Sbjct: 1536 EAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQPEGGDAKER--EELKKQ 1593

Query: 1619 IQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTI 1678
            ++ E   KY+E L   KKKAF+EG+QQ  MK++ LE+KI+KLES L N+ +N        
Sbjct: 1594 LESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQL-NSSNNPTPEKAAA 1652

Query: 1679 VSTDNETKYEGSDKKPVTINTNVVSDVGENNAERTPMNKFPRAIMNPLLS 1728
             S    TK + S  + +   T    +     +++   +  P +  NP  S
Sbjct: 1653 TSVGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTS 1702

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/1719 (31%), Positives = 923/1719 (53%), Gaps = 70/1719 (4%)

Query: 8    TTDSNKNPLSSATIAKVASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTEL 67
            T+  N N +S   + K+++F     D +  +D  IL  L N+  +FN ++++ ++++  +
Sbjct: 13   TSGDNHNDVS---LGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTI 69

Query: 68   EVXXXXXXXXXXXXXXXXXXXXDSYESVCXXXXXXXXXXXXXXXXXXXNRDELESKLIQI 127
            +                        +S+                     ++E+ES   ++
Sbjct: 70   DEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKL 129

Query: 128  HSLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLK 187
              L++    L+  K+E++  L+++I EL  +R       ++  + R ++L+LE   Q+LK
Sbjct: 130  SDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLK 189

Query: 188  INDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVK 247
              +L  +++++ ++Q L  + K   WLEE +  K EQ  S R K+ +E   L  +  + K
Sbjct: 190  SKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCK 249

Query: 248  NELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQ 307
            NEL   KS N V+  + +EL+  L++    +K++  S   +K     E+++KQ+LI +L+
Sbjct: 250  NELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLE 309

Query: 308  SQLNELQRENGNELSLTVSDTASSSRKDSD---FTREINDLKNQLNHVQERNVELEFKLR 364
            +Q+  LQ E    L     +  +S  ++++     +E+  LK      +   + LE  ++
Sbjct: 310  NQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITLKENFEESERERLRLEALVQ 369

Query: 365  K------SEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMD 418
            +      S+D   ++N++S   LRN    +  D+ +LKK+L  E+ Q+E  ++ +E F+ 
Sbjct: 370  ELIPGDDSQD--DINNTSSFISLRNK-DSSLRDMGILKKELIKERHQKERLQRQVESFIV 426

Query: 419  DLETELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKL 478
            +LE ++P                                   E      +++  E  I  
Sbjct: 427  ELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHT 486

Query: 479  VAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISE 538
            + +QR+DLA+Q+QF L++ SV  DS G L+ EEV FI+ I+  DD   + E+D+Q+VISE
Sbjct: 487  LTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDD--PNSESDSQRVISE 544

Query: 539  RLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQN 598
            RL +F +I  LQ+KNMELLKT R+LA KLE E+K    +                ++LQ+
Sbjct: 545  RLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQD 604

Query: 599  YNSSLTAKIAALTKELETYKVLSNTEDSSTPADFDKQREQREIEHT---QLVKELETRIA 655
            YN++L +K+  LTKE + +K + +   S           Q     +   + ++ LE R+ 
Sbjct: 605  YNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLT 664

Query: 656  SIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENE 715
            S+  ES +N  +LN++I  L      ISIEL +E+S+K L EERLKL+Q ++++T  EN+
Sbjct: 665  SLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQ 724

Query: 716  RLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKN 775
            +L KR  +L+++   QD RT ET+N LI   S+LA +E K    + E +LL SSE   + 
Sbjct: 725  QLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRE 784

Query: 776  ELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKL----K 831
               +L+EE+NS++++V++LQTLQSERE  L   Q  + + L+ LE    D R +L    K
Sbjct: 785  NYLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTK 844

Query: 832  EAEENYGSLMEETTELKDDFRQKK--------KSLKEEMSNVEKRYSEIVEKERETKWEN 883
            EAE+     ME +   +  + Q K        + LK+E+   + +   + + E E +   
Sbjct: 845  EAED-----MENSKRTQIQWYQDKLDSVVAESQHLKQEL---QTKTFLVTDLESEVR--- 893

Query: 884  TRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIEL 943
             +L KQ++E    I+ Y+  S  E +    SSL+KEL+  K  L+++Y++ + Y+  +  
Sbjct: 894  -KLEKQVEESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLST 952

Query: 944  LNQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYED 1003
              +S++ + +   + +   + ++  ++  K+ + D    L   +  L   L+   K  E+
Sbjct: 953  TEESLSQLTQDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAEN 1012

Query: 1004 EKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHAN 1063
            EK    +    LE  +KG  Q K +Y+ ++  L +DLE+Q  +AN+AQ NYE+ELQ  +N
Sbjct: 1013 EKNTLQKKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSN 1072

Query: 1064 VSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEE 1123
            VSKTIS+LREQ+Q  R  I  L  S    +++L +N+ SW  Q++EYE+Q+E  ++ +E+
Sbjct: 1073 VSKTISELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLED 1132

Query: 1124 ESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLS-LRSERDLLQERLNVTEAE 1182
             S QN +L++Q +L ++ N      S GVN    + + +L+ LR ERD+L  +L V++ E
Sbjct: 1133 LSTQNSLLYDQIELFSKDN------SDGVNGETAEVREILTNLRRERDILGTKLTVSQRE 1186

Query: 1183 EKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLR 1242
            E+ LR  L S+E +   T  +L + ++E   + +L+ QH+ ++ QL QL+LLRESNITLR
Sbjct: 1187 EQTLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLR 1246

Query: 1243 NETIELQSKNQHLQTEVENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQRSQ 1302
            N   E   KN+ LQ E+  L ++                 KD+QL++  EE+ RWK+RSQ
Sbjct: 1247 NAAEEENKKNRELQEELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQ 1306

Query: 1303 DILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQ 1362
            +IL K+ RIDP +H+ L E+ + L+ +L+E +KEN+EL +RF +LKKQAHEKLN+SKI+Q
Sbjct: 1307 EILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQ 1366

Query: 1363 NSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSK 1422
             +L+ Q+N+L   K EL  + E E+     L++RL     ++  + S+Q +L +AL  S+
Sbjct: 1367 TTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSR 1426

Query: 1423 DFETKFINSVESSKQIEENLNSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDTVDG 1482
            + E     +++ +++I + LN EI              A        T  G + +D    
Sbjct: 1427 ELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSA-------ATAKGEISED---- 1475

Query: 1483 GVSNDIVESMKXXXXXXXXXXXXXXXXXFKKKLQAEINKLKAEYETKQIEPVSIDENAIR 1542
             +SN +VESM+                  KK  + E + L+      Q +PV+ +E  I+
Sbjct: 1476 -LSN-VVESMRRSFEEEKINFLKEKTEELKKL-EEEKHTLQVNGNEPQQQPVNYEE--IK 1530

Query: 1543 KQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKEL 1602
            +Q E E E++  +RI EAEENLK+RIRLPTEE+I +V++K++  LE  ++ K+E     L
Sbjct: 1531 RQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESKSSL 1590

Query: 1603 LTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLES 1662
             + D  N     +KK+++++L  K+E E+Q VKKKAF+EG+QQ  MK++ LE+KI+KLES
Sbjct: 1591 ESSDGNN---SDLKKQLEKDLQEKFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLES 1647

Query: 1663 DLQNAKSNTGATDNTIVSTDNETKYEGSDKKPVTINTNV 1701
             L     +   + +   S          D+K VT N +V
Sbjct: 1648 QLHGKVDSPDKSSSETSSVPKPNLPSKIDEKSVTTNQSV 1686

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/1777 (31%), Positives = 936/1777 (52%), Gaps = 157/1777 (8%)

Query: 24   VASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVXXXXXXXXXXXXXX 83
            +ASF   S + V++ D  ++K LN++  +FN +++E +K++   +               
Sbjct: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKT 83

Query: 84   XXXXXXDSYESVCXXXXXXXXXXXXXXXXXXXNRDELESKLIQIHSLEENVSELQSKKQE 143
                     + +                       ELE    ++  L E   E QS +Q 
Sbjct: 84   EMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEEKKETQSNQQR 143

Query: 144  LIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLSQE 203
             +K LD+R+ E+   R      N+E  K R+ I+ LE + Q    NDL+ RT+LER +QE
Sbjct: 144  TLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTELERKTQE 203

Query: 204  LETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQER 263
            L  +     WLE+ L  K EQ+ SYR+K+     D++ +LN ++N+    ++ N VL+++
Sbjct: 204  LTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNNDVLKQK 263

Query: 264  TDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENG----- 318
             +ELS  L++    +K +  S N++K     E++LKQ+L+ +L+SQLN ++ E       
Sbjct: 264  NNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELNSIREL 323

Query: 319  NELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAVSNSTSS 378
            N   +   D+   + ++ D  +E+   K +L   ++  + L          +++++    
Sbjct: 324  NTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRL----------SSITDEADE 373

Query: 379  DDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTXXXXXXXXXXXX 438
            D+  N  AK+  D   LKK+L  E+  +E+ +  +E F+ +LE ++P             
Sbjct: 374  DN-ENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINSFKERTDMLE 432

Query: 439  XXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNS 498
                             +    ELN    ++   E +++ + KQR DL  Q+Q+ L+ NS
Sbjct: 433  NELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQIQYLLITNS 492

Query: 499  VANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLK 558
            V+NDS GPL  EE++FI+NI+QEDD     E+D+QKV++ERL +FK+II+LQ+KN ELLK
Sbjct: 493  VSNDSKGPLRKEEIQFIQNIMQEDDSTI-TESDSQKVVTERLVEFKNIIQLQEKNAELLK 551

Query: 559  TTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYNSSLTAKIAALTKELETYK 618
              R LA KLE ++K  +    +             +TL++    L ++I  L KELE  K
Sbjct: 552  VVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRIEELQKELEELK 611

Query: 619  VLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQESKENANILNDKIFALDEK 678
                 ED+S      KQ  + + +    V++L+TRI+ I +ES EN ++LN +I  L + 
Sbjct: 612  TSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLLNKEIQDLYDS 671

Query: 679  NNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHET 738
             + ISI+L +EKS++ LAEER KLL  ++D+T  EN++L+KR + L+N +++QD +THET
Sbjct: 672  KSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHET 731

Query: 739  INSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQ 798
            +N  +  +S+L+ VE +    + E KL    E+ LK EL +L+ EK+S++++VT+LQTLQ
Sbjct: 732  LNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSLRIMVTQLQTLQ 791

Query: 799  SEREHLLSTTQDKFNKELNDLEGTCNDLRKK-------LKEAEENYGSLME----ETTEL 847
             ERE LL  T+    K++++LE   ++L+K+       +K+ EE+  S +E    +   L
Sbjct: 792  KEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEAL 851

Query: 848  KDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRL-TKQLKEKTELIEKYKAASDD 906
            K D+     S+  + +++EK   ++   E+E + +  RL T  + ++T         +DD
Sbjct: 852  KKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDET--------INDD 903

Query: 907  EGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERI 966
                    SL+KEL+  K  LT++YSQ + Y+   E  +QS+   N ++      F  +I
Sbjct: 904  --------SLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQI 955

Query: 967  TEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSK 1026
              +   K ++ D  ++LK Q+ +LNNEL++QKK  E EK +F +  + L+   K +E  K
Sbjct: 956  KNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVK 1015

Query: 1027 RDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELT 1086
             +YE KL  +  DL++Q  YAN AQNNYEQELQ HA+VSKTIS+LREQ   Y+ ++  L 
Sbjct: 1016 SEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLN 1075

Query: 1087 ISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDN 1146
            +S    +  L EN+ SW  Q++   +Q++    RIE+ S QNK+L++Q ++ T A+ E N
Sbjct: 1076 LSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVN 1135

Query: 1147 AESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQK 1206
              ++G     G N ++++LR ERD+L  ++ V E + K+LR++++ ++ + +    +L  
Sbjct: 1136 NSTNG----PGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDN 1191

Query: 1207 IKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKX 1266
             + E  N+  +++QH  +M +L QL+LLRESNITLRNE     +K + LQ+E++ L    
Sbjct: 1192 SRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNV 1251

Query: 1267 XXXXXXXXXXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRL 1326
                            K+++L +  EE  RWK+RSQDIL K++++   ++E L  E   L
Sbjct: 1252 APIESELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENL 1311

Query: 1327 QAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETE 1386
            + +LE K ++  E   +F +L++QA E+L  SK+SQ+SLT Q+N L   K  L + L +E
Sbjct: 1312 KEELENKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSL-SE 1370

Query: 1387 KEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNSEI 1446
               ++   +  +V   N+  + +I+   E+A   S++ + K   S  S +     LN EI
Sbjct: 1371 ANARIEELQNAKVAQGNNQ-LEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEI 1429

Query: 1447 XXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKXXXXXXXXXXXXX 1506
                             + T++  +            +SN IVESMK             
Sbjct: 1430 TTLKEEIEKQRQIQQQLQATSANEQ----------NDLSN-IVESMK--------KSFEE 1470

Query: 1507 XXXXFKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEAEENLKR 1566
                F K+   E+N+   E + +  +P +I+   I+K+ E E+EQ  SQ+I+EAEE LK+
Sbjct: 1471 DKIKFIKEKTQEVNEKILEAQERLNQPSNINMEEIKKKWESEHEQEVSQKIREAEEALKK 1530

Query: 1567 RIRLPTEEKINKVID----------------------------------------KRRTQ 1586
            RIRLPTEEKINK+I+                                        +++ +
Sbjct: 1531 RIRLPTEEKINKIIERKKEELEKEFEEKVEERIKSMEQSGEIDVVLRKQLEAKVQEKQKE 1590

Query: 1587 LENEFQNKVEARAKEL-----LTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDE 1641
            LENE+  K++   K++     ++ DE+    D+++ EI+  L  ++  ELQ +KKK+FDE
Sbjct: 1591 LENEYNKKLQEELKDVPHSSHISDDER----DKLRAEIESRLREEFNNELQAIKKKSFDE 1646

Query: 1642 GRQQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVSTDNETKYEGSDKKPVTINTNV 1701
            G+QQ +MKT+ LE+K+ K+ES L                  +ETK + ++  P ++N NV
Sbjct: 1647 GKQQAMMKTTLLERKLAKMESQL------------------SETK-QSAESPPKSVN-NV 1686

Query: 1702 VSDVGENNAERTPMNKFPRAI-------MNPLLSNGE 1731
                      + P+   PR I        NPLLS GE
Sbjct: 1687 ----------QNPLLGLPRKIEENSNSPFNPLLS-GE 1712

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/1712 (32%), Positives = 908/1712 (53%), Gaps = 112/1712 (6%)

Query: 24   VASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVXXXXXXXXXXXXXX 83
            +ASF D S + V+++D  I+  LN++  +FN +++E I+I+  L+               
Sbjct: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSLKT 83

Query: 84   XXXXXXDSYESVCXXXXXXXXXXXXXXXXXXXNRDELESKLIQIHSLEENVSELQSKKQE 143
                     + +                      +ELES   ++  L E   E+QS +Q 
Sbjct: 84   EMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEEKKEIQSSQQR 143

Query: 144  LIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLSQE 203
             +K LD+R+ EL   +      ++E  K R+ IL+LE + Q    NDL+ ++QLER +QE
Sbjct: 144  TLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQE 203

Query: 204  LETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQER 263
            L  +   K WLE+ L  K +Q+ SYR+K+     +++  LN ++N+    K+ N VL+++
Sbjct: 204  LNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVLRQK 263

Query: 264  TDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSL 323
             +ELS  L++    +K +  S N++K     E+TLKQ+LI +L+SQLN ++ E  N    
Sbjct: 264  NNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNNTRES 323

Query: 324  TVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFK-LRKSEDYTAVSNSTSSDDLR 382
              SD  S   K      E   L   L   + + V+ E + LR S   +    +   D + 
Sbjct: 324  NYSDVNSDDSKQ--LISENEKLLKDLQLTKHKLVQCENECLRLS---SITEEAGKEDGIL 378

Query: 383  NSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTXXXXXXXXXXXXXXXX 442
             S  K+  D  +LKK+L  E+  +E+ +  +E F+ +LE ++P                 
Sbjct: 379  TS--KSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDTLENELN 436

Query: 443  XXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVAND 502
                         +    EL     ++   + EI +++KQR DL  Q+Q+ LV NSV+ND
Sbjct: 437  NAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSND 496

Query: 503  SAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRE 562
            S GPL  EE+KFI+NI+Q DD     E+D+QK+++ERL +F+DII+LQ+KN ELL+ TR 
Sbjct: 497  SKGPLRKEEIKFIQNILQNDDSAT-TESDSQKIVTERLVEFRDIIQLQEKNSELLRVTRN 555

Query: 563  LATKLEE-EDKIKQAEKSRXXXXXXXXXXXXXLTLQNYNSSLTAKIAALTKELETYKVLS 621
            LA KLE  E+K K   K+              LTLQ+    L +KI  L KE E +K  +
Sbjct: 556  LADKLESNENKSKNYLKN-IENETINEAKEAILTLQSQKVQLESKIHELEKEREKFKNWT 614

Query: 622  NTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNH 681
              +++S      +Q  + + E     ++L+ RI+ + +ES EN ++LN ++  L +  + 
Sbjct: 615  MDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSLLNKELQDLYDSKSS 674

Query: 682  ISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINS 741
            +SIEL REKS++ LAEER KLL  ++D+   EN++L+KR  +L+N + +QD +T ET+N 
Sbjct: 675  LSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLND 734

Query: 742  LIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSER 801
             +  +S+L+ +E + +  + E  L    E+ LK EL+ L+ EK S+ ++VT+LQTLQ ER
Sbjct: 735  YVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEKTSLHIMVTQLQTLQKER 794

Query: 802  EHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLMEETTELKDDFRQKK-KSLKE 860
            E+LL  T+     +++ L+   N+L+ +    ++ Y   +EE  + K ++ Q K ++L++
Sbjct: 795  ENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQ-YIKQLEEDNDSKIEWYQNKIETLRK 853

Query: 861  EMSNVEKRYSEI-VEKERETKWENTRLTKQLKEKTELIEKY----KAASDDEGKLEEISS 915
            +  +V    +E  +E ER  ++E   L K+++E    +  Y    ++ +DD        S
Sbjct: 854  DHESVMSSLNEKQIEVER-FQYEIKSLEKEIEENKIRLHTYNVLDESINDD--------S 904

Query: 916  LQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVELAKNN 975
            L++EL+  K  LT++YSQ + Y+K  E  ++S+ +++ Q+     AF  +I  +   K +
Sbjct: 905  LRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDEKTS 964

Query: 976  IADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKS 1035
            + D  ++L+ Q+ +LNNEL++Q +  E EK  F +  + L+   K +E  K +YE KL  
Sbjct: 965  LEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKTEYESKLSK 1024

Query: 1036 LMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRL 1095
            + KDL++Q  YAN AQNNYEQELQ HA+VSKTIS+LREQ   Y+ ++  L ++    ++ 
Sbjct: 1025 IQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQFEKA 1084

Query: 1096 LNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKL-TTQANDEDNAESSGVNS 1154
            L EN+ +W  Q++   +Q++    RIE+ S QNK+L++Q +L TT  N   +A+S  V  
Sbjct: 1085 LKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGSV-- 1142

Query: 1155 IEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETHNY 1214
               +N ++++LR ERD+L  ++ V E + K+LR++++ I+ + +    +L   K E    
Sbjct: 1143 --LNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKR 1200

Query: 1215 PDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKXXXXXXXXX 1274
              +++QH  VM +L QL+LLRESN TLRNE     SKN+ LQ+E+E L            
Sbjct: 1201 SFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA 1260

Query: 1275 XXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKS 1334
                    K++++ +  EE  RWK+RSQDI+ K+Q++   ++E L  E   L+AQLE+K+
Sbjct: 1261 ALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKT 1320

Query: 1335 KENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLE 1394
            ++  +   +F +L++QA EKL ASK+SQ+S   Q+N+L              K+ KL+LE
Sbjct: 1321 QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNEL--------------KDAKLALE 1366

Query: 1395 KRL------------EVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENL 1442
            K L                +N + +  I+   E+    SK+ ETK   +  S     + L
Sbjct: 1367 KSLNNANARIQELEDAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVKKL 1426

Query: 1443 NSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKXXXXXXXXX 1502
            N EI                 +    T      +QD +     + +VESMK         
Sbjct: 1427 NEEIGILKEELEKQRQIQQQFQAAAGT------EQDDL-----SKVVESMKRSFEEDKIK 1475

