Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E050205.698ON61961931780.0
Suva_11.3295.698ON60155322050.0
YKR093W (PTR2)5.698ON60155821780.0
Smik_11.3565.698ON60255821730.0
NCAS0A032205.698ON61157621340.0
ZYRO0G06688g5.698ON61356420720.0
CAGL0G02453g5.698ON59755620690.0
TPHA0O02000singletonON62055120590.0
KNAG0C065705.698ON59054820460.0
Kpol_529.285.698ON61053720370.0
SAKL0E14828g5.698ON59252720230.0
KAFR0H002405.698ON59154119900.0
KAFR0H00230singletonON59654019900.0
KLLA0E12915g5.698ON65453019940.0
TBLA0A091205.698ON63354119850.0
TPHA0N01960singletonON59151719760.0
TBLA0E01140singletonON61154719600.0
TDEL0B022305.698ON57453219290.0
TBLA0B04710singletonON61552919010.0
Skud_11.3315.698ON39938715890.0
Kwal_47.16930na 1ON6115857022e-83
KLTH0D16544gna 1ON6266006501e-75
AGL365Cna 2ON5995225808e-66
Ecym_2823na 2ON6136115476e-61
AFR228WsingletonON5765315052e-55
TBLA0F01600singletonON567115840.15
ADL156Cna 3ON483186820.25
NDAI0F01930singletonON564115790.59
ZYRO0G18700g1.173ON591164751.8
NCAS0A092601.305ON59432708.0
NDAI0F01940singletonON55187698.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E05020
         (619 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...  1228   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   853   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   843   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   841   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   826   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   802   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   801   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   797   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   792   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   789   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   783   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   771   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      771   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   772   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   769   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   765   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   759   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   747   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            736   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   616   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   275   2e-83
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   254   1e-75
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   228   8e-66
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   215   6e-61
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   199   2e-55
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    37   0.15 
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    36   0.25 
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               35   0.59 
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    33   1.8  
NCAS0A09260 Chr1 (1829435..1831219) [1785 bp, 594 aa] {ON} Anc_1...    32   8.0  
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}               31   8.3  

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score = 1228 bits (3178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/619 (96%), Positives = 596/619 (96%)

Query: 1   MTRDVQSINTPEIRDIVLKDXXXXXXXXXXXXXXXXXXXXXXXLHDVETYNLSNSANDST 60
           MTRDVQSINTPEIRDIVLKD                       LHDVETYNLSNSANDST
Sbjct: 1   MTRDVQSINTPEIRDIVLKDEKIEEITTTKKETNATTSSTEEKLHDVETYNLSNSANDST 60

Query: 61  NDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQ 120
           NDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQ
Sbjct: 61  NDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQ 120

Query: 121 NGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVG 180
           NGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVG
Sbjct: 121 NGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVG 180

Query: 181 IFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKS 240
           IFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKS
Sbjct: 181 IFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKS 240

Query: 241 GERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVIL 300
           GERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVIL
Sbjct: 241 GERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVIL 300

Query: 301 VFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRT 360
           VFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRT
Sbjct: 301 VFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRT 360

Query: 361 IAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFV 420
           IAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFV
Sbjct: 361 IAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFV 420

Query: 421 YPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAW 480
           YPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAW
Sbjct: 421 YPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAW 480

Query: 481 QIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDP 540
           QIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDP
Sbjct: 481 QIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDP 540

Query: 541 KFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQSKRHLSSGADDLEI 600
           KFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQSKRHLSSGADDLEI
Sbjct: 541 KFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQSKRHLSSGADDLEI 600

Query: 601 LPGPDNNNWRTSSLSHSDM 619
           LPGPDNNNWRTSSLSHSDM
Sbjct: 601 LPGPDNNNWRTSSLSHSDM 619

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/553 (73%), Positives = 467/553 (84%), Gaps = 4/553 (0%)

Query: 52  LSNSANDSTNDFDDDEMEEG--YEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYY 109
           +S+ A +ST  F+     E   +E PTDEEL +L+ VGGKIP+RCWLI +VEL+ERFSYY
Sbjct: 38  VSDDAANSTERFNLSPSPEDNEFEAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYY 97