Query: 1503 XXXXXXXXFKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEAEE 1562
                      +K++    +   E E   ++P +I+ + I+KQ E E+ +  S++I+EAEE
Sbjct: 1476 FIEEKTREVNQKIREF--QEAQEAEETGLKPSNINIDEIKKQWEAEHNEEVSKKIREAEE 1533

Query: 1563 NLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFF---------- 1612
             LK+RIRLPTEEKI+K+I++++  LE EF  KVE R K +    +  + F          
Sbjct: 1534 ALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVEERLKSISQSGKMEDIFQKQLESRIQE 1593

Query: 1613 -------------------------------DRMKKEIQEELARKYEEELQVVKKKAFDE 1641
                                           D+++ +I+ +L  ++  ELQ +KKK+F+E
Sbjct: 1594 KQKELENEYNKKLQEKLRELPSSDIISSDDKDKLRADIEAQLREEFNHELQTIKKKSFEE 1653

Query: 1642 GRQQVLMKTSFLEKKITKLESDLQNAKSNTGA 1673
            G+QQ +MKT+ LE+K+ K+ES L   K +  +
Sbjct: 1654 GKQQAMMKTTLLERKLAKMESQLSETKQSVDS 1685

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1630 (32%), Positives = 881/1630 (54%), Gaps = 70/1630 (4%)

Query: 129  SLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKI 188
            +LE+    L+S K ++ + L+++I+EL+ ++   + L  E  + R + L LE+E++  K 
Sbjct: 124  ALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKS 183

Query: 189  NDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKN 248
             DL ++ +L RLSQEL        WLE +LG+K  +F++YR  + ++   L  +L T++ 
Sbjct: 184  EDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQ 243

Query: 249  ELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQS 308
            EL     TN  L+E    ++N L     N+K +  + N++K    +E++LK++L+ +L+ 
Sbjct: 244  ELQASTRTNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEG 303

Query: 309  QLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRKSED 368
            Q+  L+ +      L +  TA     D  F+  +N L  +L    ++  E EFK++K E 
Sbjct: 304  QVQSLKSD------LELRSTAGEG-DDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQ 356

Query: 369  YTAVSNST--------SSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDL 420
                  ST        S+ +   S+   Y DI +LK+++  E+ Q+E+ +  +E F+ +L
Sbjct: 357  TVQDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVEL 416

Query: 421  ETELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVA 480
            E+++P                                V+ +L + +++I   E +I  + 
Sbjct: 417  ESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELT 476

Query: 481  KQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERL 540
            +QRSDLA Q+Q+ L+  SV +DS GPLT EE+ F+R I+++ D     E DTQKVISERL
Sbjct: 477  RQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGD--LSLERDTQKVISERL 534

Query: 541  TKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYN 600
             +F+DI+ELQ KN +LL+T R LA KLE E++  +                  +TLQ + 
Sbjct: 535  VEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHA 594

Query: 601  SSLTAKIAALTKELETYKVL---SNTEDSSTPADFDKQREQREIEHTQLVKELETRIASI 657
              L ++I  LTKE + YK +   +N  +  T       + +     +  V +LE  + + 
Sbjct: 595  QELESRIEVLTKERDAYKAIQPSTNNGNKITEHALANSKGK----MSARVDDLERSLVTE 650

Query: 658  IQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERL 717
             +E+++N  +LN +I  L  +   ++IE+ +E+++K LAEERLK+ Q S+ +T  ENE L
Sbjct: 651  REEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEEL 710

Query: 718  QKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNEL 777
             KR + +++ +++QD +T ET++ LI+ +S+LAT+E++   S  +I+ L S ++     +
Sbjct: 711  NKRYHIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESI 770

Query: 778  TRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENY 837
             +L  E+N++ +LVT+LQTLQ ER+ LL+ T+  + ++++ LE   + LR +L   +E +
Sbjct: 771  EQLTAERNNLTILVTQLQTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEF 830

Query: 838  GSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELI 897
               ++        +++K  SL E +  V  +     +  R+ + +   L  +LKE     
Sbjct: 831  NDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKA 890

Query: 898  EKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLN 957
            + Y   +  +  L +  +L+ EL+  K +L ++YSQ E +R   +   ++++ I      
Sbjct: 891  QSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFER 950

Query: 958  KEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELER 1017
             +    +    ++  ++ +      LK QI +LNNEL  QKK ++ EK         L+ 
Sbjct: 951  FKNEHSKDFGNMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQS 1010

Query: 1018 VTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQH 1077
              + +   K  YE +L  L +DL +Q  +ANKAQ NYEQELQ HA+VSKTISQLRE++Q 
Sbjct: 1011 TQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQK 1070

Query: 1078 YRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKL 1137
            Y+ + + L  S    ++ L+E+   W  Q++EYE Q+    +RIE+ + QN +L +Q  L
Sbjct: 1071 YKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQ--L 1128

Query: 1138 TTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDF 1197
              +A D  N+E       E   +L+ SLR ERD+LQ +L V++  E +   +L +IE++ 
Sbjct: 1129 DLEAKD-PNSELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQEL 1187

Query: 1198 RATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQT 1257
                 EL  ++  +     + ++H  ++ QL QL+LLRESNITLR+E  +   + Q L+ 
Sbjct: 1188 SFAKEELSSLQALSSQNSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEG 1247

Query: 1258 EVENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHE 1317
            +++NL                    KD Q+S+  EE+ RWKQRSQDILSK++RIDP EH+
Sbjct: 1248 QIDNLQQSLQPLESELASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHK 1307

Query: 1318 NLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKK 1377
             L EE ++ +A+L  K+ +N EL +RF++LKKQA E+L+A+K  QN+L++++      + 
Sbjct: 1308 KLGEELSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQS 1367

Query: 1378 ELLSQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSK- 1436
             +  QL  E++   +L++ L+     +    + Q +LE AL K    E K    +ES + 
Sbjct: 1368 NMELQLRKEQDVNKALQESLQRVESEAKADSTTQPELESALQKLSQAEKK-AQDIESDRA 1426

Query: 1437 QIEENLNSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDTVDGGVSNDI--VESMKX 1494
            QIE+ L SE+                 +L  +  E+ ++++  V  G   D   +E MK 
Sbjct: 1427 QIEKALQSELEKVKSHAEELER-----RLDEARREVESLEE--VKQGAFTDSSELEKMKR 1479

Query: 1495 XXXXXXXXXXXXXXXXFKKKLQAEINKLKAEYETKQIE------PVSIDENAIRKQIEEE 1548
                             +   +    K KA YE K++E      PV I+   ++KQ EE+
Sbjct: 1480 DLEEHSNTLIAEKEAEIRSHYEELRLKEKATYE-KELEENGKHTPVDIE--TLKKQWEED 1536

Query: 1549 YEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEK 1608
            YEQ T +RI+E+ E L++RIRLPTEEKINK+++ R+++LE EF+ K++ RA EL   +EK
Sbjct: 1537 YEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASEL--ANEK 1594

Query: 1609 NE---FFDRMKKEIQE------ELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITK 1659
             +   F + MK+  QE      +L R+ +EE+  V+KKAFDEG+QQ  MK+ FLEKKI K
Sbjct: 1595 PQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAK 1654

Query: 1660 LESDLQNAKSNTGATDNTIVSTDNETKYEGSDKKPVTI-NTNVVSDV---GENNAERTPM 1715
            LE+ ++   S T A  +   S ++ T      +KPV I   + + D     + N E  P+
Sbjct: 1655 LEAQVK--ASGTEAVPSAPTSKNSPT------EKPVRILEASPLEDALSRNDPNKESLPI 1706

Query: 1716 NKFPRAIMNP 1725
             K     + P
Sbjct: 1707 KKISLPSLTP 1716

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1711 (32%), Positives = 911/1711 (53%), Gaps = 126/1711 (7%)

Query: 24   VASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVXXXXXXXXXXXXXX 83
            +ASF D S + V+++D  I+  LN +  +FN +++E ++I+   +               
Sbjct: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83

Query: 84   XXXXXXDSYESVCXXXXXXXXXXXXXXXXXXXNRDELESKLIQIHSLEENVSELQSKKQE 143
                     + +                      +ELES   +++ L E   E+QS +Q 
Sbjct: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQR 143

Query: 144  LIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLSQE 203
             +K LD+R+ E+   +      NNE    R+ +++LE + Q    NDL+ R++LER +QE
Sbjct: 144  TLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQE 203

Query: 204  LETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQER 263
            L  +   K WLE+ L  K EQ+ SYR+++     +++ +LN +KN+    K+ N VL+++
Sbjct: 204  LNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQK 263

Query: 264  TDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSL 323
             +ELSN L++   +LKN+  S N +K     E+ LKQ+LI +L++QLN ++ E     S+
Sbjct: 264  NNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELK---SI 320

Query: 324  TVSDTASSSRKDS-DFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAVSNSTSSDDLR 382
              SD+++ +  DS     E   L   L   +E+  + E +  +    T  +   S     
Sbjct: 321  RKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRLSSITEETGEESG---- 376

Query: 383  NSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTXXXXXXXXXXXXXXXX 442
               +++  D  +LKK+   E+  +E  +  +E F+ +LE ++P                 
Sbjct: 377  TLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFKERTDMLENELN 436

Query: 443  XXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVAND 502
                         +    ELN    +I   E +I ++ +QR DL  Q+Q+ L+ NSV+ND
Sbjct: 437  NSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQYLLITNSVSND 496

Query: 503  SAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRE 562
            S GPL  EE+KFI+NI+Q D+     E+D+QK+++ RL +F+++IELQ+KN ELL+ TR 
Sbjct: 497  SKGPLRKEEIKFIQNILQNDNS-GTTESDSQKILTGRLVEFRNVIELQEKNTELLRITRN 555

Query: 563  LATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYNSSLTAKIAALTKELETYKVLSN 622
            LA KLE  +   +    +             L+LQ+   SL +K+  L +E ET K   +
Sbjct: 556  LADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKVEELERERETLKSSIS 615

Query: 623  TEDSSTPADFDKQ--REQREIEHTQLVKELETRIASIIQESKENANILNDKIFALDEKNN 680
             + SS      +Q  + +RE+E    V++L+ RI+ I +ES +N ++LN +I  + +  +
Sbjct: 616  KQASSFNNSVIQQLTKTKRELESQ--VQDLQARISQITRESTQNMSLLNKEIQDIYDSKS 673

Query: 681  HISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETIN 740
             ISIEL +EKS++ LAEER KLL  ++D+T  EN++L+KR +SL++ + +QD +THET+N
Sbjct: 674  DISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSISKQDSKTHETLN 733

Query: 741  SLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSE 800
              I  +S+L+  E   +  + E KL   SE+ LK EL +L+ EK S++++VT+LQTLQ E
Sbjct: 734  EYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRIMVTQLQTLQKE 793

Query: 801  REHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKE 860
            RE LL   +     ++N++E   N+L+ +    +++   L E+ T   + ++ K ++LK+
Sbjct: 794  REDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETLKK 853

Query: 861  E----MSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYKAA----SDDEGKLEE 912
            +    M+ V ++ +EI     + +++   L K+++E    +  Y       +DD      
Sbjct: 854  DNDSVMNLVNEKQTEI----EKLQYKVKSLEKEIEENKIRLHTYNVMDETINDD------ 903

Query: 913  ISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVELA 972
              SL+KEL++ K  LTE+YSQ + Y+K  E   QS+ ++N ++     AF  +I  +   
Sbjct: 904  --SLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTDE 961

Query: 973  KNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDK 1032
            K N+ D  ++LK Q  +LNNEL++QK   E +K+ F +    L+   K +E  K +YE K
Sbjct: 962  KINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESK 1021

Query: 1033 LKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDA 1092
            L  +  DL++Q  YAN AQNNYEQELQ HA+VSKTIS+LREQ   YR ++  LT+S ++ 
Sbjct: 1022 LSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSEL 1081

Query: 1093 KRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGV 1152
            + +L EN+ SW  Q+    +Q++    RIE+ S QNK+L+ Q +L T A    N      
Sbjct: 1082 ENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAG---NGVGDAR 1138

Query: 1153 NSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETH 1212
            N    +N ++++LR ERD+L  ++ V E + K+LR+++T ++ + +    +L   + E  
Sbjct: 1139 NGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVEND 1198

Query: 1213 NYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKXXXXXXX 1272
                +++QH  +M +L QL+LLRESNITLRNE      KN+ LQ+E+  L +        
Sbjct: 1199 ERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESE 1258

Query: 1273 XXXXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEE 1332
                      K++++ +  EE  RWK+RSQDIL K+Q++   ++E L  E   L+AQLE+
Sbjct: 1259 LSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLED 1318

Query: 1333 KSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLS 1392
            K ++  E   RF +L++QA EKL  SK++Q +LT Q+N+L              K+ K++
Sbjct: 1319 KMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNEL--------------KDAKVA 1364

Query: 1393 LEKRL-------------EVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIE 1439
            LE+ L             +V   N+   +  +SQ E+A   S++ E K   +  S     
Sbjct: 1365 LERSLNDANTRIQELEGEKVAEDNNRSEMIKRSQ-EDAEKSSRELEEKLEENAISYSSTV 1423

Query: 1440 ENLNSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKXXXXXX 1499
              LN EI                ++L T+    G+ D+D     +SN IVESMK      
Sbjct: 1424 RKLNEEI--ATLKEEIEKQGQIQKQLQTAA---GHRDED-----LSN-IVESMK------ 1466

Query: 1500 XXXXXXXXXXXFKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKE 1559
                       F ++   E+NK   E + +  +P S++ + ++KQ E E+E+  ++R++E
Sbjct: 1467 --KSFEEDKIKFIEEKTREVNKKIQEAQERLNQPSSVNIDEMKKQWEAEHEEEVAERVRE 1524

Query: 1560 AEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFF------- 1612
            AEE LK+RIRLPTEEKI+K+I++++  LE EF  K+E + K  ++G E+ E         
Sbjct: 1525 AEEALKKRIRLPTEEKISKIIERKKEDLEKEFNEKLEEKVKS-ISGSEQMEAMLQKQLEI 1583

Query: 1613 -----------------------------------DRMKKEIQEELARKYEEELQVVKKK 1637
                                               D ++ EI+ +L  +  +ELQ VKKK
Sbjct: 1584 RVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKK 1643

Query: 1638 AFDEGRQQVLMKTSFLEKKITKLESDLQNAK 1668
            +F+EG+QQ  MKT+ LE+K+ K+ES L   K
Sbjct: 1644 SFEEGKQQATMKTTLLERKLAKMESQLSEIK 1674

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1718 (30%), Positives = 898/1718 (52%), Gaps = 117/1718 (6%)

Query: 24   VASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVXXXXXXXXXXXXXX 83
            +ASF   S + V++++  ++K LN++  +FN +++E ++I+   +               
Sbjct: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83

Query: 84   XXXXXXDSYESVCXXXXXXXXXXXXXXXXXXXNRDELESKLIQIHSLEENVSELQSKKQE 143
                     + +                      +ELES   +   L E   ELQ  +Q 
Sbjct: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143

Query: 144  LIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLSQE 203
             +K LD+R+ EL   R +    +NE  + R+ I+ LE + QDL  +DL+ R +LER +QE
Sbjct: 144  TLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAELERKAQE 203

Query: 204  LETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQER 263
            L  +     WLE+ L  K EQ+ SYR+K+     +++ +LN ++++    K+ N VL ++
Sbjct: 204  LNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTKNDVLTQK 263

Query: 264  TDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSL 323
             DELS  L++    +K++    +++K     E+ LKQ+L+ +L+SQLN ++ E  +   L
Sbjct: 264  NDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELDSTRGL 323

Query: 324  -TVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAVSNSTSSDDLR 382
             T +D+     +  D  +E+   K +L   +   + L          +++   T  +   
Sbjct: 324  ETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRL----------SSIIGETDEESGS 373

Query: 383  NSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTXXXXXXXXXXXXXXXX 442
            ++   + D I +LKK+L  E+  +E+ +  +E F+ +LE ++P                 
Sbjct: 374  STSRSSSDFI-LLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTLENELN 432

Query: 443  XXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVAND 502
                         +    EL+    +++  E +I+ + KQR DL  Q+Q+ L+ NSV+ D
Sbjct: 433  NAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSKD 492

Query: 503  SAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRE 562
            S GPL  EE+ FI+NI+Q D +    ETD+QK+++ERL +F+ IIELQ+KN ELLK  R 
Sbjct: 493  SKGPLRKEEIMFIQNILQNDSDTA-TETDSQKIVTERLVEFRSIIELQEKNTELLKIVRN 551

Query: 563  LATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYNSSLTAKIAALTKELETYK-VLS 621
            LA +LE  +   +    +             LTL+     L +K+  L KE E  K +LS
Sbjct: 552  LADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKECENSKALLS 611

Query: 622  NTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNH 681
            N E S   +   +  E +     Q +++L++ I+ I +ES EN ++LN +I  L +  + 
Sbjct: 612  NEETSHLNSTIQQLNETKRNLECQ-IQDLQSNISQITRESTENMSLLNKEIQDLYDSKSD 670

Query: 682  ISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINS 741
            ISI+L +EKS++ LAEER KLL  ++D+T  EN++L+KR + L++ +++QD +T ET+N 
Sbjct: 671  ISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQETLNE 730

Query: 742  LIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSER 801
             I  +S+L   E +    + E KL   SE+ LK E+ +L+ EK  ++++VT+LQTLQ ER
Sbjct: 731  YISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQKER 790

Query: 802  EHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEE 861
            E+LL  T+  +  ++++LE   N+L+ +    ++    L E+     + ++ K + LK++
Sbjct: 791  ENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVLKKD 850

Query: 862  ----MSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQ 917
                + ++  + +EI + + + K     L K++ E    +  Y      +G + +  SL+
Sbjct: 851  NESIICSMNDKQAEIEKLQHKVK----SLEKEIDENKIRLHTYNVI---DGTIND-DSLR 902

Query: 918  KELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIA 977
            KEL+  K  LT++YSQ + Y++  E   +S+  ++ +       F  RI  +   K+++ 
Sbjct: 903  KELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLE 962

Query: 978  DSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLM 1037
            +  ++LK QI +LNNEL++Q K  ++EK  F +  + L+   K +E  K +YE KL  + 
Sbjct: 963  EKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQ 1022

Query: 1038 KDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLN 1097
            KDL++Q  YAN AQNNYEQELQ HA+VSKTIS+LREQ   YR ++  LT+S    +  L 
Sbjct: 1023 KDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLK 1082

Query: 1098 ENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQAND--EDNAESSGVNSI 1155
            EN+ SW  QR    +Q+E    RIE+ + QNK+L++Q +L T A+    D  +   +NSI
Sbjct: 1083 ENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSI 1142

Query: 1156 EGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETHNYP 1215
                  +LSLR ERD+L  ++ V E + K+LR++++ ++ + +    +L   + E    P
Sbjct: 1143 ------LLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRP 1196

Query: 1216 DLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKXXXXXXXXXX 1275
             +++QH+ +M +L QL+LLRESNITLRNE      + + LQ+E++ L             
Sbjct: 1197 TIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAA 1256

Query: 1276 XXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSK 1335
                   K+++L +  EE  RWK+RSQDIL K++++   ++E L  E + L+ +L+EK++
Sbjct: 1257 LKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTR 1316

Query: 1336 ENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEK 1395
            +  E   RF +L++QA E+L  SK+S ++LT Q+NDL              K  K+ LEK
Sbjct: 1317 QGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDL--------------KNAKIKLEK 1362

Query: 1396 RLE------------VTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLN 1443
             L+               ++++ + +I+   ++A   SK+F+TK            + LN
Sbjct: 1363 SLDDANTKIEELENAKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLN 1422

Query: 1444 SEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKXXXXXXXXXX 1503
             EI                 +     +E  N   D       + IVESMK          
Sbjct: 1423 EEIITLREEIEKQRRIQQQLQ-----SEPANEQNDL------SKIVESMK--------KT 1463

Query: 1504 XXXXXXXFKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEAEEN 1563
                   F ++   E+N+   E + +  +P +I+ + ++ + + E+E+    RI+EAEE 
Sbjct: 1464 FEEDKINFIREKTKEVNEKILEAQERLNQPSNINIDELKIKWKAEHEEEVVNRIREAEEA 1523

Query: 1564 LKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFF----------- 1612
            LK+RIRLPTEEKI+K+I+++R  LE EF  KVE R K L    + +  F           
Sbjct: 1524 LKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEK 1583

Query: 1613 --------------------------DRMKKEIQEELARKYEEELQVVKKKAFDEGRQQV 1646
                                      D+++ EI+ ++ ++ + ELQ +KKK+F+EG+QQ 
Sbjct: 1584 QKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQA 1643

Query: 1647 LMKTSFLEKKITKLESDLQNAKSNTGATDNTIVSTDNE 1684
            +MKT+ LE+K+ K+ES L   K  T +    +  T N+
Sbjct: 1644 MMKTTLLERKLAKMESQLSETKKITESPSKHVNHTQNQ 1681

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  591 bits (1523), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 509/1614 (31%), Positives = 889/1614 (55%), Gaps = 60/1614 (3%)

Query: 129  SLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKI 188
             L+ N+     + +EL  S D+++TEL   R   + L  +     +KIL+LE + Q+ + 
Sbjct: 114  GLQNNIDRANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQS 173

Query: 189  NDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKN 248
            ++L+++++LER +QE+  + K + WLE+ L  K + F  YR+K+     D    +  +K+
Sbjct: 174  SELNRKSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKS 233

Query: 249  ELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQS 308
            +L   KS+  +L ++ DE + +L++     K+++     +K   +KEL++K +LI + ++
Sbjct: 234  DLKIEKSSKEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYEN 293

Query: 309  QLNELQ-------------RENGNELSLTVSDTAS-SSRKDSDFTREINDLKNQLNHVQE 354
            Q+  L+              EN +E+  ++ +  S + RK  D   +   L++ L+H   
Sbjct: 294  QIKSLESTLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDH-DS 352

Query: 355  RNVELEFKLRKSEDYTAVSNST------SSDDLRNSLAKAYDDIDVLKKKLNDEQSQREN 408
             +V L+ K RK   Y+  SNS       S DD   SL++   DI +LK++L  E+ Q+E 
Sbjct: 353  NDVSLQTKGRKR-TYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEK 411

Query: 409  FEKNLEEFMDDLETELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSR 468
             +  +E F+ +LE ++P                               L ++EL   + +
Sbjct: 412  LQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKK 471

Query: 469  IQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDK 528
            I     +++++ +QR+DLA+QLQ+ L++ S+ ND+   L ++E+KFI+N++  D+     
Sbjct: 472  ISDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMAST- 530

Query: 529  ETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXX-- 586
              D+QKVISE L KFKDI +LQ+KNMEL+KT R LA +LEE ++ K++  +         
Sbjct: 531  -NDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEI 589

Query: 587  -XXXXXXXLTLQNYNSSLTAKIAALTKELETYKVLSNTEDS----STPADFDKQREQREI 641
                    LTL+  N +L   +  +TKE + +K+L  +ED      +     K  E +  
Sbjct: 590  FAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLLV-SEDRERNFKSSNSVHKYHELKSY 648

Query: 642  EHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLK 701
              T +VK+LE R+  +  +S  ++  L +++  L ++ + +++++ + +SAK LAEERLK
Sbjct: 649  NET-VVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLK 707

Query: 702  LLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQN 761
            + Q SM++   ENE+L+ R + L + +++QDK T +T +S ++  S+ +++E      + 
Sbjct: 708  ITQNSMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLET 767

Query: 762  EIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEG 821
            E+ LL   E  LK+EL+   EEK  ++++VT+LQ+LQSERE LL   Q  F K ++++  
Sbjct: 768  EVTLLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNY 827

Query: 822  TCNDLRKKLKEAEENYGSLMEETTELKDDFRQKK--KSLKEEMSNVEKRYSEIVEKERET 879
                L K+L E       + +E    + ++ QKK  ++ +++     +  ++  E ER  
Sbjct: 828  INEKLDKQLSERVHEIDKIEKERN-AQYEWYQKKIDEASQQQQQIQGQLQTKNDELER-L 885

Query: 880  KWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRK 939
              +N  L K+L+     I  Y+  + +  + +E + + KEL+  K EL ++YSQ E ++ 
Sbjct: 886  HLQNKTLEKELEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKN 945

Query: 940  DIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKK 999
              +    ++ ++N     K+  +++ I  +   K  I     +LK Q++++ NEL VQ +
Sbjct: 946  LSQNSEDALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSE 1005

Query: 1000 LYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQ 1059
              E E+   T+   EL+   + +E+ K+ +E+KL+ L  DLEEQ  YAN AQ NYEQELQ
Sbjct: 1006 EAESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQ 1065

Query: 1060 NHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKK 1119
             HA+VSKTIS+LREQ Q  + +   LT      +  +++N+   + +RDEY  QI+  ++
Sbjct: 1066 RHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQ 1125

Query: 1120 RIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVT 1179
            RI++ ++QN++L+ Q  L  +A  E   E+S  +   G   LVLSLR ERD+L  ++NV 
Sbjct: 1126 RIDDITKQNQLLYNQIDLLNRA--ESVNENSSDDEANGSTALVLSLRRERDILDTKINVI 1183

Query: 1180 EAEEKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNI 1239
            E E+  L+++L  I+ +   T      ++ E   + DL+  ++T+   L QL+LLRESN+
Sbjct: 1184 ETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNV 1243

Query: 1240 TLRNETIELQSKNQHLQTEVENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQ 1299
            TLRNE  +   +   +  +++   ++                 KD +++  ++ES+RWK 
Sbjct: 1244 TLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKT 1303

Query: 1300 RSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASK 1359
            R ++++ K+Q+++  ++  L E  N  +  L+ K +E  EL +RF +LKKQAHEKLN SK
Sbjct: 1304 RLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSK 1363

Query: 1360 ISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALM 1419
              Q+SL  QI++L ++K ++  QL+ + E    L   L    +  +D+ +++ +L + + 
Sbjct: 1364 ELQSSLQEQISNLISEKDDIRKQLDVKTEENSELLSELNNFREKQNDLETLREELNKEIS 1423

Query: 1420 KSKDFETKFINSVESSKQIEENLNSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDT 1479
            KS++ E K  N +ESS     N N EI                 +L  ++T   + D+ T
Sbjct: 1424 KSEELEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKT-----QLAANST---DADEQT 1475

Query: 1480 VDGGVSNDIVESMKXXXXXXXXXXXXXXXXXFKKKLQAEINKLKAEYETKQIEP---VSI 1536
                  N  VE++K                 F K+L  E  K++ E++  + +P   +++
Sbjct: 1476 ------NRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENE-KPDTELNV 1528

Query: 1537 DENAIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVE 1596
            D  A+RKQ EE+ E+   +RI EAE+NLK+RIRLP+EEKINK+I+KRR++LE+EF  K+ 
Sbjct: 1529 DVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIR 1588

Query: 1597 ARAKELLTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKK 1656
             +A++LL  D  NEF + +K+ +++EL  ++E+ELQ  +KKAF+EG+QQ  MKT+ LE+K
Sbjct: 1589 DKARDLLMNDHSNEFNNELKEALEKELKERFEDELQAARKKAFEEGKQQATMKTTLLERK 1648

Query: 1657 ITKLESDLQNAKSNTGATDNTIVSTDNETKYEGSDKKPVTINTNVVSDVGENNA 1710
            I KLES +Q  + ++  T + +   +N T      K P T+N++  S    NN 
Sbjct: 1649 IQKLESQIQEKEKDSEETQD-VKPEENSTP--SVKKIPETLNSSDTSFGNSNNV 1699

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  571 bits (1471), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 421/1250 (33%), Positives = 711/1250 (56%), Gaps = 25/1250 (2%)

Query: 126  QIHSLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQD 185
            Q+   ++ +  + S KQ++ K L+++I++L   +   + L     + R   + LE   Q 
Sbjct: 120  QVEEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQG 179

Query: 186  LKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNT 245
             K  +L ++++++RL QEL  +     WL + L  K EQ +S+REK+ +E Q+   Q+N+
Sbjct: 180  YKSQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNS 239

Query: 246  VKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVV 305
            +K++L+  ++ N  L+ +T ELSN+L++     K +    N +K    +E++LKQ+LI +
Sbjct: 240  LKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDL 299

Query: 306  LQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRK 365
            L+SQ++ ++ +  N       +  S+  KD     E+ D K  L   Q  N++LE  + +
Sbjct: 300  LESQVSSMKSDLENAYQSANQNGMSTPEKDQ-LLDELIDTKKNLEATQAENIKLEATVNE 358

Query: 366  -----SEDYTAVSNS----TSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEF 416
                  ++  AV NS    TS D   +++ K   DI +LKK+L  E+ Q+E  +  +E F
Sbjct: 359  LLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESF 418

Query: 417  MDDLETELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEI 476
            + +LE ++P                                 + ELNQ +++I + E ++
Sbjct: 419  VVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQV 478

Query: 477  KLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVI 536
              +  QRSDLA+Q+Q+ L+  SV +D+ GPLT++EV+F++ II  +DE    ++DTQ +I
Sbjct: 479  CSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEA--PKSDTQGII 536

Query: 537  SERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTL 596
            SERL +FK +IELQ KN ELL T R+LA KLE+E+K  +                  L+L
Sbjct: 537  SERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSL 596

Query: 597  QNYNSSLTAKIAALTKELETYKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIAS 656
            Q +   L  ++  ++KE + +K+ ++       A     + ++  EH   + ELE R+ +
Sbjct: 597  QEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEH---IMELEKRLKN 653

Query: 657  IIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENER 716
            + ++S++N  +LND+I AL +  + +++ L +E+S+K LAEERLKL+Q ++ +T  EN  
Sbjct: 654  LAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLE 713

Query: 717  LQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNE 776
            L KR + L+ V+++QD++T  TI+ +I T+S+L+ + +K  +  +E   L   E  LKNE
Sbjct: 714  LHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNE 773

Query: 777  LTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKL----KE 832
               L +E  + K+LV++LQTLQ ER+ LL   Q  + K +  LE   ++ R+ L    +E
Sbjct: 774  NEALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTRE 833

Query: 833  AEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKE 892
             EE   S   +T++ K  F+ K  SL E++ N  K   E        +     LT +L+E
Sbjct: 834  YEEQRVS---DTSQYKW-FQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEE 889

Query: 893  KTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADIN 952
                 + Y   ++ +   ++I +L+K L+     L ++YSQ E Y+   ++  QS  +I+
Sbjct: 890  AELRTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEIS 949

Query: 953  KQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNA 1012
            K +   +A +++ I  +E  + ++ D   +L  QI DLN+EL+ QK   + EK    +  
Sbjct: 950  KALEESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKL 1009

Query: 1013 NELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLR 1072
            + L+   + L++ K +YE+K+  L +DL +Q  YAN+AQ NYEQELQ HA+V+KTIS LR
Sbjct: 1010 SILQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLR 1069

Query: 1073 EQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLF 1132
            E++Q Y++E+     SA++AK  L  N+ SW +Q  + E Q+   ++R EE + QN++L+
Sbjct: 1070 EESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLY 1129

Query: 1133 EQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTS 1192
            +Q +L ++A   D +E++   S E   +L+++LR ERD+L+ +L+V+  EEK+LR+RL  
Sbjct: 1130 DQVELLSKATSSD-SEAAASMSAES-RELIMTLRRERDILETKLDVSIREEKILRQRLGL 1187

Query: 1193 IEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKN 1252
             + +     LE  K +    +     E  + +M +L QL+LLRESN+TLRNE+ +   ++
Sbjct: 1188 AKTELENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQS 1247

Query: 1253 QHLQTEVENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRID 1312
            QH Q E+  L ++                 +D+Q+S+  EES RWKQRSQDIL KY+RID
Sbjct: 1248 QHFQNEIAKLQEQLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERID 1307

Query: 1313 PVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQ 1362
            PVEH+ LA+E   L+ +LE+KS EN E   RF KL+KQA+E+L+  K ++
Sbjct: 1308 PVEHQKLADEVTELKNELEKKSLENLESQERFRKLRKQANERLDEFKAAK 1357

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  563 bits (1451), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 478/1571 (30%), Positives = 830/1571 (52%), Gaps = 89/1571 (5%)

Query: 129  SLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKI 188
            +LE+    L++ K ++ + L+++I ++   +   E L  E    R + L+LE + +  K 
Sbjct: 126  ALEQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKS 185

Query: 189  NDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKN 248
             +L  +    +LSQ++  +N    WLE +L +K  +F++YR+++ +E   +  +L T + 
Sbjct: 186  EELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEG 245

Query: 249  ELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQS 308
            +L     T   L+E+  +  ++L      +K +     + K    +E++LKQ+L+ +L+ 
Sbjct: 246  DLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEG 305

Query: 309  QLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRK--- 365
            Q++ L+    +EL    S  AS+   D+  T   + ++++L H  ++  E E K++K   
Sbjct: 306  QVSALK----SELEFKNSPQAST---DAATTESQSQIEDELVHKTQQLEESELKIQKLEQ 358

Query: 366  ------SEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDD 419
                  S D   +S S S  DL       Y DI +LKK++  E+ Q+E  +  +E F+ +
Sbjct: 359  TVEQLLSADEKTISGSQSLPDL-------YADIGILKKQVIHERRQKEFLQNQVEAFVVE 411

Query: 420  LETELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLV 479
            LE ++P                                 +++L + +S+I+ +E +I  +
Sbjct: 412  LENKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISAL 471

Query: 480  AKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISER 539
             +QRSDLA Q+Q+ L+  +V  DS GPL+ EE  F++ ++  ++   D   D Q +ISER
Sbjct: 472  TQQRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPD--GDAQGIISER 529

Query: 540  LTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNY 599
            L +FK+I+ELQ KN +LL T R LA +LE E++  +++                +TLQ++
Sbjct: 530  LVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDH 589

Query: 600  NSSLTAKIAALTKELETYKVL-SNTEDSSTPADFDKQREQREIEHTQL-VKELETRIASI 657
               L  +I  +T+E + YK + S T    +     +    +  E++ L ++ELE  +++ 
Sbjct: 590  IQELETRIDVITRERDAYKAIQSQTSHEGSNGGL-RDVNAKASENSDLKIRELEELLSAA 648

Query: 658  IQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERL 717
             +E++ N  +L  +   L    + + + + +EKS++ LAEERLK+ + S+ +T  ENE L
Sbjct: 649  KREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEEL 708

Query: 718  QKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNEL 777
             KR   L N + +QD RT ETI+ LI  +S+LAT+  +   S  +  LL++S + LK   
Sbjct: 709  NKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETN 768

Query: 778  TRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENY 837
             +L +E+N + +LVT+LQTLQ ER+ LL  + D F  +++ LE   + LR  L +     
Sbjct: 769  EQLTKERNELTILVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATEL 828

Query: 838  GSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELI 897
               M  +      +++K  +L E + +     +   +  +E + + + LT +L++     
Sbjct: 829  SDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKS 888

Query: 898  EKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLN 957
            + Y   +  +  L +  +L+ EL+  +  L +++SQ + Y+       +++  +   +  
Sbjct: 889  QSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTAL-- 946

Query: 958  KEAAFKERITEVELAK---NNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANE 1014
             E + ++   EVE  K   + +++   VLK Q+ +LN+EL+ QK L E  K    +   E
Sbjct: 947  -EHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEE 1005

Query: 1015 LERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQ 1074
            ++     L   K  Y+ +L  L +DL +Q  YANKAQ NYEQELQ HA+VSKTISQLRE+
Sbjct: 1006 VKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREE 1065

Query: 1075 TQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQ 1134
             Q ++ ++  L  S T+ K+ L EN+  W  Q+ EYE Q     +RIE+ S QN++LF+Q
Sbjct: 1066 AQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQ 1125

Query: 1135 SKL----TTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERL 1190
              L    +   NDE  +E+          +L+ +L+ E D+LQ +L + + +E  L+++L
Sbjct: 1126 ISLKDTDSIPINDELKSEA---------RELISTLKRECDILQTKLELAKRDESNLKQKL 1176

Query: 1191 TSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQS 1250
               E++      E++K +  +     ++E++  ++ QL Q++LLRESNITLRNE      
Sbjct: 1177 EFTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQ 1236

Query: 1251 KNQHLQTEVENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQR 1310
            +NQ L+  VE L +                  KDKQ+S+  EE  RWKQRSQDIL KY+R
Sbjct: 1237 RNQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYER 1296

Query: 1311 IDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQIN 1370
            +DP EH+ LAEE ++ +A+    +++  EL +RF++LKKQA E+L+ ++ +QN+L  ++ 
Sbjct: 1297 VDPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELT 1356

Query: 1371 DLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNS-HDIVSIQSQLEEALMKSKDFETKFI 1429
            +    +K L   L+ E+E   SL++ ++ T +N   +  + + QL++AL K +D + +  
Sbjct: 1357 EARESQKALEDALDKEREKTRSLQESIKATEENEIENSSATRDQLQDALQKLEDAQARIN 1416

Query: 1430 NSVESSKQIEENLNSEIXXXXXXXXX------------XXXXXAHEKLTTSTTEIGNVDQ 1477
                +  Q E+ L  E+                          A  +++ +  EI  V  
Sbjct: 1417 EMSTAPSQEEQTLREELERTRQHVKQLEEHLAKTQNEVRVLEEAKNQVSGTEAEIARVKT 1476

Query: 1478 DTVDGGVSNDIVESMKXXXXXXXXXXXXXXXXXFKKKLQAEINKLKAEYETKQIEPVSID 1537
            + +D   SN ++                      K+K + +  + KAE E       S+ 
Sbjct: 1477 ELIDH--SNKLL---------------AEKEAEIKEKYEKQRLEDKAELEKSLASSESLK 1519

Query: 1538 ENAI---RKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNK 1594
             + I   +K+ EEEYEQ T +RI+EA E L++RIRLPTEEKINK+I+ R+ +L+ EF+ K
Sbjct: 1520 SSDIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAK 1579

Query: 1595 VEARAKELLTGDEK-----NEFFDRMKKEIQE---ELARKYEEELQVVKKKAFDEGRQQV 1646
            ++ R  E L G++       E   R K+E+++   ++ R+ +EE+   KKKAFDEG+QQ 
Sbjct: 1580 LQQRTSE-LAGEKPLPATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQA 1638

Query: 1647 LMKTSFLEKKI 1657
             MK+ FLEKKI
Sbjct: 1639 SMKSMFLEKKI 1649

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  559 bits (1441), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 487/1604 (30%), Positives = 839/1604 (52%), Gaps = 83/1604 (5%)

Query: 126  QIHSLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQD 185
            Q+   E  V+   S +++L + L+++I++L+  +  +E +     + R   ++LE   Q 
Sbjct: 117  QLEETERRVAAGDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQS 176

Query: 186  LKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNT 245
             +   L ++ +++RL QEL  +     W   +L EK +Q +SYREK+  E Q  +++LN 
Sbjct: 177  QRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNI 236

Query: 246  VKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVV 305
            VKNEL+   +    L+ +  ELS +L+D     K +  S +++K    +E+ LKQ+LI +
Sbjct: 237  VKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIEL 296

Query: 306  LQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDL---KNQLNHVQERNVELEFK 362
            L  Q+  ++++   E +  V+     S  DS+  R +NDL   K +L   Q     LE  
Sbjct: 297  LNGQVATMKQDL--EKAYDVAKNGGMS--DSERERLLNDLFDTKKKLELSQANVSRLEDT 352

Query: 363  LR--------KSEDYTAVSNS-TSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNL 413
            ++        +S     + ++   S    ++++  Y D+  L+K+L  E+  +E  +  +
Sbjct: 353  IKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQV 412

Query: 414  EEFMDDLETELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIE 473
            E F+ +LE ++P                                   ++ Q ++++   E
Sbjct: 413  ESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYE 472

Query: 474  QEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQ 533
             ++  + +QRSDLA Q+Q  L+H SV +DS+GPLT EEV+F++ +    D      +DTQ
Sbjct: 473  TQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATG--SDTQ 530

Query: 534  KVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXX 593
             +IS RL +FK ++ELQQKN ELL   R+LA KLE+E+   Q++                
Sbjct: 531  AIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAI 590

Query: 594  LTLQNYNSSLTAKIAALTKELETYKVL-SNTEDSSTPADFDKQREQREIEHTQLVKELET 652
            L+LQ +   L  ++  +T E +++K+L S  +++S P        Q + E    +  LE 
Sbjct: 591  LSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQ-EVADGIAHLEA 649

Query: 653  RIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTIT 712
            R+ ++ +ES+++A +LN++I AL + N+ ++IEL RE+S+++LA+E+L L+QKS+++   
Sbjct: 650  RLKAMAEESEQHAKMLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKG 709

Query: 713  ENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEM 772
            EN  LQ R  SL+ +++EQD R   TI   +  +SEL ++ ++  + Q+E   L   E  
Sbjct: 710  ENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEAD 769

Query: 773  LKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKE 832
            LK E   LN++ N  +LL+ +L+T Q ER+ L+  T+ ++   + +L+G  +  +++L+ 
Sbjct: 770  LKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLER 829