Query: 110 GLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNS 169
           GLSAPFQNYM+ GPND+PKG+L LNSSGATGLSYFFQFWCYVTPVFGG++ADT+WGKYN+
Sbjct: 98  GLSAPFQNYMEYGPNDTPKGMLSLNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNT 157

Query: 170 ISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLP 229
           I  GT  YI GIFILFIT+IPS+ +++++LGGFI SIILIGI TG IKANLSVLIADQLP
Sbjct: 158 ICCGTAIYIAGIFILFITSIPSVGNRDSALGGFIASIILIGIATGMIKANLSVLIADQLP 217

Query: 230 KRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLP 289
           KRKP +K+LKSGERVIED NITLQNVFM FY MIN+GS+S+MATTELE HKGFWAAYLLP
Sbjct: 218 KRKPFIKVLKSGERVIEDGNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLP 277

Query: 290 FCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPW 349
           FCFFW+AVV LVFG+K Y++  +GD V+ KSFKVCWI+ KNK D+NAAKPS HPE++YPW
Sbjct: 278 FCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPW 337

Query: 350 NDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIAL 409
           ND+FVDE+KR +AACKVFVFYPIYW QYG+MIS+F+TQ S MELHGIPNDFLQ FDSIAL
Sbjct: 338 NDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIAL 397

Query: 410 IIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLS 469
           IIFIPIFE F YPFIRR+TP +PITKI  GF  G  AMTWAAVLQ F+Y  GP Y  PL 
Sbjct: 398 IIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLG 457

Query: 470 CDTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSIL 529
            +TPN +HV WQIPAYVLI+FSEIFASITGLEYAYSKAP +MKSF+MSIFLLTNAFGS +
Sbjct: 458 HNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAI 517

Query: 530 GIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQSKR 589
           G ALS VTVDPKF WLF GLAV+C ++G LFWLCFR  N TEEEMNAMDY+ E DE    
Sbjct: 518 GCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEMNAMDYEEE-DEFDLN 576

Query: 590 HLSS-GADDLEIL 601
            +S   A+D+EIL
Sbjct: 577 PISQPKANDIEIL 589

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/558 (73%), Positives = 468/558 (83%), Gaps = 13/558 (2%)

Query: 45  HDVETYNLSNSANDSTNDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAE 104
           +  E YNLS S  D           E +E PT+EE+ TL+ VGGKIP+RCWLI +VEL+E
Sbjct: 44  NSTERYNLSPSPED-----------EDFEGPTEEEMQTLRHVGGKIPMRCWLIAIVELSE 92

Query: 105 RFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYW 164
           RFSYYGLSAPFQNYM+ GPNDSPKGVL LNS GATGLSYFFQFWCYVTPVFGG+VADT+W
Sbjct: 93  RFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFW 152

Query: 165 GKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLI 224
           GKYN+I  GT  YI GIFILFIT+IPS+ ++++++GGFI +IILIGI TG IKANLSVLI
Sbjct: 153 GKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATGMIKANLSVLI 212

Query: 225 ADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWA 284
           ADQLPKRKP +K+LKSGERVI D NITLQNVFM FY MIN+GS+S+MATTELE HKGFWA
Sbjct: 213 ADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWA 272

Query: 285 AYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPE 344
           AYLLPFCFFWIAVV L+FG+K Y++  +GD V+ KSFKVCWI+ KNK D+NAAKPS HPE
Sbjct: 273 AYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPE 332

Query: 345 RNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVF 404
           +NYPWND+FVDE+KR +AACKVF+FYPIYW QYG+MIS+F+TQ S MELHGIPNDFLQ F
Sbjct: 333 KNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAF 392

Query: 405 DSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCY 464
           DSIALIIFIPIFE FVYPFIRR+TP++PITKI  GF  G  AMTWAAVLQ F+Y  GP Y
Sbjct: 393 DSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWY 452