Query: 833  AEENYGSLMEETTELKDDFRQKKKSLKEEMSN----VEKRYSEI-VEKER----ETKWEN 883
             +  Y  L   ++     F+ K  SLKEE+ +    ++ + SE+   K R     +K E 
Sbjct: 830  KQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEP 889

Query: 884  TRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIEL 943
              +  Q   ++ L+ +   AS        + SL K+L     +L+ +YS+ E Y+     
Sbjct: 890  ASMDHQ---QSSLVLESDHAS-------RVQSLSKDLDEANRKLSSAYSEIERYKAASNA 939

Query: 944  LNQSIADINKQVLNKEAAFKERIT-EVELAKNN--IADSNTVLKTQIDDLNNELEVQKKL 1000
              +     N    NK+ + +  I+ E EL K N  IA +N  +K   D+LN     ++  
Sbjct: 940  TERPSLSYNAVQDNKDGSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNR----REAT 995

Query: 1001 YEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQN 1060
            Y  E+       N L    + +E++K DY+ K+  L  DLE+Q+   N+A+  Y+  LQ 
Sbjct: 996  YSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQK 1055

Query: 1061 HANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKR 1120
             A +S+ I  LR+ ++ Y++EIA+   +A +A+++L  N+ +W +Q+ + E  ++   +R
Sbjct: 1056 QAEISENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQR 1115

Query: 1121 IEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTE 1180
            IEE S QN++L++Q +L +++        + ++S     +L+++LR ERD+L+ +++V++
Sbjct: 1116 IEELSTQNRLLYDQIELLSRSPSSSLEPDTKISS--DARELIVTLRRERDILETKIDVSK 1173

Query: 1181 AEEKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNIT 1240
             EEK+LR+RL   + +      +L + K       D  +  + +  +L QL+LLRE N++
Sbjct: 1174 REEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMS 1233

Query: 1241 LRNETIELQSKNQHLQTEVENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQR 1300
            LRNE+ ++   N+ LQ E+ +L +K                 K+++L++  EES+RWKQR
Sbjct: 1234 LRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWKQR 1293

Query: 1301 SQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKI 1360
            SQDIL KY+RIDP E+  LA E   L+A+LE KS E+ +   RF KL+KQA+E+L+  K 
Sbjct: 1294 SQDILHKYERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKA 1353

Query: 1361 SQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMK 1420
            ++  +  ++    + K +L ++L   +E   SLE +L      S D   +  +LEE   K
Sbjct: 1354 AKAKVESELELALSGKSQLEAKLSEAREKITSLETQL-TERPASEDDNPVSHELEETKTK 1412

Query: 1421 SKDFETKFINSVESSKQI-EENLNSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDT 1479
             +D E   IN ++S   I EE+   ++                     S    G+ D  +
Sbjct: 1413 LQDAENT-INMLKSEWSISEESFKKQLDELNKQLETIQK--------NSAPSSGHSDPSS 1463

Query: 1480 VDGGVSNDIVESMKXXXXXXXXXXXXXXXXXFKKKLQAEINKLKAEYETK---------- 1529
                 +  ++E  K                    +L+A      AE E            
Sbjct: 1464 YHEQPTA-VLEDFKKQVEEERRTLIESHQQELTARLEASRKNFLAEKEKALEELRDSLTN 1522

Query: 1530 -QIEPVSIDENAIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLE 1588
              +E  S +  A++K+ EEEYEQ T QRI+EAEE LK+RIRLP+EE+IN+VI++++  LE
Sbjct: 1523 VSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALE 1582

Query: 1589 NEFQNKVEARAKELL------TGDEKNEFFDRMKKEI---QEELARKYEEELQVVKKKAF 1639
             EF  KV A A  LL         +K +     +KEI   +++LA K+E +L  VKKKAF
Sbjct: 1583 QEFTTKVNATALALLKENPDSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAF 1642

Query: 1640 DEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVSTDN 1683
            +EGRQQ +MK   LE KI+KLES    AK+  G    T +  +N
Sbjct: 1643 EEGRQQGIMKVKLLESKISKLES---QAKAPLGTNVPTKIPLEN 1683

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  498 bits (1282), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 411/1340 (30%), Positives = 732/1340 (54%), Gaps = 107/1340 (7%)

Query: 139  SKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLE 198
            + KQ++ +SL+++I EL+  +  +        + R K++  E E Q  +  +L  ++++ 
Sbjct: 125  ASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEIL 184

Query: 199  RLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNC 258
            R+ QE+  + +   WL  +L  K  Q + +RE +I+E QD +L+++ +++EL+  +++N 
Sbjct: 185  RMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQ 244

Query: 259  VLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENG 318
             L++    L  +L    +  K I+   N  K    KE++LKQ++I  L+  +  L++E  
Sbjct: 245  KLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKE-- 302

Query: 319  NELSLTVSDTASS--SRKDSD-FTREINDLKNQLNHVQERNVELE---------FKLRKS 366
              +  T ++  SS  + K+ D    E+N +K +L+  +   ++L+          KL  S
Sbjct: 303  --MDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDS 360

Query: 367  EDYTAVSNSTSSDDLRNS-LAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELP 425
            E    V N+T+S +   S + K Y D+ +LKK+L  E+ Q++  +  +E F+ +LE ++P
Sbjct: 361  E----VGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIP 416

Query: 426  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVAKQRSD 485
                                             SS+L+  ++ ++S E +I  ++KQR D
Sbjct: 417  VLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVD 476

Query: 486  LANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKD 545
            LA+Q+Q+ LV+ S+ ++  GPL+ EE++F++N+   + +   K +DTQ +I++RL +F+ 
Sbjct: 477  LAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLT--NSQEITKTSDTQGIITDRLVEFRS 534

Query: 546  IIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYNSSLTA 605
            ++ELQQKN ELL T R LA +LE  +   +++                LTL ++  +L  
Sbjct: 535  VVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLEN 594

Query: 606  KIAALTKELETYKVLSNTEDSST----------PADFDKQREQREIEHTQLVKELETRIA 655
            ++  L+KE + YK LS    S T          P + DK            VK+LETR+ 
Sbjct: 595  QLVILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDK------------VKDLETRLT 642

Query: 656  SIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENE 715
            ++IQE++ NA   + +   L +K   IS+    EK+++ LAE+RL LLQ +++++  + E
Sbjct: 643  AVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCE 702

Query: 716  RLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKN 775
             LQKR + L++++ +QDKRT ET++SLIKT+S L++++++ ++ ++E + +   ++ LK 
Sbjct: 703  ELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKA 762

Query: 776  ELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEE 835
            E  R ++E    K+L+ +LQTLQ ERE LL  TQ+ + ++L  LE   +   ++L+E E+
Sbjct: 763  ENERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEK 822

Query: 836  N-----------YGSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENT 884
            N           Y    E+  +L  +  Q+K +L+E+ + ++K  S I E+         
Sbjct: 823  NTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQ--------- 873

Query: 885  RLTKQLKEKTELIEKYKAAS--DDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIE 942
              + +LKE     + Y   S  DD   L  + +L++EL+ +  +L++SYSQ E ++    
Sbjct: 874  --SAKLKEAEARAQSYTMLSNVDDAQNL--VETLRQELEKVNLQLSDSYSQIEHHKT--- 926

Query: 943  LLNQSIADINKQVLNKEAAFKER---ITEVELAKNNIADSNTVLKTQIDDLNNELEVQKK 999
            L  QS+  +N+     E A KE    I  +E  +N +  +  +L  Q+ DLNNE+  QK 
Sbjct: 927  LAEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKS 986

Query: 1000 LYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQ 1059
             Y+ E+       ++L+ V + ++++K DYE+K+  + KDLE Q +YAN++Q +YE ELQ
Sbjct: 987  EYQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQ 1046

Query: 1060 NHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKK 1119
             HA+VSKTI+ LR + Q Y++++  L   +  A   L  ++  W +Q+ EYE ++   ++
Sbjct: 1047 KHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQ 1106

Query: 1120 RIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVT 1179
            R++E S QNK+L++Q +L  +  D DN+  S          L++SLR ERD+L+ +L V 
Sbjct: 1107 RVQELSTQNKLLYDQIELLNKTEDRDNSHDSS--------DLLISLRRERDMLETKLEVA 1158

Query: 1180 EAEEKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNI 1239
             +E+ +L++RL   + +    + +L ++K  +     LLEQ + +M +L QL LLRESN+
Sbjct: 1159 LSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNV 1218

Query: 1240 TLRNETIELQSKNQHLQTEVENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQ 1299
            TLR+E    + +  +L+++++  +D+                 K+++L    EE+ERWK 
Sbjct: 1219 TLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKS 1278

Query: 1300 RSQDILSKYQRIDPVEHENLAEE----RNRLQA---QLEEKSKENEELGNRFEKLKKQAH 1352
            RSQDIL KY+RIDP EH  L EE    +N LQ     L+    E ++  ++F++++ QA 
Sbjct: 1279 RSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQAR 1338

Query: 1353 EKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNS-------- 1404
            ++LNASK  + SL+ +IN +   K ++ + L   K     LE+RL+V  + +        
Sbjct: 1339 DRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQVVTQEAETKEQTFN 1398

Query: 1405 -------HDIVSIQSQLEEA 1417
                    D+ SIQ Q+E A
Sbjct: 1399 SQLSKLQEDLHSIQVQMENA 1418

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  432 bits (1111), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 463/1615 (28%), Positives = 838/1615 (51%), Gaps = 96/1615 (5%)

Query: 126  QIHSLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQD 185
            ++ SL   ++ ++++K+ELI  ++   T+ NE +   E LN    K  N  ++LEN   +
Sbjct: 89   KLTSLGGKLATVETEKKELIDKVNGYETQFNELKIKNEGLN---LKVSNLNIELENWKNN 145

Query: 186  L------KIN------DLSQR-TQLERLSQELETINKEKLWLEERLGEKGEQFDSYR--- 229
                   K+N       LS R ++++RL QE+  +N+ K  L E+  ++ E+F+  +   
Sbjct: 146  SNNFETEKLNYVXXXXXLSIRESEIQRLKQEVTFLNENKSSLSEQWLKEKEEFNKAKLLL 205

Query: 230  EKSINENQDLKLQLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDK 289
            EK++N N  +KL+  T    L  M++   VL ++ ++L+ K  ++   +KN++ +    K
Sbjct: 206  EKNLN-NSTIKLEEATTT--LKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTK 262

Query: 290  ATHEKELTLKQQLIVVLQSQLNELQRE--NGNELSLTVSDTASSSRKDSDFTREINDLKN 347
                KE+ +K +LI +LQ QL+  Q E     EL+   +       ++     +I DL  
Sbjct: 263  DDMNKEIAMKSKLIDLLQGQLSSTQEELRQNVELNSKFTKFPDLESQNETLKSDIQDLTL 322

Query: 348  QLNHVQERNVELEFKLRKSEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRE 407
            ++  +Q  N  L   + +  +    SN++SS    ++L   Y  I++LKK++  E+ +++
Sbjct: 323  KIEELQNENFNLNSMINQMSNEQNNSNNSSSI--DSNLPTLYSKINLLKKQVTQEKLEKK 380

Query: 408  NFEKNLEEFMDDLETELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQS 467
            + +  +E F+ +LE ++P                              + + ++LN   S
Sbjct: 381  HLQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDS 440

Query: 468  RIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHD 527
            ++ + +  IK + +QR DLANQ++  L+  +V NDS GPLT EE++FI  I    ++++ 
Sbjct: 441  KLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNG 500

Query: 528  KETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRX-XXXXX 586
             E  +Q VISERL  F +I ELQ KNMELL + R L+  LE    I+ A   +       
Sbjct: 501  SELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLE---NIENANSHKEFQNKTI 557

Query: 587  XXXXXXXLTLQNYNSSLTAKIAALTKELETYKVLSNTE---DSSTPADFDKQREQREIEH 643
                   LTLQ +N  L +K+  L  E +++K+L N     DSS   D D         +
Sbjct: 558  ADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKND-DLSSSTSPETN 616

Query: 644  TQLVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLL 703
             + +++L+T I  +  E K+N + L  +I +     ++++I L +EKS+  L  E++ L 
Sbjct: 617  EKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLT 676

Query: 704  QKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEI 763
            + + DM  TEN+ L KR  +L+N++++Q+ +  + IN  I   +E++ ++ + +++++E 
Sbjct: 677  ESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEK 736

Query: 764  KLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTC 823
              L  S++ L +EL + +EEKN +++++++LQ+LQ+ER  LL  TQ KF  ++++LE   
Sbjct: 737  DFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNN 796

Query: 824  NDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWEN 883
             DL K       N GS M E  +L      +    +  + +++K  S I   + E   +N
Sbjct: 797  LDLIK-------NLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAI---KTELTSKN 846

Query: 884  TRLTKQLKEKTELIEKYKAASDDEGKLE----EISSLQKELQVLKNELTESYSQTESYRK 939
            + L   L  K EL+E      D   +      + S + K+L + K  L+E+Y+Q E Y++
Sbjct: 847  S-LISDLNTKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQ 905

Query: 940  DIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTV-LKTQIDDLNNELEVQK 998
                  +S+  +     + +    ++I+++ L++N    ++T     +I +L+ +L+ +K
Sbjct: 906  LYTSTEESLKTLESNFESVKNLMDDKISKL-LSENETLKASTGEYDKRISELSTDLKNEK 964

Query: 999  KLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQEL 1058
              Y +E          L +  K    +  +YE+K+  L   LE + K+A+ AQ  YE  L
Sbjct: 965  NKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLL 1024

Query: 1059 -QNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFF 1117
             +++AN+ ++I + +EQ +     I  +         LL+EN+  W+K++D +   +E  
Sbjct: 1025 TKDNANL-QSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEES 1083

Query: 1118 KKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLN 1177
            KK+I+  + QNK+  +Q +L     ++D +             +   LR++RD+L+ +L+
Sbjct: 1084 KKKIDNLTNQNKLYVDQLELL----NKDFSSMDSSQLSSETKHMFNRLRADRDVLETKLS 1139

Query: 1178 VTEAEEKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRES 1237
            + E + K    +L S+  +     ++L   + +   + DL+E H+ ++S+L Q+ L +ES
Sbjct: 1140 IAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKES 1199

Query: 1238 NITLRNETIELQSKNQHLQTEVENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERW 1297
            N TLRN+  EL  KN+ LQT++   + K                 K+  + +  EES +W
Sbjct: 1200 NETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKW 1259

Query: 1298 KQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNA 1357
            + R++++  +  ++D      L+ E + L+   E K K+N EL  RF  LKKQAHE+LNA
Sbjct: 1260 RLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNA 1319

Query: 1358 SKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRL-EVTMKNSHDIVSIQSQLEE 1416
            SK  Q+SL  QIN+L+A    +   L +E++  + L+  L +  +K +  + +I+S+L+ 
Sbjct: 1320 SKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYTQKLSNIESELKA 1379

Query: 1417 ALMKSKDFETKFINSVESSKQIEENLNSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVD 1476
               ++  F+        SS++ +  L  E+                + L  + +++  + 
Sbjct: 1380 LKTENNSFKL-------SSEKEKMELTDEV------------DSLKKSLVEAQSKLSAIG 1420

Query: 1477 QDTVDGGVSNDIVESMKXXXXXXXXXXXXXXXXXFKKKLQAEINKLKAEYETKQIE---- 1532
             D+ D  + N ++ESMK                  + + + E +KL  EYE K IE    
Sbjct: 1421 SDSTDSTM-NAMIESMKKEFEEEKLKLLEDKTNELEAQWKLEKDKLLKEYEEK-IEDLQS 1478

Query: 1533 -----PVSIDE-NAIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQ 1586
                  + I+E  +++K+ EEEYE+AT +RI+EA+E LK+RIRLP+E KIN+VI+KR+ +
Sbjct: 1479 ARTDQSIKIEEFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHE 1538

Query: 1587 LENEFQNKVEARAKELLTGDEKNEFFD--RMKKEIQEELAR----KYEEELQVVKKKAFD 1640
            LENE++ K++ +  E+       E  D  ++++EI+EE+ R    K+E +L   KKK+F+
Sbjct: 1539 LENEYEVKLQEKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFE 1598

Query: 1641 EGRQQVLMKTSFLEKKITKLESDLQNAKSNTGATD-NTIVSTDNETKYEGSDKKP 1694
            EG+QQ  MKT+ LE+KI+KLES L  A  N   +D N I+S   +T    S + P
Sbjct: 1599 EGKQQSSMKTTLLERKISKLESQLSEAIENDKQSDKNPIISDLAQTSTLASIQPP 1653

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  312 bits (799), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 426/1508 (28%), Positives = 742/1508 (49%), Gaps = 144/1508 (9%)

Query: 218  LGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTN 277
            L E   +F + +  S NE ++ K  L++++ + + +   N   +ER +EL+  + D    
Sbjct: 204  LSEMSNKFYTLKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFK 263

Query: 278  LKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSLTVSDT--ASSSRKD 335
             K+++   N  K +  +E+TL Q          N+L +E+   L  T  +T   +S+ + 
Sbjct: 264  KKSLENDLNELKESFTREMTLTQHE--------NDLLKEHIEYLKNTTKETTGGTSTLEK 315

Query: 336  SDFTREINDLKNQLNHVQERNVEL-EFKLRKSEDYTAVSNSTSSDDLRNSLAKAYDDIDV 394
                 E+ D+K  L   +  NV L +F     E Y   +  ++SD+          ++ +
Sbjct: 316  DRLLHELVDIKKSLEKSELENVHLNDF----IEQYLTENEESTSDN----------ELVL 361

Query: 395  LKKKLNDEQSQRENFEKNLEEFMDDLETELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 454
            LK++L  E+ Q++  ++ +E F+ +LE +LPT                            
Sbjct: 362  LKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERE 421

Query: 455  XSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKF 514
              +   EL     R++   + I ++  QR DLA+Q+QF L++  +       LT +E+ F
Sbjct: 422  SDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITF 481

Query: 515  IRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIK 574
            +R II+  +  +D  +D+QK+ISERL KF DI  LQ++NMELL TTR LA +LE  D   
Sbjct: 482  LRKIIKSRNSQND--SDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKS 539

Query: 575  QAEKSRXXXXXXXXXXXXXLTLQNYNSSLTAKIAALTKELETYKVLS--NTEDSSTPADF 632
              + +R               LQ   + LT+K+  L KE + YK+LS  NT + +   + 
Sbjct: 540  VQKITRNESKEKIAK------LQESINGLTSKLEKLQKEKDAYKLLSLQNTGEQTPTEEL 593

Query: 633  DKQREQREIEHTQL--VKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREK 690
              Q +++E + T+L  +  L++ +A      +E A +LN  I  L ++   ++  + +E 
Sbjct: 594  RSQLQKKEEQLTKLERMSSLDSHLA------EEKAKVLNQSIIKLKKEKYDLNNAIIKET 647

Query: 691  SAKQLAEER-------LKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLI 743
            S + +AE++       L+LL K  D+ + + E  +  LN             H   N  I
Sbjct: 648  SQRAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLND------------HNAEN--I 693

Query: 744  KTRSELATVENKWNVSQNEIK-----LLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQ 798
            K   E  T + K ++ Q EI+     LL  S++  +N L++L       + L +RL T++
Sbjct: 694  KHSRENETTQAKISILQKEIESYKQNLLQYSKDN-ENTLSKLAAATQEKETLGSRLSTVK 752

Query: 799  SEREHLLSTTQDK--FNKELNDLEGTCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKK 856
            +E E  ++  Q++  + KE + +      L KK K        L ++  E+KD F  KK 
Sbjct: 753  NELEQKINLMQERETYYKEHDSI---SERLLKKSK------IQLEDKIKEVKD-FEAKKN 802

Query: 857  SLKEEMSNVEKRYSEIVEKERETKWE-NTRLTKQLKEKTELIEKYKAASDDEGKLEEISS 915
            S   +++  +KR   +     + + E N  LTK   ++ ++ +  K  S +      +  
Sbjct: 803  S---QINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKISDLEKTLSQNTNGSSSLPR 859

Query: 916  LQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVEL-AKN 974
            + ++ + LKNEL E   +   YR   +LLN  +A+  K  L K+   + +I +  +  K 
Sbjct: 860  VDQDFEKLKNELKEKQLEINQYR---DLLN--LAEETKNRLQKDLNKQRQIVDDAMEGKE 914

Query: 975  NIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLK 1034
             +      L  +   +N+ L+ QK   ED++      A E    T+ L+ S    E+K+ 
Sbjct: 915  QLDQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDKATE----TENLKNSLSSLENKIT 970