Query: 465 DHPLSCDTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNA 524
           + PL  +TPN +HV WQIPAYVLI+FSEIFASITGLEYAYSKAP SMKSF+MSIFLLTNA
Sbjct: 453 NEPLGHNTPNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNA 512

Query: 525 FGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEID 584
           FGS +G ALS VTVDPKF WLF GLAV+C ++G LFWLCFR  N TEEEMNAMDY+ E D
Sbjct: 513 FGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEMNAMDYEEE-D 571

Query: 585 EQSKRHLSS-GADDLEIL 601
           E     +S+  A+D+EIL
Sbjct: 572 EFDLNPISAPKANDIEIL 589

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/558 (73%), Positives = 467/558 (83%), Gaps = 13/558 (2%)

Query: 45  HDVETYNLSNSANDSTNDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAE 104
           +  E YNLS+S  D           E +E PT+EE  TL+ VGGKIP+RCWLI +VEL+E
Sbjct: 44  NSTEQYNLSHSPED-----------EDFEAPTEEETKTLRHVGGKIPMRCWLIAIVELSE 92

Query: 105 RFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYW 164
           RFSYYGLSAPFQNYM+ GPNDSPKGVL LNS GATGLSYFFQFWCYVTPVFGG+VADT+W
Sbjct: 93  RFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATGLSYFFQFWCYVTPVFGGYVADTFW 152

Query: 165 GKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLI 224
           GKYN+I  GT  YI GIFILFIT+IPS+ ++++++GGFI +IILIGI TG IKAN+SVLI
Sbjct: 153 GKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGFIAAIILIGIATGMIKANISVLI 212

Query: 225 ADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWA 284
           ADQLPKRKP +K+LKSGERVI D NITLQNVFM FY MIN+GS+S+MATTELE HKGFWA
Sbjct: 213 ADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWA 272

Query: 285 AYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPE 344
           AYLLPFCFFWIAVV L+FG+K Y++  +GD VV KSF+VCWI+ KNK D+NAAKPS HPE
Sbjct: 273 AYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSFRVCWILTKNKFDFNAAKPSVHPE 332

Query: 345 RNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVF 404
            NYPWND+FVDE+KR +AACKVFVFYPIYW QYG+MIS+F+TQ S MELHGIPNDFLQ F
Sbjct: 333 ENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAF 392

Query: 405 DSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCY 464
           DSIALI+FIPIFE FVYPFIRR+TP++PITKI  GF  G  AMTWAAVLQ F+Y  GP Y
Sbjct: 393 DSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWY 452

Query: 465 DHPLSCDTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNA 524
           + PL  +TPN IHV WQIPAYVLI+FSEIFASITGLEYAYSKAP SMKSF+MSIFLLTNA
Sbjct: 453 NEPLGHNTPNHIHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNA 512

Query: 525 FGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEID 584
           FGS +G ALS VTVDPKF WLF GLAV+C ++G LFWLCFR  N TEEEMNAMDY+ E D
Sbjct: 513 FGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEMNAMDYE-EDD 571

Query: 585 EQSKRHLSS-GADDLEIL 601
           E     +S+  A+D+EIL
Sbjct: 572 EFDLNSISAPKANDIEIL 589

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/576 (70%), Positives = 466/576 (80%), Gaps = 15/576 (2%)

Query: 44  LHD-VETYNLSNSANDSTNDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVEL 102
           +HD +ETY++ +          D+E E GYE PT+E++ TL+ V GKIPLRCWLI +VEL
Sbjct: 46  VHDELETYHIHH----------DEECEPGYEIPTEEDMETLRHVSGKIPLRCWLIALVEL 95

Query: 103 AERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADT 162
           AERFSYYGLSAPFQNYM+NGPND+P GVL LNSSGATGLSYFFQFWCYVTPVFGGF+ADT
Sbjct: 96  AERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADT 155

Query: 163 YWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSV 222
           YWGKYN+I VGTG Y+ GIFILFIT+IPSIAS++ SLGGFI +IILIGI TG IKANLSV
Sbjct: 156 YWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLGGFIAAIILIGIATGMIKANLSV 215

Query: 223 LIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGF 282
           LIADQLPKRKPRVK LKSGERV+EDPNITLQNVFM FYLM+N+GS+SV+ATTELE HK F
Sbjct: 216 LIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNF 275

Query: 283 WAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYH 342
           WAA+LLPFCFFWIAVV+LV GR  YVKE   +  +QKSFK+ WIV+KNK D  +AKPSYH
Sbjct: 276 WAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFKILWIVSKNKFDLTSAKPSYH 335

Query: 343 PERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQ 402
           PE+NYPW D+FVDE  R ++ACKVF+FYPIYWV YG+MISTFVTQGS MELHG+PND  Q
Sbjct: 336 PEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQ 395

Query: 403 VFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGP 462
             DS ALIIFIPI E F+YPFIRRFTP +PITKI  GF     AM W+ VLQ FIY  GP
Sbjct: 396 AIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGP 455

Query: 463 CYDHPLSCDTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLT 522
            YDHPL+   PN+IHV WQ+PAYVLIAFSEI ASITGLEYAYSKAP SMKSF+MS+FL +
Sbjct: 456 YYDHPLNGGGPNRIHVGWQVPAYVLIAFSEILASITGLEYAYSKAPMSMKSFIMSLFLFS 515

Query: 523 NAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAE 582
           NA GSILGIALS V+VDPKF WLFGGL V+C + G +FW+ FR  N TEEEMNAMDY+  
Sbjct: 516 NAGGSILGIALSPVSVDPKFTWLFGGLGVACFIGGCIFWIIFRKYNDTEEEMNAMDYE-- 573

Query: 583 IDEQSKRHL-SSGADDLEILPGPDNNNWRTSSLSHS 617
            DE+  R + S+GA+DLE+         RT   S  
Sbjct: 574 -DEEDLREMESAGANDLELNSTQSLTQRRTGESSEE 608

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/564 (68%), Positives = 450/564 (79%), Gaps = 4/564 (0%)

Query: 47  VETYNLSNSANDSTNDFDDDEME-EGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAER 105
           +E  +L  S +    + D DE E    +EPT+EEL +L+ VGG IP RCWLI +VEL+ER
Sbjct: 18  IEDKSLEVSGSHERGELDFDEYEVPNDDEPTEEELRSLRHVGGHIPFRCWLIAIVELSER 77

Query: 106 FSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWG 165
           FSYYGLSAPFQNYMQNG +D+P GVL L S GATGL+YFFQFWCYVTPVFGG++ADTYWG
Sbjct: 78  FSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLAYFFQFWCYVTPVFGGWLADTYWG 137

Query: 166 KYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIA 225
           KY +I VGTG Y+VGIFILFIT++PS+ S+N +LGGFI +I+LIGI TG IKANLSVLIA
Sbjct: 138 KYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGFITAIVLIGIATGMIKANLSVLIA 197

Query: 226 DQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAA 285
           DQ PKRKPR+K  K GERVIEDPNIT+QNVFM FYLMINIGS+SV+ATTELE HKGFWAA
Sbjct: 198 DQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLMINIGSLSVIATTELEEHKGFWAA 257

Query: 286 YLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPER 345
           YLLPFCFFWIAV++L  GRK YV+  +GD V+ KSF+V   + K++ DY A KPS HPER
Sbjct: 258 YLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEAVKPSVHPER 317

Query: 346 NYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFD 405
           +YPWND FV+E+KR + ACKVF+FYPIYWV YG M STFV+ G  M+LHG+PNDF Q  D
Sbjct: 318 DYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQAID 377

Query: 406 SIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYD 465
           SIALI+FIPI E ++YPFIRR+TP +PITKI  GF     +M WAAVLQHFIY TGPCYD
Sbjct: 378 SIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPCYD 437

Query: 466 HPLSC-DTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNA 524
           HP+ C + PN IH+ WQ+PAYVLIAFSEIFASITGLEYAYSKAP SMKSF+MSIFLLTNA
Sbjct: 438 HPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTNA 497