Query: 1035 SLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKR 1094
            +L  ++ E+ K   + +N Y+++L   +  S  I ++  + + Y+T     ++    A  
Sbjct: 971  TLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKT-----SLDGLKANI 1025

Query: 1095 LLNENQISWQKQR--DE---YEKQIEFFKKRIEE-----ESEQNKMLFEQSKLTTQANDE 1144
               E+ IS  +Q+  DE   +E Q++ FK+ I+        ++ K  F  S+ +T +ND 
Sbjct: 1026 AAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDT 1085

Query: 1145 DNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLEL 1204
            D    + VN     N+L+L+LR ERD L  +L++++ E   LRE++ +++     T    
Sbjct: 1086 D---ETVVNDTSDKNELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSF 1142

Query: 1205 QKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHD 1264
            + ++ E        EQHK  + QL +L+ L+E+N  L+ +  E   +N  + T++E L +
Sbjct: 1143 KGLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKN 1202

Query: 1265 KXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERN 1324
            +                 KD+QL++  EE+ERWK RS++IL K Q++D  EH  L EE +
Sbjct: 1203 EMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELS 1262

Query: 1325 RLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLE 1384
             L+ QL+ K+K+NE+L +RF +LKKQAHEKL+A+K    SLT +I DL   K +L   L+
Sbjct: 1263 TLKTQLDTKTKDNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLD 1322

Query: 1385 TEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNS 1444
             E++    +E +L+    N   I +++ +L +++  SK  E     +V SS ++ + L  
Sbjct: 1323 EERKRIQEVESQLKQKPDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELNKKLTE 1382

Query: 1445 EIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKXXXXXXXXXXX 1504
            E+                E L      I   D   ++      + ES +           
Sbjct: 1383 EVNSLKSQL---------ETLKNQNGVISVADGSAINSETIAHLKESFEVEKTELITTLK 1433

Query: 1505 XXXXXXFKKKLQAEINKLKAEY----ETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEA 1560
                   +++ +  + + + EY     T   EP+ I++  ++ + EE+ E+   QRI +A
Sbjct: 1434 EEFKKQLEEEKKKLLEEKEKEYYDSKPTGGSEPIDIEK--MKSEWEEKQEEIIMQRIADA 1491

Query: 1561 EENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQ 1620
            EENLK+RIRLP+EEKIN+VI+KRR +LE E++ K++ +     T  E     + ++KE++
Sbjct: 1492 EENLKKRIRLPSEEKINRVIEKRRKELEEEYEKKLKRQGLTTETAIE-----EELRKEVE 1546

Query: 1621 EELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLES--------DLQNA-KSNT 1671
             EL  K++ EL  VKKKAF EG+QQ  MKT+ LE+K++KLES        DL+++ K NT
Sbjct: 1547 RELRVKFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQASPSRTPDLESSQKENT 1606

Query: 1672 -GATDNTI 1678
             GAT  T+
Sbjct: 1607 EGATKTTL 1614

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  289 bits (740), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 338/1245 (27%), Positives = 617/1245 (49%), Gaps = 166/1245 (13%)

Query: 476  IKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKV 535
            I+ +  QRSDLA+Q+QF L+       +   L+ +E  FIR + + D   + +  D+Q +
Sbjct: 383  IQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTEND--TYARNNDSQSI 440

Query: 536  ISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLT 595
            ISERL KF DI ELQ++NM++L T R LA +LEE++K++QA+                L 
Sbjct: 441  ISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKKALLD 500

Query: 596  LQNYNSSLTAKIAALTKELETYKVLSNTEDSST--PA---DFDKQ---REQREIEHTQ-- 645
            LQ Y +SL  K+    KE + YK+LS  +  S+  P+   D DK    + Q E++ T+  
Sbjct: 501  LQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECNDIDKHTTGKLQNELQQTREY 560

Query: 646  LVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQK 705
            L KE+E       + ++ N +ILN        K   +   + + +SAK+ AE + +L++ 
Sbjct: 561  LTKEIE-------KLTRTNKDILN--------KKKELEYSMKKMESAKEYAEGKAELIEN 605

Query: 706  SMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKL 765
            ++ M     + + ++ + L+ ++ +++ +  E    L +  S+   ++ ++  +Q++   
Sbjct: 606  NLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQSQSNS 665

Query: 766  LHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCND 825
            L +  +  + EL  + EEKN++K+ +  L+  ++E + + +T + K N+ L + +    D
Sbjct: 666  LRTQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNERLTEYQLHEQD 725

Query: 826  LRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRY-----SEI-----VEK 875
            L K +++ E              D  R  +    EE++  +K +     +EI     ++K
Sbjct: 726  LLKIIEKQE--------------DQIRDMEVKRAEELNWYQKNFPTQTETEIGLPVDMKK 771

Query: 876  ERETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKE--LQVLKNELTESYSQ 933
            E ET  ++ R T         +E  K+ S     L   SS++K   L V++   TE  S+
Sbjct: 772  EGETGRQSNRDT---------LESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEESK 822

Query: 934  TESYRKDIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNE 993
             E+ + D    +  +  + + V  KE     +I ++   K  +  S   ++ +   L+++
Sbjct: 823  -EAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQ 881

Query: 994  LEVQKKLYEDEKINFTRNANELERVTKG---LEQSKRDYEDKLKSLMKDLEEQVKYANKA 1050
            L+++K  ++ EK +     NEL+++ +     E +K+  ED L  +   LEE        
Sbjct: 882  LQLEKNSFDTEKASLN---NELDKIMENNSLTEVAKKSLEDDLHDVEMKLEE-------- 930

Query: 1051 QNNYEQELQNHANVSKTISQ-------LREQTQHYRTEIAELTISATDAKRLLNENQISW 1103
                  E Q H   + T+S+       + E+   YR E+++   SA        E Q+  
Sbjct: 931  ------ERQKHEETNATLSEKELLCEKMIEEISGYREELSK---SA--------EMQVDI 973

Query: 1104 QKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVL 1163
            Q  R E E  ++   KRI++   QN +L EQ   T    D  N +            +++
Sbjct: 974  QHTR-ELEDLLDLANKRIDDLCTQNNLLHEQLNATLDLEDTQNKDDI--------KDIIV 1024

Query: 1164 SLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETHNYP--DLLEQH 1221
             ++ ERD LQ++L + E E ++LRER   ++ +  A         ++ HN P  +LL  H
Sbjct: 1025 CMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAVS-----KGQQWHNLPLSNLLTGH 1079

Query: 1222 KTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKXXXXXXXXXXXXXXXX 1281
            + ++ +L ++ LLRE+N++L  E  +L+  N  L  E+  +                   
Sbjct: 1080 EKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFK 1139

Query: 1282 XKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELG 1341
             KD+++S+  +E ERWK+R Q ++ +      +E  N   E + L+  +EE++KE E+L 
Sbjct: 1140 EKDQEISLYKDEIERWKKRWQQMVHRQDDTLGLEA-NFKNEIDSLKGLIEERTKEKEKLS 1198

Query: 1342 NRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTM 1401
             +F+ LKKQAHEKL+A+KI   +L   +++++A   +L  ++  EK+ K+   + +E+T+
Sbjct: 1199 EKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQL-EEVMKEKDKKI---REIELTL 1254

Query: 1402 KNSHDIVSIQSQLEEALMKSKDF---ETKFINSVESSKQIEENLNSEIXXXXXXXXXXXX 1458
            K + +    +   +E L+  K F   E K   ++   +++ E LN E+            
Sbjct: 1255 KENLE----KFDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEV------------ 1298

Query: 1459 XXAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKXXXXXXXXXXXXXXXXXFKKKLQAE 1518
                     S  E  NV +   D   +N ++ +MK                   +K ++ 
Sbjct: 1299 --------VSLREEINVLRKKDDE--TNQLISTMKLDFEREKDRLIEEKVRELNEKFESG 1348

Query: 1519 INKLKAEYETKQIEPVSIDENA-----IRKQIEEEYEQATSQRIKEAEENLKRRIRLPTE 1573
             N    E  +KQ E V+ D        +++++ +++E+ T QRI+EA+ENLKR IRLP+E
Sbjct: 1349 RN----EVLSKQSENVTNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSE 1404

Query: 1574 EKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQEELARKYEEELQV 1633
            EKI ++I+KRR +LE++F  +VE +A  +   D+ +   D +K++++ EL    E++LQ 
Sbjct: 1405 EKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSPDELKQKVRRELEHAIEQDLQA 1464

Query: 1634 ----VKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGAT 1674
                ++ KAF+EG++Q  MKT+ LE+K++KLES  Q AK N   +
Sbjct: 1465 KLETIRTKAFEEGKRQAEMKTTLLERKLSKLES--QVAKDNESGS 1507

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  242 bits (618), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 370/1491 (24%), Positives = 710/1491 (47%), Gaps = 185/1491 (12%)

Query: 164  LLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGE 223
            +L+ E    + K+L++EN  Q  K N +S + + +  SQE E   + K W EERL    +
Sbjct: 141  VLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQEKELWLQNKKWTEERLSSCNQ 200

Query: 224  QFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQ 283
            +         +  Q+L+ +LN  + E + + + N  L ++  +LS+ + +    +KN++ 
Sbjct: 201  KALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKD 260

Query: 284  SRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREIN 343
            + N +K+   KE+TL++++  +L+SQL   +R +         D    + +  D   E+ 
Sbjct: 261  TANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEELI 320

Query: 344  DLKNQLNHVQERNVELEFKLRKS-------EDYTAVSNSTSSDDLRNSLAKAYDDIDVLK 396
            D K +L   +E     E +L K+       E+ T V+ +T++     ++ K + +I  LK
Sbjct: 321  DAKLKLEKSKE-----ECQLLKNIVSDCIEENGTTVNTNTAAP----TVGKLFSNIKTLK 371

Query: 397  KKLNDEQSQRENFEKNLEEFMDDLETELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS 456
            ++L  E+SQ+   +  L++F+ +LE + P                               
Sbjct: 372  RQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKR 431

Query: 457  LVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIR 516
                +L   + +I S E  I  + +QR DLA Q++  L + S    +  PL+++E+  +R
Sbjct: 432  KDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLR 491

Query: 517  NIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQA 576
             +++ ++ ++  E D+Q +I+E+L +FK+I ELQ+KNMELL   R LA KLE  +     
Sbjct: 492  KLLESENTVN--ERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADK 549

Query: 577  EKSRXXXXXXXXXXXXXLTLQNYNSSLTAKIAALTKELETYKVLSNTEDSSTPADFDKQR 636
              ++             + +++ NS L  ++  LT+E ++YK+L++  D+ T AD +   
Sbjct: 550  TVAKIENQTIKEAKEAIIEMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGIT 609

Query: 637  EQREIEHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLA 696
            E     + + ++EL+++++S   ES      LN ++    +      I L   ++ K L 
Sbjct: 610  EAT---YEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLV 666

Query: 697  EERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKW 756
             E+  +LQ+ ++   T+ E+  +RL++   V   QD + +  +  L  + +++ +++ + 
Sbjct: 667  AEKEAMLQERINHLKTQLEK--QRLSAAPPV---QDYK-YSNLTDLSHSENKIGSLKYEI 720

Query: 757  NVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKEL 816
            +  + E   L + +E L  +L R  +EK  + + ++  +T  +E+  +  + + +++  +
Sbjct: 721  SNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRI 780

Query: 817  NDLEGTCNDLRKKLKEAEENYGSLM-EETTELK------DDFRQKKKSLKEEMSNVEKRY 869
              LE    +L  +L+  E+   +L   + ++LK      DD  +  KS+  E+SN E   
Sbjct: 781  KVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTI 840

Query: 870  SEIVEKERETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTE 929
              +   E E      R+TK       L  K+ + + D   LE   +L+KEL+  + EL +
Sbjct: 841  GRL-SLEIENLGNELRMTK-------LQYKFLSNTSDTNTLE--PTLRKELKQTQIELKD 890

Query: 930  SYSQTESYRKDIELLNQSIADINK-------------QVLNKEAAFKERITEVELAKNNI 976
            ++SQ ++Y + I      + ++N              Q+ NKE   KE     EL+    
Sbjct: 891  AHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEE----ELSH--- 943

Query: 977  ADSNTVLKTQIDDLNNELEVQKKLYEDEK---INFTRNANELERVTKGLEQSKRDYEDKL 1033
                  L+ ++D++     +Q KL E      +   +  ++ +R+     Q  ++  DK+
Sbjct: 944  ------LRKELDEIRC---LQPKLREGASYLVLQSEKVGDQAQRI-----QEMKNKIDKM 989

Query: 1034 KSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAK 1093
             ++++       Y  +  + Y+ EL+ + ++S+ + +L ++   Y+TE+ +   S    +
Sbjct: 990  AAIIE------AYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYSTQ 1043

Query: 1094 RLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVN 1153
             LL+ ++  W +++ +YE+++    ++ E    +N +L E+    T+          G N
Sbjct: 1044 ELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIDGATE----------GSN 1093

Query: 1154 SIEGDNKLV---LSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDF----RATDLELQK 1206
            S E   +LV    +LR ER  L+ +L   + +  LLR++  S+EK      RA  +   K
Sbjct: 1094 SNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNK 1153

Query: 1207 IKEETHNYPD-LLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDK 1265
            ++      P  ++++++ ++ ++ Q+++LRE+N  L      +  KN+ +  E+ N+ ++
Sbjct: 1154 VQ-----CPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEE 1208

Query: 1266 XXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNR 1325
                                ++     E E+ KQR QD LS+ Q++    H+N  E+ + 
Sbjct: 1209 ISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQD-LSQQQKLT---HKNETEKLHN 1264

Query: 1326 LQAQLEEK----SKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLS 1381
            +   LE K       N +L N+F +LKKQAHEKL+ASK  Q +LT ++N+L+  K +L  
Sbjct: 1265 VIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEE 1324

Query: 1382 QLETEKEGKLSLEKRLE------VTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESS 1435
             L  E+   + LE +L+        +   HD ++ +  +EE            I S++  
Sbjct: 1325 NLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEE------------IESLKKE 1372

Query: 1436 KQIEENLNSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGN--VDQDTVDGGVSNDIVESMK 1493
             Q+  N N                 A EK+  +  E  N  +D+ T D            
Sbjct: 1373 LQVFRNAND-------------ASDAFEKIKNNMEEEKNKIIDEKTKD------------ 1407

Query: 1494 XXXXXXXXXXXXXXXXXFKKKLQAEINKLKA-EYETKQIEPVSIDENAIRKQIEEEYEQA 1552
                             F+KKLQ  +NK K+ E E +  E +     A++K+  +EYE+ 
Sbjct: 1408 -----------------FEKKLQDAVNKSKSNESEVENSEHIE----ALKKEWLKEYEEE 1446

Query: 1553 TSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELL 1603
            T +RIKEAEENLK+RIRLP+EE+I K+I KR+ +LE EF+ K++   K L+
Sbjct: 1447 TVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLV 1497

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  239 bits (609), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 357/1412 (25%), Positives = 636/1412 (45%), Gaps = 157/1412 (11%)

Query: 376  TSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTXXXXXXXXX 435
            T +D+  +S+++  ++I +L  +L  E   ++  EK + +F+ +LE   P          
Sbjct: 276  TGNDETSHSMSELNNNISILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSE 335

Query: 436  XXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLV 495
                                  +  E+ Q + +++ I  + K++ ++R DLA QLQ+ L+
Sbjct: 336  QSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLL 395

Query: 496  HNSVANDSAGPLTDEEVKFIRNIIQED-DEMHDKETDTQKVISERLTKFKDIIELQQKNM 554
             N    DS  PLT  E  +I+ I+  D +E +   TD+Q +IS+R+ KFK I+ELQQ+N+
Sbjct: 396  -NGFVKDSDDPLTSSEFSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNI 454

Query: 555  ELLKTTRELA-------TKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYNSSLTAKI 607
             LL   R L+        KLE  D I+   +++             L LQ YNSSL AK+
Sbjct: 455  NLLSAVRTLSDRAETLERKLESGDSIEAINEAKQTL----------LDLQQYNSSLEAKV 504

Query: 608  AALTKELETYKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQESKENANI 667
             +LT +L+  +  ++  D     +F       ++     ++ L+ +  S++ ES E    
Sbjct: 505  ESLTNKLKANEHFTSIGD----GEFGNS----DLSDGNNIQALKNKYDSLMAESSETIGH 556

Query: 668  LNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNV 727
            L  +I  L +  + ++ E     ++K L E+RLK+ Q  +D++  EN  L+ R+ +    
Sbjct: 557  LYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQA 616

Query: 728  VVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSM 787
            + E++  T +TI   +   ++L  ++ +   +  E  +L +++  ++N+L +  +E+N+ 
Sbjct: 617  LKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNF 676

Query: 788  KLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGS-LMEETTE 846
            + L+ +L+ LQ  ++  L   Q     +++DLE    +LR K+   E +  S L     E
Sbjct: 677  QGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAE 736

Query: 847  LK------DDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKY 900
            L+      D       +L E+M         +  K +        L ++   K +L+E  
Sbjct: 737  LEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDI----LLQEANSKNKLLEAR 792

Query: 901  KAASDDEGKLEEISSLQKELQVLKNELTESYSQTE-------SYRKDIELLNQSIADINK 953
            +   DD  KL    +L+ EL   +  LT++  + E        Y+ +I++LN        
Sbjct: 793  ETV-DDVNKL--TGALETELATSRTRLTDTSRELEISSNTIRQYQSEIKVLN-------- 841

Query: 954  QVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNAN 1013
                      ER +E+E       + N  L+ +I  L +EL      +E EK    +  +
Sbjct: 842  ----------ERQSELE-------NENKHLRDEIAILRDELTHNGGEFEREKEALMKKLS 884

Query: 1014 ELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLRE 1073
             LE     L + + DY  +++ L  DL++Q     + +  +++E++   N          
Sbjct: 885  NLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQN---------R 935

Query: 1074 QTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFE 1133
             T+ YR E+  + I  T   ++  E +   + +     +QIE  K+R+++ S++  +L E
Sbjct: 936  NTETYRNELELVEIRQT---KVFVEKEKELESRIKILNEQIELDKERMKQFSDEESLLRE 992

Query: 1134 QSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSI 1193
            Q KL       D  + +GV+    D  LV  L  E+  L+ +L  +++E+  LRE+LT  
Sbjct: 993  QVKLLADEKASDLVD-AGVSPEYTD--LVRKLSDEKKNLESKLFASQSEKNRLREQLTKT 1049

Query: 1194 EKDFRATDLELQKIKE----ETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQ 1249
            E +    ++  ++ K+    E +N     E+H      + QL+ L+ESN++L NE    Q
Sbjct: 1050 ESEIAVLNMNYEQAKKEVAAEVNNESGRAEEH------IAQLESLKESNMSLTNEVKLAQ 1103

Query: 1250 SKNQHLQTEVENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQ 1309
             +N  +  E+  L  K                 KD +L     E  R K  S D+     
Sbjct: 1104 MRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGN 1163

Query: 1310 RIDPVEHEN-LAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQ 1368
            +    E    L      L  Q++     N EL +RF +LK+QA E+L+ASK++ NSL   
Sbjct: 1164 KDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDN 1223

Query: 1369 INDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMKSKDFETKF 1428
            +  L   K  L   +E  K+    L  +++  ++ S  +  ++++L   + K+KD E + 
Sbjct: 1224 VETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAEL 1283

Query: 1429 INSVESSKQIEENLNSEIXXXXXXXXXXXXXXAHEKLTTSTTEIGNVDQDTVDGGVSNDI 1488
              + +SS Q+   LN EI               + K  +S    GN +   V        
Sbjct: 1284 NETSKSSNQLTTALNEEIESLKHEVQ-------YLKEASSAEPQGNEEMSGV-------- 1328

Query: 1489 VESMKXXXXXXXXXXXXXXXXXFKKKLQAEINKLKAEYETKQIEPVSI--------DEN- 1539
            VESM+                  + +L  E  KLK E E  + E  S+        +EN 
Sbjct: 1329 VESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENT 1388

Query: 1540 AIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARA 1599
            A+ K   +  +  T Q+  EA    K R+ L  +EK ++++  +  +LE +FQN+V  + 
Sbjct: 1389 ALMKARSDVPDIETLQKQWEASN--KERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNKE 1446

Query: 1600 KELLTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITK 1659
            KEL          + +K EI+E+    +E+ L  VKK+AF+EG+QQ  MK S LE+KI K
Sbjct: 1447 KEL----------NALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAK 1496

Query: 1660 LESDLQNAKSNTGAT---DNTIVSTDNETKYEGSDKKP--VTINTNVVSDVGENNAERTP 1714
            LE++ +  KS +  +   D     T N  K + ++ +P   T  +       E+N   TP
Sbjct: 1497 LEAESKATKSGSDMSVSEDAPRFVTPNNNKVQQAN-QPFLATAGSGFSVQSSESNPFTTP 1555

Query: 1715 M------------NKF-PRAIMN---PLLSNG 1730
            +            +KF P  ++N   P+L +G
Sbjct: 1556 VSRGAAHTNASSQSKFAPTFLLNSQPPVLVSG 1587

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  204 bits (518), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 311/1298 (23%), Positives = 620/1298 (47%), Gaps = 110/1298 (8%)

Query: 124  LIQIHSLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSK------------ 171
            L ++H+L      L++++ +  + +D    +LN  ++ I  LN+E+              
Sbjct: 80   LSRLHNL------LKNERSKCARKIDALNKQLNASKNTITKLNDERGVKEEAEVLKAEHQ 133

Query: 172  ---------------TRNKILQLENENQDLKINDLSQRTQLERLSQELETINKEKLWLEE 216
                            R K+L++EN  Q  K N LS + + + + QE E I + K W+EE
Sbjct: 134  NNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQEKELILENKKWMEE 193

Query: 217  RLGEKGEQF---DSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQERTDELSNKLRD 273
            +L  + E+    D  R   +   Q+L+ QLN  +N+ + + + N  L  +  +LS+ +  
Sbjct: 194  QLSFRDEKTLVDDVTRTSHV---QNLEEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQ 250

Query: 274  TSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSLTVSDTASSSR 333
                +KN++ + N +KA   KE+TL++ +  +L+SQL   ++          +D    + 
Sbjct: 251  KILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSAREKDNDDPCKNS 310

Query: 334  KDSDFTREINDLKNQLNHVQERNVELEFKLRKS--EDYTAVSNSTSSDDLRNSLAKAYDD 391
            + ++   ++ D K QL   ++    L+  +     ED  A  N+ + D    S+ K + D
Sbjct: 311  QHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDP---SVNKVFSD 367

Query: 392  IDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTXXXXXXXXXXXXXXXXXXXXXXXXX 451
            I  LK++L  E++Q+   +  +E F+ +LE + P                          
Sbjct: 368  IKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETI 427

Query: 452  XXXXSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEE 511
                     EL   + +I + E  I  + KQR DLA Q++  L++ S     A PL+++E
Sbjct: 428  SLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDE 487

Query: 512  VKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEED 571
            +  ++ +++  D  ++K  D+Q +I+ERL +F +  ELQ+KNMELL   R LA KLE  +
Sbjct: 488  LISLKKLLESGDVPNEK--DSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHE 545

Query: 572  KIKQAEKSRXXXXXXXXXXXXXLTLQNYNSSLTAKIAALTKELETYKVLSNTEDSSTPAD 631
              +    ++             + L++ NS+L ++I  L++E ++YK+L++   +   AD
Sbjct: 546  GKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYAD 605

Query: 632  FDKQREQREIEHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAREKS 691
               + E   ++    +KELE+ ++    E+      LN ++    +  ++  I L    +
Sbjct: 606  AANKTEAANLKK---IKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSN 662

Query: 692  AKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELAT 751
             K LA E+  LLQ  +D   T   +L+K+ +S  + +       H +I S     +EL+ 
Sbjct: 663  FKVLAIEKENLLQTRIDDLKT---KLEKQRSSAPSSI-------HGSIGS---EETELSQ 709

Query: 752  VENKWNVSQNEIKL-------LHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHL 804
             +NK      EI         L   +E L  +L R  +EK  +++ +T  +T  +E++  
Sbjct: 710  YKNKTKSLMCEISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLK 769

Query: 805  LSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSL-MEETTELK------DDFRQKKKS 857
              + Q ++N ++ +LE  C +L  +L    +   +L   + ++LK      DD  +  KS
Sbjct: 770  SDSKQVQYNTKIKNLEKNCEELNNRLHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKS 829

Query: 858  LKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQ 917
            L  ++S  EK+ +      R+   E   L  +L +KT+L  K    S D   LE  ++L+
Sbjct: 830  LSTDLS--EKKTT-----IRKLSLEMKDLEIEL-QKTKLQYKLLNNSSDANTLE--TALK 879

Query: 918  KELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIA 977
            KEL+  + +L +++SQ E+Y + I     ++ ++N Q+   +   K +   ++   N   
Sbjct: 880  KELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKE 939

Query: 978  DSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLM 1037
            +  + L+ ++D++     +Q KL E   +   + + +L   T+ + Q+  +  DK+ +++
Sbjct: 940  EEISFLRRELDEIRG---LQPKLKEG-ALRLVQQSEKLGNQTQRI-QAMNEKIDKMTTIV 994

Query: 1038 KDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLN 1097
             +L ++V+ +      Y+ +L+ + ++S  + +L  +   Y+TE+ +   S    + LL+
Sbjct: 995  -ELHQEVETS-----QYQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLD 1048

Query: 1098 ENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEG 1157
            +++  W +++ +YE+++    ++ E    +N  L E+        D+   E++G      
Sbjct: 1049 KHERKWMEEKADYERELISNIEQTESLRVENSALVEKI-------DDGTGENNGDKEYLK 1101

Query: 1158 DNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEK---DFRATDLELQKIKEETHNY 1214
               L  SLR ER+ L+ +L   + +  L +++  ++EK   D + T L  +K   +    
Sbjct: 1102 LVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRK---DVQCS 1158

Query: 1215 PDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKXXXXXXXXX 1274
             D++++ + +M ++ Q+++L+E+N  L+    ++  KN+ +  E  +L  +         
Sbjct: 1159 TDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLA 1218

Query: 1275 XXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKS 1334
                       ++ +   E E+WKQR  ++  + +     E E L  E + L+A+L    
Sbjct: 1219 QTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISDLKAKLLNAQ 1278

Query: 1335 KENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDL 1372
              N +L ++F +LKKQAHEKL+ASK  Q +LT ++++L
Sbjct: 1279 NANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDEL 1316

 Score = 73.6 bits (179), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 86/162 (53%), Gaps = 19/162 (11%)

Query: 1541 IRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAK 1600
            ++KQ  ++YE+ T +RIKEAEENLK+RIRLP+EE+I K+I KR+ +LE EFQ K++A + 
Sbjct: 1434 LKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSG 1493

Query: 1601 ELLTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKL 1660
                  +K E     + ++    ++   E+  VV               T+ + +K   L
Sbjct: 1494 SFTLSSDKKENEVNAEDDLWNSPSKGNSEKPSVV---------------TNLIRQKNLIL 1538

Query: 1661 ESDLQNAKSNTGATDNTIVSTDNETKYEGS----DKKPVTIN 1698
            +  L+N K    + D+   S++ E    GS    +K P+  N
Sbjct: 1539 QEQLKNPKKGIISNDSRPTSSNKENDIPGSTTAENKAPLAFN 1580

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  191 bits (484), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 255/941 (27%), Positives = 428/941 (45%), Gaps = 184/941 (19%)

Query: 830  LKEAEENY-GSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEI-------VEKERETKW 881
            +K + ENY    + E  E     ++    LK E+  ++ + SE+        E E++   
Sbjct: 377  IKNSRENYDNDTINEAKETILSLQEYNNVLKLEIGTLQSKISELQSSIPNSKESEKQHFN 436

Query: 882  ENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDI 941
             ++ L K L+ K   +  Y  ++        I +L K++Q L NE T+     E  +   
Sbjct: 437  YHSNLVKDLESKLSKLSAYSQST--------IENLNKDIQNLYNERTDILINLEKEKSST 488

Query: 942  ELLNQSIADI----------NKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLN 991
             L N+ +  +          N+++ +K +  ++++ E E   N++ +     KT + D  
Sbjct: 489  ILANEKLTLLQNSYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFT 548

Query: 992  NELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQV-KYANKA 1050
            N L     L  + K+      N L++  K   +  +D + K K L + LE ++ KY +K 
Sbjct: 549  NRL----TLLNNNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKV 604

Query: 1051 QNNYEQELQNHANVSKTISQ---LREQTQHYRTEIAELTISATDAKRLLNENQISW-QKQ 1106
            +   E EL    N+SK   Q   L  + Q+   EI +L  S  D        QISW QK+
Sbjct: 605  K---ELEL----NISKLNEQKLILERKLQNKNIEIDDLNSSNYD--------QISWYQKK 649

Query: 1107 RDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIE----GD---- 1158
             D+YEK I+  + R+  +++ +K L E   L    +    + S+  N I     GD    
Sbjct: 650  LDQYEKTIKTLESRLPADTQNSKALVEDKALEDSRDASPVSSSASCNEITIRIFGDSNKT 709

Query: 1159 --------------------------------NKLVL----------------SLRSERD 1170
                                            N+L+L                SLR ERD
Sbjct: 710  KKIYPIEEEKNLELITKELEDTKVRVQNLATQNRLLLEKLERSANLEVDDIFVSLRYERD 769

Query: 1171 LLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHK-------T 1223
             L +++   E + +++   L S++ +  A + ++        N   +++ HK       T
Sbjct: 770  TLSDQVVNYEKDMQVILADLESVQSELNAANSQILNF----ENQRAMVQDHKKGNVNEET 825

Query: 1224 VMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKXXXXXXXXXXXXXXXXXK 1283
            ++ +LT+LD L+E N+ L  E   L   N  L+ ++E   ++                 K
Sbjct: 826  LIEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDK 885

Query: 1284 DKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNR 1343
            D  +++ +E++E WK R       +  +      N  E+   LQ Q+EEKSKENEEL +R
Sbjct: 886  DNIINVSNEKAENWKTR-------FNELTLSAKNNDNEDLINLQKQVEEKSKENEELSDR 938

Query: 1344 FEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKN 1403
            F +LKKQA+E+L+ASK++QN+LT Q N+L+A+  +L   L  + E    LE  + +  + 
Sbjct: 939  FNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQE 998

Query: 1404 SHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNSEIXXXXXXXXXXXXXXAHE 1463
               I  ++ QL  AL KSK FE + I +V  S+ +  +L +EI               +E
Sbjct: 999  LGSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNEI------------ESLNE 1046

Query: 1464 KLTTSTTEIGNVDQDTVDGGVSNDIVESMKXXXXXXXXXXXXXXXXXFKKKLQAEINKLK 1523
            KL +  + +G + +  ++      I E                        L+ ++NK K
Sbjct: 1047 KLKSKESSVG-LQESEIENAKKILIAE------------------------LEEKLNKTK 1081

Query: 1524 AEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKR 1583
            +E + K  E + +        ++ EYE    +R+ EAEE LKR+IRLP+EEKIN +I+ +
Sbjct: 1082 SELDLKHKEELKV--------LKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESK 1133

Query: 1584 RTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGR 1643
               LE +++ K+E  + E  + D      +++K+E        +E+ L   KKKAF+EG+
Sbjct: 1134 VADLEEDYKKKLETVSAE--STD-----IEKIKQE--------FEDNLVNAKKKAFEEGK 1178

Query: 1644 QQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVSTDNE 1684
            QQ  MKT FLE KI KLES LQN +S+    +  + +TDNE
Sbjct: 1179 QQASMKTKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNE 1219

 Score =  138 bits (347), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 156/281 (55%), Gaps = 12/281 (4%)

Query: 482 QRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLT 541
           QR+DLA+QLQ+ L+H+S+ ND+ GPL+  E+ F++N+I +D +     +D Q VIS+RL 
Sbjct: 287 QRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLS--SDVQSVISDRLI 344

Query: 542 KFKDIIELQQKNMELLKTTRELATKLE-EEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYN 600
           KFKDI+ LQ+KNMEL K+ R LA  LE +E +IK + +               L+LQ YN
Sbjct: 345 KFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNS-RENYDNDTINEAKETILSLQEYN 403

Query: 601 SSLTAKIAALTKELETYKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQE 660
           + L  +I  L  ++   +       SS P   + +++     H+ LVK+LE++++ +   
Sbjct: 404 NVLKLEIGTLQSKISELQ-------SSIPNSKESEKQHFNY-HSNLVKDLESKLSKLSAY 455

Query: 661 SKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKR 720
           S+     LN  I  L  +   I I L +EKS+  LA E+L LLQ S D+   ENE L  +
Sbjct: 456 SQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDLLTLENEELSSK 515

Query: 721 LNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQN 761
            + L   + E++K  +  +N  IK ++ L    N+  +  N
Sbjct: 516 NSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLLNN 556

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  191 bits (484), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 378/1562 (24%), Positives = 721/1562 (46%), Gaps = 186/1562 (11%)

Query: 165  LNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQ 224
            LN E    R K++++EN  Q  K N +S + + +   QE E + + K  +EE+L      
Sbjct: 142  LNKENKLLRRKLMEMENILQRCKSNAISLQLKYDTSVQEKELMLQSKKLIEEKLS----- 196

Query: 225  FDSYREKSINENQDLKLQLNTVKNELDQMKST-------NCVLQERTDELSNKLRDTSTN 277
              S+ +K++ E       +  ++ +L QM+S        N  L  +  +LS  + +    
Sbjct: 197  --SFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLE 254

Query: 278  LKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSLTVSDTASSSRKDSD 337
            +KN++ + + +KA   KE+TL++ +  +L+SQL  L+++          D +  + + +D
Sbjct: 255  MKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTD 314

Query: 338  FTREINDLKNQL----NHVQE-RNVELEFKLRKSEDYTAVSNSTSSDDLRNSLAKAYDDI 392
               E+ D K +L    N  Q  +N+ ++    K E+ T  +++ S      ++ K + DI
Sbjct: 315  VIDELIDTKLRLEKSKNECQRLQNIVMD--CTKEEEATMTTSAVSP-----TVGKLFSDI 367

Query: 393  DVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTXXXXXXXXXXXXXXXXXXXXXXXXXX 452
             VLK++L  E++Q+   +  LE+F+ +LE + P                           
Sbjct: 368  KVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELLETVS 427

Query: 453  XXXSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEV 512
                    E+   + +I   E  I  + KQR DLA Q++  L++ S   ++A PL+ +E+
Sbjct: 428  LTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDEL 487

Query: 513  KFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDK 572
              +R I++  + ++  E D+Q +I+ERL +F ++ ELQ+KN+ELL   R LA KLE  + 
Sbjct: 488  ISLRKILESSNIVN--ENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLENYEG 545

Query: 573  IKQAEKSRXXXXXXXXXXXXXLTLQNYNSSLTAKIAALTKELETYKVLSNTED----SST 628
             +     +             + L+N N+ +  +I  L +E ++YK+L++TE+    +++
Sbjct: 546  KQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENKANTNS 605

Query: 629  PADFDKQREQREIEHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNHISIELAR 688
                +  RE++       ++ELE  ++S   E+      L  ++    +        L  
Sbjct: 606  VTSMEAAREKK-------IRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLED 658

Query: 689  EKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSE 748
             ++ K LA+E+ ++L++++D    E E+ +  + S   + VE+++ + E   S IK +S 
Sbjct: 659  FENFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSY--IHVEKERASTELSQSRIKIKS- 715

Query: 749  LATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTT 808
               +E + +  + E      ++E L  +  +  +EK  +++ +   +   +E +   S+ 
Sbjct: 716  ---LEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSK 772

Query: 809  QDKFN---KEL-NDLEGTCNDLRKKLKEAEE---NYGSLMEETTELKDDFRQKKKSLKEE 861
            + ++    KEL N+LE   +DL+ K++E E       S ++      DD   K KSL  E
Sbjct: 773  EGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTE 832

Query: 862  MSN----VEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQ 917
            +SN    +EK  SEI         EN  L K+L+ KT+   K+   + D   LE   +L+
Sbjct: 833  LSNKETTIEKLSSEI---------EN--LDKELR-KTKFQYKFLDQNSDASTLE--PTLR 878

Query: 918  KELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIA 977
            KEL+ ++ +L ++ SQ ++Y + I     ++ ++  ++   +  +  +I   EL K    
Sbjct: 879  KELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKI---ELEKKEKW 935

Query: 978  DSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNA----NELERVTKGLEQSKRDYEDKL 1033
                 L     +L     +Q KL E   ++F + +    NE+ER+ K +E+      +K+
Sbjct: 936  AREEDLSRLRGELGEIRALQPKLKEG-ALHFVQQSEKLRNEVERIQKMIEKI-----EKM 989

Query: 1034 KSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAK 1093
             ++++  ++      K  + Y+  ++ + ++S+ + +L +     + E+ +   S   A+
Sbjct: 990  STIVQLCKK------KEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQ 1043

Query: 1094 RLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDEDNAESSGVN 1153
             LL++++  W +++ +YE+++    ++ E    +N +L E+    T AN+ D      V+
Sbjct: 1044 DLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD-DTAANNGDKDHLKLVS 1102

Query: 1154 SIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLE-LQKIKEETH 1212
                   L  +LR ER+ L+ +L   + E   ++++  S+EK     DL+  Q + E+ +
Sbjct: 1103 -------LFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTI--NDLQRTQTLSEKEY 1153

Query: 1213 NYPD-LLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKXXXXXX 1271
                 ++++ K +  ++TQ+++L+E+N  L+     +  KN+ +  ++ +  ++      
Sbjct: 1154 QCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQR 1213

Query: 1272 XXXXXXXXXXXKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLE 1331
                          ++ +   E E+ KQR QD+                      Q Q +
Sbjct: 1214 DLIQTKEQVSINSNKILVYESEMEQCKQRYQDLS---------------------QQQKD 1252

Query: 1332 EKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKL 1391
             + K+ E+L N    LK +     NA+            DLE K     ++L+ +   KL
Sbjct: 1253 AQKKDIEKLTNEISDLKGKLSSAENANA-----------DLENK----FNRLKKQAHEKL 1297

Query: 1392 SLEKRLEVTMKNS-HDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNSEIXXXX 1450
               K+ +  + N  +++ +I+ +LE+ L     FE   +  +++  +  E L SE     
Sbjct: 1298 DASKKQQAALTNELNELKAIKDKLEQDL----HFENAKVIDLDTKLKAHE-LQSE----- 1347

Query: 1451 XXXXXXXXXXAHEKLTTSTT--EIGNVD---QDTVDGGVSNDIVESMKXXXXXXXXXXXX 1505
                       HEK T  T   EI ++    Q       S+D  E +K            
Sbjct: 1348 ------DVSRDHEKDTYRTLMEEIESLKKELQIFKTANSSSDAFEKLKVNMEKEKDRIID 1401

Query: 1506 XXXXXFKKKLQAEINKL---KAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEAEE 1562
                 F+KKLQ  +NK    +AEY +K IE        ++K+  +EYE  T +RIKEAEE
Sbjct: 1402 ERTKEFEKKLQETLNKSTSSEAEY-SKDIE-------TLKKEWLKEYEDETLRRIKEAEE 1453

Query: 1563 NLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQEE 1622
            NLK+RIRLP+EE+I K+I KR+ +LE EF+ K++  A  L   D K    D         
Sbjct: 1454 NLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLTFLDNKGSGED--------- 1504

Query: 1623 LARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVSTD 1682
                 EEEL     K   E    V     F+ +K  K +  L+N K++    D+  + T+
Sbjct: 1505 ----AEEELWNSPSKGNSERPSAV---AGFINQKNLKPQEQLKNVKNDVSFNDSQSMVTN 1557

Query: 1683 NE 1684
             E
Sbjct: 1558 KE 1559

 Score =  172 bits (436), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 317/1361 (23%), Positives = 638/1361 (46%), Gaps = 143/1361 (10%)

Query: 122  SKLIQIHSLEENVSELQSKKQELIKSLDDRITE-LNEYRHNIEL---------------- 164
            S++ ++  L +  SE ++  +E +  L D++ E  + YR  I+                 
Sbjct: 57   SRISKLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVN 116

Query: 165  -------------------------LNNEKSKTRNKILQLENENQDLKINDLSQRTQLER 199
                                     LN E    R K++++EN  Q  K N +S + + + 
Sbjct: 117  DEKRVKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQLKYDT 176

Query: 200  LSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKST--- 256
              QE E + + K  +EE+L        S+ +K++ E       +  ++ +L QM+S    
Sbjct: 177  SVQEKELMLQSKKLIEEKLS-------SFSKKTLTEEVTKSSHVENLEEKLYQMQSNYES 229

Query: 257  ----NCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNE 312
                N  L  +  +LS  + +    +KN++ + + +KA   KE+TL++ +  +L+SQL  
Sbjct: 230  VFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTS 289

Query: 313  LQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQL----NHVQE-RNVELEFKLRKSE 367
            L+++          D +  + + +D   E+ D K +L    N  Q  +N+ ++    K E
Sbjct: 290  LEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMD--CTKEE 347

Query: 368  DYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTX 427
            + T  +++ S      ++ K + DI VLK++L  E++Q+   +  LE+F+ +LE + P  
Sbjct: 348  EATMTTSAVSP-----TVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPEL 402

Query: 428  XXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLA 487
                                             E+   + +I   E  I  + KQR DLA
Sbjct: 403  ISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLA 462

Query: 488  NQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDII 547
             Q++  L++ S   ++A PL+ +E+  +R I++  + ++  E D+Q +I+ERL +F ++ 
Sbjct: 463  RQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVN--ENDSQAIITERLVEFSNVN 520

Query: 548  ELQQKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYNSSLTAKI 607
            ELQ+KN+ELL   R LA KLE  +  +     +             + L+N N+ +  +I
Sbjct: 521  ELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRI 580

Query: 608  AALTKELETYKVLSNTED----SSTPADFDKQREQREIEHTQLVKELETRIASIIQESKE 663
              L +E ++YK+L++TE+    +++    +  RE++       ++ELE  ++S   E+  
Sbjct: 581  NILLRERDSYKLLASTEENKANTNSVTSMEAAREKK-------IRELEAELSSTKVENSA 633

Query: 664  NANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNS 723
                L  ++    +        L   ++ K LA+E+ ++L++++D    E E+ +  + S
Sbjct: 634  IIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAELEKQKSWVPS 693

Query: 724  LRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEE 783
               + VE+++ + E   S IK +S    +E + +  + E      ++E L  +  +  +E
Sbjct: 694  Y--IHVEKERASTELSQSRIKIKS----LEYEISKLKKETASFIPTKESLTRDFEQCCKE 747

Query: 784  KNSMKLLVTRLQTLQSEREHLLSTTQDKFN---KEL-NDLEGTCNDLRKKLKEAE---EN 836
            K  +++ +   +   +E +   S+ + ++    KEL N+LE   +DL+ K++E E     
Sbjct: 748  KKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSC 807

Query: 837  YGSLMEETTELKDDFRQKKKSLKEEMSN----VEKRYSEIVEKERETKWENTRLTKQLKE 892
              S ++      DD   K KSL  E+SN    +EK  SEI         EN  L K+L+ 
Sbjct: 808  KDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEI---------EN--LDKELR- 855

Query: 893  KTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADIN 952
            KT+   K+   + D   LE   +L+KEL+ ++ +L ++ SQ ++Y + I     ++ ++ 
Sbjct: 856  KTKFQYKFLDQNSDASTLE--PTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELK 913

Query: 953  KQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNA 1012
             ++   +  +  +I   EL K         L     +L     +Q KL E   ++F + +
Sbjct: 914  NELAKTKENYDAKI---ELEKKEKWAREEDLSRLRGELGEIRALQPKLKEG-ALHFVQQS 969

Query: 1013 ----NELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTI 1068
                NE+ER+ K +E+      +K+ ++++  ++      K  + Y+  ++ + ++S+ +
Sbjct: 970  EKLRNEVERIQKMIEKI-----EKMSTIVQLCKK------KEMSQYQSTMKENKDLSELV 1018

Query: 1069 SQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQN 1128
             +L +     + E+ +   S   A+ LL++++  W +++ +YE+++    ++ E    +N
Sbjct: 1019 IRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVEN 1078

Query: 1129 KMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRE 1188
             +L E+    T AN+ D      V+       L  +LR ER+ L+ +L   + E   +++
Sbjct: 1079 SVLIEKVD-DTAANNGDKDHLKLVS-------LFSNLRHERNSLETKLTTCKRELAFVKQ 1130

Query: 1189 RLTSIEKDFRATDLE-LQKIKEETHNYPD-LLEQHKTVMSQLTQLDLLRESNITLRNETI 1246
            +  S+EK     DL+  Q + E+ +     ++++ K +  ++TQ+++L+E+N  L+    
Sbjct: 1131 KNDSLEKTI--NDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLK 1188

Query: 1247 ELQSKNQHLQTEVENLHDKXXXXXXXXXXXXXXXXXKDKQLSICHEESERWKQRSQDILS 1306
             +  KN+ +  ++ +  ++                    ++ +   E E+ KQR QD+  
Sbjct: 1189 NVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQ 1248

Query: 1307 KYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLT 1366
            + +     + E L  E + L+ +L      N +L N+F +LKKQAHEKL+ASK  Q +LT
Sbjct: 1249 QQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALT 1308

Query: 1367 IQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNSHDI 1407
             ++N+L+A K +L   L  E    + L+ +L+     S D+
Sbjct: 1309 NELNELKAIKDKLEQDLHFENAKVIDLDTKLKAHELQSEDV 1349

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  167 bits (424), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 270/1127 (23%), Positives = 516/1127 (45%), Gaps = 88/1127 (7%)

Query: 138  QSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQL 197
            Q  K EL+K L++RI +++  + ++  +  E         +L  E +  K   L  RTQL
Sbjct: 71   QETKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQL 130

Query: 198  ERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTN 257
            ++++  L    K+K   E     K + F+SY+++   E Q++   L  + NEL      N
Sbjct: 131  DKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKN 190

Query: 258  CVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQREN 317
              L +R +ELS  LR   + +K+++ S          E  L+ QLI  LQ+Q+  LQ E 
Sbjct: 191  AELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQ-EQ 249

Query: 318  GNELSLTVSDTASSSRKD-SDFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAVSNST 376
               LS    D   + + D  +  R+I +L  +L   +   + L   + + ++     +S+
Sbjct: 250  LESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPEEESSS 309

Query: 377  S---SDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTXXXXXXX 433
                +    NS      D+++L+K    E+ Q+   E+ + + + +LE  +P+       
Sbjct: 310  VSSHASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSYKER 369

Query: 434  XXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFF 493
                                     S+EL + +S   ++   I  +A QR+ LA Q+++ 
Sbjct: 370  STFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYL 429

Query: 494  L--VHNSVANDSAGP-LTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQ 550
            L  + N   N++ G  L  ++++ +   +  +    +  +D++K++ ERL +FK++ ELQ
Sbjct: 430  LLIIQN---NETLGSSLGRKDLELLGQYLAAN--TAEAMSDSEKILLERLAQFKNVKELQ 484

Query: 551  QKNMELLKTTRELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYNSSLTAKIAAL 610
             +NM+LL+ +RELA+K E+ +K+   + S              L LQ Y+  L ++I  L
Sbjct: 485  NRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKEL 544

Query: 611  TKEL----------ETYKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQE 660
            + EL          E+   +S  ED ++    D                L  ++++ ++ 
Sbjct: 545  SDELAVQKKEKTEKESISAMSKIEDDASSHTID----------------LGKQLSANLKH 588

Query: 661  SKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKR 720
            SK+  + LN +I  L + N  ++I L +EKSA++LAE+R  LL+ ++ +  +E E LQ+ 
Sbjct: 589  SKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEE 648

Query: 721  LNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRL 780
            +N L+  +++++K+   +    I  +S+L+T E +    + E +L   ++  L+ +   L
Sbjct: 649  VNKLQQNILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEAL 708

Query: 781  NEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSL 840
              E+N++++ VT++ +L +E + LL  T+  ++ +L      C     +L+  +      
Sbjct: 709  LNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQ------ 762

Query: 841  MEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKY 900
                        Q+   LK +  +  K Y   ++  +   +E   L ++LK+K E IE++
Sbjct: 763  ------------QRMSELKSQNDSEIKWYKATIDDLKANVFE---LNEELKQKEEKIEEF 807

Query: 901  KAASD---DEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLN 957
                +   +E  L     + +E + L+ EL+E  SQ E    +++     I+   +   N
Sbjct: 808  SKTLENVQNELTLANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFEN 867

Query: 958  KEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELE- 1016
            K   +++RI  +    ++     T L+  +  L   + VQ    +DE    T N N L  
Sbjct: 868  KSIQYEDRIKALASKLDSELRERTTLQENLSTLQARMVVQ----QDE---LTSNNNTLSE 920

Query: 1017 -RVTKG---LEQ-SKRDYEDKLKSLMKDLEEQVKYAN--KAQNNYEQELQNHANVSKTIS 1069
             RV+     LEQ + +D E +L+S++      VK  N      +YE+ +Q ++ +SK + 
Sbjct: 921  LRVSYDSLLLEQKTFKDKEAELRSVIA-----VKTGNYDSLSKSYERIMQENSELSKVVE 975

Query: 1070 QLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNK 1129
             LRE+ ++ RT   E      D + ++ + Q  W +++  +E QI              +
Sbjct: 976  LLREEVKN-RTSNGEKEGDLEDTESIIKKGQDVWDEEKKVFEVQI--TNLNERLSELLEE 1032

Query: 1130 MLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRER 1189
                 ++L +Q  D+ N   S   +  G+ + + +LRSER  L E+L   + EE+ +R +
Sbjct: 1033 NESLLARLESQ--DKGNNSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHK 1090

Query: 1190 LTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRE 1236
            L   E        EL+KIK +      L +    ++  L  L   RE
Sbjct: 1091 LRETEHALSENAFELKKIKSQIFELSSLPQNEHDILRHLVHLKEQRE 1137

 Score =  111 bits (278), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 102/140 (72%), Gaps = 13/140 (9%)

Query: 1529 KQIEPVSIDENAIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLE 1588
            ++IE ++ +E  +R    E YE+   +++ +AEENLK+RIRLPTEEKIN +I+KR+++LE
Sbjct: 1208 QEIEKLTDNERKLR----EFYEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELE 1263

Query: 1589 NEFQNKVEARAKELL--TGDEKNEFFDRMKKEIQEE----LARKYEEELQVVKKKAFDEG 1642
            + F+ K++  AK LL  + D+K     ++ KEI+E     L ++++E+L +V+KKAF+EG
Sbjct: 1264 SSFEQKIKEEAKSLLLHSDDDK---IKKIYKEIEESGRETLQQEFDEQLNIVRKKAFEEG 1320

Query: 1643 RQQVLMKTSFLEKKITKLES 1662
            +Q VLMK++FLE+KI+ LE 
Sbjct: 1321 KQHVLMKSAFLERKISMLEG 1340

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score =  156 bits (395), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 151/473 (31%), Positives = 230/473 (48%), Gaps = 59/473 (12%)

Query: 1224 VMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKXXXXXXXXXXXXXXXXXK 1283
            VM   T+L  L ESN  L  E       N+ L +++ ++  K                 K
Sbjct: 1062 VMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEK 1121

Query: 1284 DKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNR 1343
            ++ L+IC EE ERWK RSQ IL + + ++   H    E+   L+ QLE    EN +L +R
Sbjct: 1122 EQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDR 1181

Query: 1344 FEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRL--EVTM 1401
            F++LKKQAHEKL+A+K  Q +LT QIN+L               E K++LEK L  E+  
Sbjct: 1182 FDRLKKQAHEKLDAAKTMQINLTTQINEL--------------NETKVNLEKSLQQEIEK 1227

Query: 1402 KN---------SHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNSEIXXXXXX 1452
             N         S +I+ ++++LE    KS +F  +    VE +K+ +  +          
Sbjct: 1228 NNQSGNGAADESEEIIRLRAELE----KSNNFSNELEKKVEDAKKFKNEI---------- 1273

Query: 1453 XXXXXXXXAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKXXXXXXXXXXXXXXXXXFK 1512
                      E L +    +   +  TV+  +  D+ ES K                 FK
Sbjct: 1274 ----------ESLKSELQSVKAYENSTVNSKIIKDLKESFK----REKDELIEQMKKEFK 1319

Query: 1513 KKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEEYEQAT--SQRIKEAEENLKRRIRL 1570
             KL+ E   + A+ +   +       N    + + E EQ     +RI EAEENLK+R+RL
Sbjct: 1320 TKLEKEKETILAQRKNNILANGQESANIEELKKKWEEEQEALILKRITEAEENLKKRMRL 1379

Query: 1571 PTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQEELARKYEEE 1630
            P+EEKIN VI+KRR  LE EF+ K+    +EL    + N      + +I++EL  K+  E
Sbjct: 1380 PSEEKINAVIEKRRKVLEQEFETKL----RELGLNADGNGVVTDTRAQIEKELREKFNLE 1435

Query: 1631 LQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVSTDN 1683
            L  +KKKAF+EG+QQ +MK++ LE+K++KLES   +   N  + +  + S  N
Sbjct: 1436 LAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKIN 1488

 Score = 92.4 bits (228), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 97/380 (25%), Positives = 187/380 (49%), Gaps = 20/380 (5%)

Query: 242 QLNTVKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQ 301
           QL  V +E+  +KS    L+   + LS  L+     +K++  + N+ K    KE+TLKQ+
Sbjct: 230 QLQIVSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQR 289

Query: 302 LIVVLQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEF 361
           +  +L +++   +++      LT  +  +  +K     +E+ DLK +L + ++   EL+ 
Sbjct: 290 VNELLHNEIASYKKQIE---RLTSKNLETPEKK---IIQELVDLKEKLVNSEKECNELKS 343

Query: 362 KLRKSEDYTAVSNSTSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLE 421
            + K   Y  +        L +        I++L+++L  E+  ++  ++ +E F+ +LE
Sbjct: 344 TVDK---YINI----DEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVELE 396

Query: 422 TELPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVAK 481
            +LP                               +   EL   Q +I + EQ    + +
Sbjct: 397 QKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLR 456

Query: 482 QRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLT 541
           QRSDLA+Q+Q+ L    +  D+  P T++E   ++ I+  ++  +D  TD+ K+IS+RL 
Sbjct: 457 QRSDLAHQVQYLL----LCIDNKSPFTEKEATLVKKIVSNENTEND--TDSHKIISKRLL 510

Query: 542 KFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAE-KSRXXXXXXXXXXXXXLTLQNYN 600
            F+++ ELQQKNMELL+TTR+L   LE +++ +Q   +               + L+ + 
Sbjct: 511 HFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHI 570

Query: 601 SSLTAKIAALTKELETYKVL 620
            +L +KI  +++E ++YK+L
Sbjct: 571 KTLESKINIISQERDSYKLL 590

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  130 bits (327), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 117/212 (55%), Gaps = 22/212 (10%)

Query: 1541 IRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAK 1600
            +RK +EEE+E+ T QRI+EA+ENLK+ IRLPTEEKI +VI KR+ QLE +FQ KV  +A 
Sbjct: 1331 LRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQAN 1390

Query: 1601 ELLTGDEKNEFFDRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKL 1660
             L   +  N+  D ++KE++EE+  + EE+ +++KKKAF+EGRQQ  MKT+ LE+KI KL
Sbjct: 1391 LLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKL 1450

Query: 1661 ESDLQNAKSN------------------TGATDNTIVSTDNETKYEGSDKKPVTINTNVV 1702
            E+ LQ                        G   N  V  +    + G+    ++  T+  
Sbjct: 1451 EARLQGGTGPLKSANGLNKINIDSPLMVAGPLTNEPVLDEKPNAFAGATTTTISQPTSTT 1510

Query: 1703 SDVGEN----NAERTPMNKFPRAIMNPLLSNG 1730
            +    N    NA++ P      +   P  S G
Sbjct: 1511 AKDSANAFSFNAQKVPAQPAFSSRAQPAFSFG 1542

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  114 bits (284), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 168/705 (23%), Positives = 334/705 (47%), Gaps = 47/705 (6%)

Query: 155 LNEYRHNIEL----LNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLS---QELETI 207
           L+E  +NI L    + NEK++  +KI +LE + +  K N+L  + +LE++S     LE+ 
Sbjct: 59  LHEQLNNITLKYNRVTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESK 118

Query: 208 NKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQERTDEL 267
           N+E   LE  L    +  ++  ++   +NQ L  ++  +KN++        +L+ + D+L
Sbjct: 119 NRE---LESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDI-------LILETKYDKL 168

Query: 268 SNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLI----VVLQSQLNELQRENGNELSL 323
                DT  NLK           + + E  LK ++I     ++ +  NE++     E++ 
Sbjct: 169 LKGYNDTKDNLKEKISELLALDTSFKSETKLKDEIIEEKDYLIANLTNEIESLKNREINE 228

Query: 324 TVSDTASSSRKDSDFTREINDLKNQLNHVQERNVEL-EFKLRKSEDYTAVSNSTSSDDLR 382
             SD      K+S    +  + +  LN     N ++ E+ L+ +     V+   S   + 
Sbjct: 229 HSSDINIEYGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQSKTGIN 288

Query: 383 NSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTXXXXXXXXXXXXXXXX 442
                 + D  +LKK++   + QR+  ++ LE  + +LE   P                 
Sbjct: 289 FVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELELLLS 348

Query: 443 XXXXXXXXXXXXXSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVAND 502
                          + +E     SR++  + +I+ + ++ +DL NQ+QF L+ NS+ ND
Sbjct: 349 KEKNTSEHFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQND 408

Query: 503 SAGPLTDEEVKFIRNIIQEDDEMHDKE-TDTQKVISERLTKFKDIIELQQKNMELLKTTR 561
             G LT+ E+KFI+ + ++  E    E  ++Q +IS+RL +F+ +I LQQKNMEL+KT R
Sbjct: 409 KYGELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLR 468

Query: 562 ELATKLEEEDKIKQAEKSRXXXXXXXXXXXXXLTLQNYNSSLTAKIAALTKELETYKVLS 621
            +  KL+ ++   +A+                L + + +  L  KI+ L ++L       
Sbjct: 469 LITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQL------- 521

Query: 622 NTEDSSTPADFDKQREQREIEHTQLVKELETRIA-----SIIQESKENANILN---DKIF 673
              +++ P   +K   +  +   +L  E +  I      +I + +K+ +NI++   D++ 
Sbjct: 522 ---NANRPVSHEKNGHESVLAENKLYTEGDRLILDELKNNIPEFTKQASNIISMNFDQLT 578

Query: 674 ALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDK 733
           +L  KN  ++ +  +   ++ + +++L LLQ   D     NE+L++ +  +++ +  +D+
Sbjct: 579 SLYNKNLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDE 638

Query: 734 RTHETINSLIKTRSELATVENKWN---VSQNEIKLLHSSEEMLKNELTRLNEEKNSMKLL 790
             + TI + +  ++ L +V N  N      +E+K L   +  + NEL ++  E+  M+LL
Sbjct: 639 TLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNEL-KMEREQLKMELL 697

Query: 791 VTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEE 835
             +   +QS+ E   +  +     ++NDLE T ++L K L+  E+
Sbjct: 698 NIKTVQIQSDLES--AEYKASVASKINDLEITNSNLSKDLRTKEQ 740

 Score = 43.9 bits (102), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 49/75 (65%)

Query: 1326 LQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLET 1385
             + + E KSKEN+E  +RF +LKKQA+ +L++SK  QN+L  QI+ L+    E+ S+LE 
Sbjct: 973  FKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEV 1032

Query: 1386 EKEGKLSLEKRLEVT 1400
            + +    LE +++ T
Sbjct: 1033 QSKTVQELETQIKST 1047

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 71.6 bits (174), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 96/174 (55%), Gaps = 18/174 (10%)

Query: 1511 FKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEAEENLKRRIRL 1570
            F+KKL+  ++K K+   T ++   S +   ++K+  +EYE+ T +RI+EAEENLK+RIRL
Sbjct: 1408 FEKKLEEIVSKSKS---TGKVADNSENIETLKKEWLKEYEEETIRRIREAEENLKKRIRL 1464

Query: 1571 PTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFFDRMKKEIQEELARKYEEE 1630
            P+EE+I K+I KR+ +LE EFQ K++  A  L    ++ E  D   +++    ++   E 
Sbjct: 1465 PSEERIQKIISKRKEELEEEFQRKLKENASSLTFSCDRKETNDDPDEDLWNSPSKGNSER 1524

Query: 1631 LQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVSTDNE 1684
              V+               T F+++K  K++  L+ AK+     D+   S + E
Sbjct: 1525 PSVI---------------TDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSMNKE 1563

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 68.9 bits (167), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 63/102 (61%), Gaps = 3/102 (2%)

Query: 468 RIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVAN-DSAGPLTDEEVKFIRNIIQEDDEMH 526
           ++   E  +K + +QRSDL +Q+ + L+  S  N D+   LT+ E+ FIRN++ +    +
Sbjct: 355 KLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQ--PTN 412

Query: 527 DKETDTQKVISERLTKFKDIIELQQKNMELLKTTRELATKLE 568
              T+TQ +ISERL KF ++ +L  KN++L+   REL  K+E
Sbjct: 413 TWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKME 454

 Score = 37.0 bits (84), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (61%)

Query: 1322 ERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKK 1376
            E + L+ Q+E KSKE  E  +RF +LKKQA +KLN  K ++N L     DLE  K
Sbjct: 752  EIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSK 806

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 3/64 (4%)

Query: 1326 LQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKK---KELLSQ 1382
            L+   EEKSKE EE  ++F +LK+QA+E+LNASK +Q  L+  +  LE ++   KE +S+
Sbjct: 653  LKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISK 712

Query: 1383 LETE 1386
            LE +
Sbjct: 713  LEVD 716

>Skud_4.625 Chr4 (1115049..1117892) [2844 bp, 947 aa] {ON} YDR356W
            (REAL)
          Length = 947

 Score = 44.3 bits (103), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 103/393 (26%), Positives = 178/393 (45%), Gaps = 87/393 (22%)

Query: 710  TITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSS 769
             I E E+++++LN L        ++  +T+N  ++       +EN+ NV ++E+K   S 
Sbjct: 228  CIEEREKIERKLNDL--------EKKFKTVNDQVRE------LENRANVQKSELK---SK 270

Query: 770  EEMLKNELTRLNEEKNS--------------MKLLVTRLQTLQSEREHLLSTTQDKFNKE 815
            E+ LK  + +LNE KN+              ++ L  +L  L++E +   S  Q K   E
Sbjct: 271  EDQLKESMNQLNEFKNNTDENVSQLESKRIELRNLTNQLNALKNESDEKDSQLQQK-ESE 329

Query: 816  LNDLEGTCNDLRKKLKE-------AEENYGSLMEETTELKDDFRQKK----------KSL 858
            L  L    N+L K+L E        E        + TEL++   +K           KSL
Sbjct: 330  LKRLTNKLNELEKRLNENSSQSSAKESELKESKSQITELEEKINKKNSQLETKENELKSL 389

Query: 859  KEEMSNVEKRY----SEIVEKERETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEIS 914
              +++ +E R     S++  KE E K  N +L + +K     I + + AS DE     I 
Sbjct: 390  MAQLTQLENRLNQKDSQLGSKEDELKTINEKLQRDIK-----IARQETASKDE----RIY 440

Query: 915  SLQKELQVLKNELT-------ESYSQT----ESYRKDIELLNQSIADINKQVLNKEAAFK 963
            +LQ ++Q L+N+L+       ES S T    ES  K I++L   +    ++ L  ++  K
Sbjct: 441  ALQMKIQNLENDLSMMKKTHNESKSVTNDELESKSKVIKILETDLEVAQEKYLKLQSELK 500

Query: 964  ERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLE 1023
            ER    +++++N+ D N  L  +I DL  E    K   +D+              +  + 
Sbjct: 501  ERENRYKISESNLEDENIRLNERISDLARENSRLKSTVDDK--------------STAVY 546

Query: 1024 QSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQ 1056
            + K  YE +L SL K++EE    A K+++  E+
Sbjct: 547  RMKESYEARLDSLRKEVEEYKVNAEKSESKVEE 579

>Kpol_1031.15 s1031 (38596..41385) [2790 bp, 929 aa] {ON}
            (38596..41385) [2790 nt, 930 aa]
          Length = 929

 Score = 40.8 bits (94), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 124/250 (49%), Gaps = 52/250 (20%)

Query: 886  LTKQLKEKTELIEKYKAASDDEGKLE---EISSLQKELQVLKNELTESYSQTESYRKDIE 942
            +TK+L  K ELI     AS++E   +    I +L+  ++ L+  + E     +  + +I+
Sbjct: 240  ITKELIAKDELI-----ASNEEDIKQLNSHIDTLKNTIRGLEETIIEKDDNLKKQKDEIK 294

Query: 943  LLNQSIAD---INKQVLNKEAAFKERITEVELAKNNIADSN---TVLKTQIDDLNNELEV 996
             LN ++ D   +  + L  +   KE+ +++ + +NN+ DS    T LKT++++L  E   
Sbjct: 295  TLNNNLNDSDHLGSEFLLLQNKLKEKNSQISVLENNLIDSKNTATELKTRLENLQKE--- 351

Query: 997  QKKLYED---EKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNN 1053
                Y+D   EKIN      ++ ++   ++Q K + + K  SL  +        +K + +
Sbjct: 352  ----YDDKLREKIN------QIHKLDDNIKQLKSERDSKYVSLDTN--------DKVRKD 393

Query: 1054 YEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQ 1113
            +E+  +N+AN+   +SQ+  + + +R +I++L+    D KR              E + Q
Sbjct: 394  FERMRENNANLDSKLSQISNENKLFRDKISKLSNQLDDTKR--------------ERDNQ 439

Query: 1114 IEFFKKRIEE 1123
            +E  K+RI+E
Sbjct: 440  VELMKRRIDE 449

>Kwal_56.22618 s56 complement(207409..209631) [2223 bp, 740 aa] {ON}
            YGR130C - Hypothetical ORF [contig 184] FULL
          Length = 740

 Score = 37.7 bits (86), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 115/241 (47%), Gaps = 26/241 (10%)

Query: 824  NDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWEN 883
             +L+  LK+ E ++ +L+ E   LK    ++ ++ KE M+ + +  SE   +  +    N
Sbjct: 488  GELKSHLKDIETDHETLVGEHNVLK----KQHEAGKERMNELVRVVSENETETMKVSEAN 543

Query: 884  TRLTKQLKEKTELIEKYKAAS-----DDEGKLEEISSLQKELQVLKNEL-TESYSQTESY 937
             +L + L++KT L    K+A+     D + +  +I   ++EL VL+ ++   S  +TES 
Sbjct: 544  MKLQRDLEQKTSLAAHAKSANVKLQKDYQRERCKILDARRELDVLRAQIDVVSCHKTESL 603

Query: 938  RKDIELLNQSIADI-NKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQI--DDLNNEL 994
            +   +++  S  D+ +K  L +  AF E I    L  N + D+   +  Q   D +  E 
Sbjct: 604  QFMAQMM-MSFRDVLSKDTLQQCDAFLEAINSNRLFNNALFDTQGKISKQCLNDQMAKEF 662

Query: 995  EVQKKLYED------------EKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEE 1042
            E   + Y              + +++ R+ + L +  KGL Q  +++E+ +  L+KD + 
Sbjct: 663  EQVTQFYRQFAKERLLDQLFAKHVSYMRSNSFLSQQLKGLRQEAQNHEEYISRLLKDCKT 722

Query: 1043 Q 1043
            Q
Sbjct: 723  Q 723

>ZYRO0C11066g Chr3 (851369..857125) [5757 bp, 1918 aa] {ON} similar to
            uniprot|P08964 Saccharomyces cerevisiae YHR023W MYO1 Type
            II myosin heavy chain required for wild- type cytokinesis
            and cell separation localizes to the actomyosin ring
            binds to myosin light chains Mlc1p and Mlc2p through its
            IQ1 and IQ2 motifs respectively
          Length = 1918

 Score = 37.4 bits (85), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 90/174 (51%), Gaps = 17/174 (9%)

Query: 712  TENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEE 771
            T+N  L K++  L+N V E+++  H    S  +   EL +++++ +   +E++ L S E 
Sbjct: 951  TKNSELAKQVEQLKNQVSEKERALHSLEQSKSQVSKELVSLKSRESSVHDELQKLKSQES 1010

Query: 772  MLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKF-------NKELNDLEGTCN 824
             +K E+ +L   +++ +    +++  ++ ++  +ST + +        N +LN+LE  C 
Sbjct: 1011 AMKREMEKLRSAESARRKEFDKMKADETSKDKEISTLRGRLSSSEKDVNIKLNNLEKNCE 1070

Query: 825  DLRKKLKEAEENYGSLMEETTELKD---DFRQKKKSLKEEMSNVEKRYSEIVEK 875
               K+LK       +L+EE T+L +      ++K +   ++S  E+ Y+ + E+
Sbjct: 1071 AAMKRLK-------TLVEENTDLNNKISTLEKEKNNYTRDVSTKEREYTRMRER 1117

>NDAI0H02310 Chr8 (560510..562336) [1827 bp, 608 aa] {ON} Anc_2.454
           YMR100W
          Length = 608

 Score = 37.0 bits (84), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 1/98 (1%)

Query: 806 STTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNV 865
           ST +D F  EL  +   CNDLR K  E  + Y  L     ++KD+ R+ K     E  N 
Sbjct: 353 STMKDSFTIELEAIASKCNDLRLKKMELRDPYERLNVTLPKVKDNKRRTKAQRLTEHFNS 412

Query: 866 EKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYKAA 903
              Y+ + E+  +  W++  ++K      +L+E++ ++
Sbjct: 413 NSSYNAMSEELTDNTWQHI-ISKNYLNIFQLVERFTSS 449

>YEL043W Chr5 (70478..73348) [2871 bp, 956 aa] {ON} Predicted
           cytoskeleton protein involved in intracellular
           signalling based on quantitative analysis of
           protein-protein interaction maps; may interact with
           ribosomes, based on co-purification studies; contains
           fibronectin type III domain fold
          Length = 956

 Score = 37.0 bits (84), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 78/149 (52%), Gaps = 16/149 (10%)

Query: 816 LNDLEG-TCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVE 874
           L DL+  + +DL+K L  A+E+   ++ + T L  DF++ K  L+ E+ N++  +S  ++
Sbjct: 210 LKDLDSFSIDDLKKILICAQEDLHDVLSQQTSLLQDFQESKLELELELDNLKTHWSHEID 269

Query: 875 KERETK-----WENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTE 929
             +  K      EN++L   LK     IEK     D     E+IS ++ ++Q    E TE
Sbjct: 270 LRKSLKSNIKSLENSKLLTDLK-----IEKLNKKIDKSK--EKISKMRNDMQKWSQEDTE 322

Query: 930 SYSQTESYRKDIELLNQ---SIADINKQV 955
             S+     K  +LLN+   S+A+INK++
Sbjct: 323 LLSKDTIKEKYFKLLNESNASVANINKEI 351

>Suva_5.26 Chr5 (46040..48943) [2904 bp, 967 aa] {ON} YEL043W (REAL)
          Length = 967

 Score = 36.6 bits (83), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 85/356 (23%), Positives = 157/356 (44%), Gaps = 70/356 (19%)

Query: 816  LNDLEG-TCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVE 874
            L DL+  + +DL+K L  A+E+   ++ +   L  DF++ K  L+ E+ N++  +S  ++
Sbjct: 209  LKDLDSFSIDDLKKILICAQEDLHDVLSQQNSLLQDFQESKVELELELDNLKTHWSHEID 268

Query: 875  KERETK-----WENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTE 929
              +  K      EN++L   LK     IEK     D     E+IS ++ ++Q    E  E
Sbjct: 269  LRKSLKSNIKSLENSKLLTDLK-----IEKLSKKIDKS--REKISKMRNDMQNWSREDAE 321

Query: 930  SYSQTESYRKDIELL---NQSIADINKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQ 986
              S+     K ++LL   N S+A I++QV    A+ ++ I+ +E       +SN  L   
Sbjct: 322  LLSKDTVKEKYLKLLHDSNASVAKIDQQV----ASLQKEISNME-------ESNKKLNAT 370

Query: 987  IDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKY 1046
               L   + V   +  D+ I     + EL  V              LK L+   +E+  +
Sbjct: 371  RKSLVTSIVVNANVENDKPI----ASGELSAV--------------LKKLLDLTQEKNGF 412

Query: 1047 ANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQ 1106
            A+ +   +  +L   +++ K I Q             EL        R+  E++ +W+ Q
Sbjct: 413  ASTSGEEFLSKLNADSSLIKLIKQ-------------EL--------RIDQESETNWKSQ 451

Query: 1107 RDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQA--NDEDNAESSGVNSIEGDNK 1160
            R  + K+I   + +  E S  N+ L  ++KL  Q   N+ D+  ++  N+   +N+
Sbjct: 452  RSNFLKKISILENQFNEMSLNNRTL--KTKLMVQPYNNNSDSLVATNSNNSADNNR 505

>Smik_5.50 Chr5 (72674..75550) [2877 bp, 958 aa] {ON} YEL043W (REAL)
          Length = 958

 Score = 34.7 bits (78), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 77/149 (51%), Gaps = 16/149 (10%)

Query: 816 LNDLEG-TCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVE 874
           L DL+  + +DL+K L  A+E+   ++ + T L  DF++ K  L+ E+ N++  +S  ++
Sbjct: 210 LKDLDSFSIDDLKKILICAQEDLHDVLSQQTLLLQDFQESKLELELELDNLKTHWSHEID 269

Query: 875 KERETK-----WENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTE 929
             +  K      EN++L   LK     IEK     D     E+IS ++ ++Q    E TE
Sbjct: 270 LRKSLKSNIKSLENSKLLTDLK-----IEKLNKKIDKSK--EKISKMRNDMQNWTREDTE 322

Query: 930 SYSQTESYRKDIELL---NQSIADINKQV 955
             S+     K  +LL   N S+A+INK++
Sbjct: 323 LLSKDTMKEKYFKLLKESNASVANINKKI 351

>Smik_4.772 Chr4 complement(1359469..1362507) [3039 bp, 1012 aa] {ON}
            YDR495C (REAL)
          Length = 1012

 Score = 34.7 bits (78), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 57/125 (45%), Gaps = 23/125 (18%)

Query: 1514 KLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTE 1573
            KL  EI K+K EY    +EP+S+ + A      + YE   S      EEN+K+   LP E
Sbjct: 667  KLLIEIYKVKGEY----LEPLSLLKKA------KNYESLVSF----IEENIKK---LPEE 709

Query: 1574 EKINKVIDKRRTQLENEFQNKVEARAKELL-----TGDEKNEFFDRMKKEIQEELARKYE 1628
               + + D     L     N  E+  K++L      G  KNEF DR+ KE    L   + 
Sbjct: 710  YVKDTLADDLIFVLRESDANNKESITKQVLKVLNMAGVNKNEFLDRIPKE-DVSLKVSFI 768

Query: 1629 EELQV 1633
            EEL V
Sbjct: 769  EELGV 773

>TDEL0E02080 Chr5 complement(393303..395042) [1740 bp, 579 aa] {ON}
            Anc_5.416 YDR358W
          Length = 579

 Score = 34.3 bits (77), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 54/115 (46%), Gaps = 17/115 (14%)

Query: 1165 LRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETHN----YPDLLEQ 1220
            L+ + DLL E L+ T++ + L  + ++S+  + +    + QKI EE H       DLL+ 
Sbjct: 243  LKRKADLLNEMLSSTDSPD-LQDDTISSLYSNLKGAQPKFQKIIEEEHEDDNLVQDLLKF 301

Query: 1221 HKTVMSQLTQLDLLR-----------ESNITLRNETIELQSKNQHLQTEVENLHD 1264
            + TV   LT+ DLL+            SNI    E   + S    L  E+ NL D
Sbjct: 302  NDTVNQLLTKFDLLKAGDSTSASQIHPSNIATSPEPTTIGSSGGALAKEI-NLID 355

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL058W
           (USO1)
          Length = 1292

 Score = 34.3 bits (77), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 112/237 (47%), Gaps = 27/237 (11%)

Query: 778 TRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENY 837
           T+L+E  + ++ L T+  TL++ +   L        K+L   EG  N L+ +  + E+  
Sbjct: 761 TQLDEANSKVEDLSTKKTTLEAAKADCL--------KKLASHEGQVNSLKNRTTQLEKQL 812

Query: 838 GSLMEETTELKDDFRQKKKSL------KEEMSNVEKRYSEIVEKE-RETKWENTRLTKQL 890
            ++ E+ +  +    +  + L      K+ ++ V  +  +  EK+ +E + E  R+T+ L
Sbjct: 813 ATVSEQKSTAEAGINKMNRELFNLTKEKDSLTAVMNKLQKEGEKKLQEAEKEKVRITQLL 872

Query: 891 KEKTELIEKYKAASDDEG----KLE-EISSLQKELQVLKNELTESYSQTESYRKDIELLN 945
            ++   IE  +    D+G    KLE E + L KE+  LK++     S     ++ ++ L 
Sbjct: 873 SQRDRDIENLRNELQDQGTQKKKLEDEHAGLLKEIADLKSQCASQDSLIPKLKEKLKTLA 932

Query: 946 QSIAD-------INKQVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELE 995
           +S+ D       + KQV N +A     IT++      + D N +L ++ D+L  ELE
Sbjct: 933 ESLKDTQNEHATLQKQVGNIQATSHAEITQLNAELQKLKDENVILISRKDELTQELE 989

>Skud_4.15 Chr4 complement(23550..25922) [2373 bp, 790 aa] {ON}
           YDL239C (REAL)
          Length = 790

 Score = 33.9 bits (76), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 123/265 (46%), Gaps = 41/265 (15%)

Query: 708 DMTITENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLH 767
           ++ I+E  + QK+++SL+   +   +   ++  S+++ +SEL  ++NK  +SQ+E K L 
Sbjct: 359 NLLISELYKRQKQISSLQQESISFSQDVKDSKGSIVRLQSELEILKNKLQISQDENKKLK 418

Query: 768 SSEEMLKNELTRLNEEKNSMKLLVTRLQTL---QSEREHLLSTTQDKFNKELNDLEGTCN 824
            +    +  L  +     ++ L    L      + +  H  ST Q +F K   D++    
Sbjct: 419 ENSSFFEKRLNDIYSYMQNLPLFEKDLGKFILEEMKHGHTPSTFQSRFTKFYPDVKDI-- 476

Query: 825 DLRKKLKEAEENYGSLME--ETTELKDDFRQKK-----KSLKEEMSNVEKRYS---EIVE 874
               K  E+ E Y  L    +  E KD  R +K     K + E +  +++++S   + ++
Sbjct: 477 ----KHFESMEQYKQLKAKIQVLEKKDGIRLEKISSLFKLISERLHFMQQQHSHKIQCLQ 532

Query: 875 KERETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKE-LQVLKNELTESYSQ 933
           KE  TK +  RL K+                   +  +I +L++E  Q LKNEL E  + 
Sbjct: 533 KEMSTKEQQFRLEKR-------------------RWHDILNLKEESFQKLKNELREKLTL 573

Query: 934 TESYRKDIE-LLNQSIADINKQVLN 957
            E  +K+ E  LN  I + +K+V+N
Sbjct: 574 CEKIQKNAEDKLNNYINE-HKEVIN 597

>AFR494W Chr6 (1327026..1329587) [2562 bp, 853 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR318W (EST2)
          Length = 853

 Score = 33.5 bits (75), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1019 TKGL-EQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQ--T 1075
             KG+ E+ KR+YED +++++K +++ ++Y    +    Q L + A ++K I + R    T
Sbjct: 428  CKGIDEEDKREYEDYVRTVIKPVQQILEYLRMRRAVRFQRLYSPAQIAKYIGEFRSSILT 487

Query: 1076 QH 1077
            +H
Sbjct: 488  KH 489

>NDAI0B04200 Chr2 (1058568..1059422) [855 bp, 284 aa] {ON} Anc_2.175
           YOR106W
          Length = 284

 Score = 32.7 bits (73), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 818 DLEGTCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRY 869
           DL   CN+LR ++ + +  + +   E ++L +DF    K LK E+ +VE+ Y
Sbjct: 71  DLIPLCNELRDRIDDNQPTWQNTFHEGSKLYNDF----KILKTELISVERSY 118

>Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)
           [2388 nt, 796 aa]
          Length = 795

 Score = 33.1 bits (74), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 85/173 (49%), Gaps = 15/173 (8%)

Query: 711 ITENER-LQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSS 769
           + +N+R LQ + + + N V E   +  E        + ++A  EN+ N S ++++LL   
Sbjct: 367 LNQNQRILQDKYDGMANEVDEWRNKYEEV-------QGKMAKQENEANNSASKLQLLEDE 419

Query: 770 EEMLKNELTRLNEEKNSMKLLVTRLQTLQSEREHLL-------STTQDKFNKELNDLEGT 822
            E+LKN+L      +  +KL    L  L  +RE  L       +T Q   N+ +N  +  
Sbjct: 420 LEILKNKLDEYEASETKLKLDYKELDELFQKREEELFSKANEVNTLQQSLNEIMNSQKSA 479

Query: 823 CNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEK 875
             DL K+++E   +   L  + +++  D  ++K  L+++++ +EK  SE V K
Sbjct: 480 SEDLVKQIEELSTSKSQLEVKLSQISVDHSKEKHYLEDKINGMEKDLSENVGK 532

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.123    0.312 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 181,457,967
Number of extensions: 8397856
Number of successful extensions: 90029
Number of sequences better than 10.0: 4381
Number of HSP's gapped: 74305
Number of HSP's successfully gapped: 11456
Length of query: 1973
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 1848
Effective length of database: 39,148,149
Effective search space: 72345779352
Effective search space used: 72345779352
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 74 (33.1 bits)