Query: 525 FGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEID 584
           FGS +G ALS V  DPK++W+F GLAV+  ++G LFWL F  LN TEEEMNAMDY+ E  
Sbjct: 498 FGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMNAMDYE-ENQ 556

Query: 585 EQSKRHLSSGADDLEILP-GPDNN 607
           E+    L  G  DLE  P G D+ 
Sbjct: 557 EKIDDGLQKGTSDLEFEPAGADDK 580

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/556 (69%), Positives = 455/556 (81%), Gaps = 3/556 (0%)

Query: 44  LHDVETYNLSNSANDSTNDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELA 103
           + D E ++L    +++ ++F   E ++ +E PT+EEL TL+ V G IPLRCWLI +VEL+
Sbjct: 35  IEDQEIHHLDRDKSNAESNFALGE-DDDFEAPTEEELKTLRHVAGHIPLRCWLIAIVELS 93

Query: 104 ERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTY 163
           ERFSYYGLSAPFQNYMQNGPND+PKG+L L S GATGLSYFFQFWCYVTPVFGG+V+DTY
Sbjct: 94  ERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTY 153

Query: 164 WGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVL 223
           WGKYN+I VGT  Y+ GIFILFIT+IP + + + +LGGFI +IILIGI TG IK+NLSVL
Sbjct: 154 WGKYNTICVGTFIYVCGIFILFITSIPGVTNSDGALGGFIAAIILIGIATGMIKSNLSVL 213

Query: 224 IADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFW 283
           IADQLP +KPRV I K GERVIEDPN+TLQNVFM FY  IN+GS+SVMATTELE HKGFW
Sbjct: 214 IADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFW 273

Query: 284 AAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHP 343
           AAYLLPFCFFW+AV +LVFGR  Y+K  +GD V+ KSFKV +I++KNK +  AAKPS++P
Sbjct: 274 AAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNP 333

Query: 344 ERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQV 403
           ++N+PW+D+FVDE+KR + ACKVFVFYP+YWV YG+M++ FVTQG TMELH +PNDFLQ 
Sbjct: 334 DKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQA 393

Query: 404 FDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPC 463
           FDSIALIIFIPIFE FVYPFIRR+TP+RPITKI  GF VG  AM WAAVLQHFIY  GP 
Sbjct: 394 FDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPW 453

Query: 464 YDHPLSCDTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTN 523
           YDHPL  DTPN IHVAWQIPAYVLIA SEIFASITGLEYAYSKAP SMKSF+MSIFLLTN
Sbjct: 454 YDHPLDHDTPNHIHVAWQIPAYVLIAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTN 513

Query: 524 AFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEI 583
           AFGS +G ALS V+VDPKFVW + GLA +C + G +FW  + GLN  EE MNA+DY  E 
Sbjct: 514 AFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWFIYSGLNDEEEAMNALDY--EH 571

Query: 584 DEQSKRHLSSGADDLE 599
           DE   +H S   +  E
Sbjct: 572 DEFMYKHHSDDEEAAE 587

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/551 (67%), Positives = 448/551 (81%), Gaps = 17/551 (3%)

Query: 45  HDVETYNLSNSANDSTNDFDDDEM-----------EEGYEEPTDEELNTLKRVGGKIPLR 93
           HDV T+N+ +   + TN+ + DE            E GY EPT+EE+ TLK V G IP R
Sbjct: 36  HDV-TFNIDDKVENDTNEEELDEFAVDDEADPYNDEWGYVEPTEEEMATLKHVAGHIPYR 94

Query: 94  CWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTP 153
           CWLI VVEL+ERFSYYGLSAPFQNYM NGPND+PKG+L LN++GATGLSYFFQFWCY+TP
Sbjct: 95  CWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNGATGLSYFFQFWCYITP 154

Query: 154 VFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGT 213
           +FGG++ADTYW KYN+I+VGT  YI+GIFILFITAIPSIA++  + GGF+ +IILIGIGT
Sbjct: 155 IFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKETATGGFVTAIILIGIGT 214

Query: 214 GFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMAT 273
           G IKANLSVL+A+Q+PKRK RV   K GERVIEDP+IT+QNVFM FYLMINIG++SV+AT
Sbjct: 215 GMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFYLMINIGALSVLAT 274

Query: 274 TELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLD 333
           TELESHKGFWAAYLLPFCFFWIAVVILV GR  Y+ + +GD V+ K FKV +IV KNK +
Sbjct: 275 TELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKCFKVTFIVCKNKFN 334

Query: 334 YNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMEL 393
           +++AKPS +PE  YPW+D+FVDE+ R+I ACKVF+FYPIYW  YG MI+ F+TQ  TMEL
Sbjct: 335 FDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQMINNFITQAGTMEL 394

Query: 394 HGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVL 453
           H IPNDFLQVFDSI +I+FIPIFE FVYP IRRFTP++PITKI +GF  G CAM WAAVL
Sbjct: 395 HNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGFMCGSCAMVWAAVL 454

Query: 454 QHFIYNTGPCYDHPLSC-----DTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAP 508
           Q FIY  GPCYDHP++C     + PN++HVAWQIPAYV+IA+SEIFAS+TGLE+AYS AP
Sbjct: 455 QSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFASVTGLEFAYSNAP 514

Query: 509 PSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLN 568
            SMK+F+MSIFL TNA G+ LG+A+S  +VDPK+ W+F GLAVSC V G LFW+CF   N
Sbjct: 515 DSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFVAGCLFWICFHHYN 574

Query: 569 ATEEEMNAMDY 579
             + +M A+D+
Sbjct: 575 DIDADMKAIDF 585

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/548 (68%), Positives = 447/548 (81%), Gaps = 3/548 (0%)

Query: 53  SNSANDSTNDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLS 112
           S   +D  + ++DD + EGYE PT+EEL TLK VGG IP+RCWLI VVEL+ERFSYYGLS
Sbjct: 35  SRIVDDLASQYEDD-IPEGYEVPTEEELRTLKHVGGHIPMRCWLIAVVELSERFSYYGLS 93

Query: 113 APFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISV 172
           APFQNYM NGP+D P G+L LNS GATGLSYFFQFWCYVTP+FGG++ADT+WGKYN+I+V
Sbjct: 94  APFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYVTPIFGGYMADTHWGKYNTIAV 153

Query: 173 GTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRK 232
           GTG YI GIFILF+T+IPSI ++NA LGGFIV+IILIGI TG IK+NLSVLIADQLPKRK
Sbjct: 154 GTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILIGIATGMIKSNLSVLIADQLPKRK 213

Query: 233 PRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCF 292
           P VK  K+GERVIED N+TLQNVFM FYLMINIGS+SV+AT+ELE H+GFWAAYLLPFCF
Sbjct: 214 PLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIATSELELHRGFWAAYLLPFCF 273

Query: 293 FWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDR 352
           FWIAVV+LV G+  YVK  +GD V+ K FKV WI+ KN+ +++A KPS +P +NYPW+D+
Sbjct: 274 FWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNRFNFDAPKPSLNPTKNYPWSDK 333

Query: 353 FVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIF 412
           FVDE++R + ACKVF+FYPIYW  YG M+S FVTQGS MELHG+PNDF Q  DSIA+I+F
Sbjct: 334 FVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMMELHGLPNDFFQCIDSIAIIVF 393

Query: 413 IPIFENFVYPFIRRFTPIRPITKITIGF-FVGGCAMTWAAVLQHFIYNTGPCYDHPLSCD 471
           IP+ E+ +YPFIR++TP RPITKI  GF F  GC M WAAVLQ +IY  GP Y  PL  D
Sbjct: 394 IPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGC-MIWAAVLQSYIYKAGPHYKWPLEHD 452

Query: 472 TPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGI 531
            PN+IHVA Q+PAYVL+AFSEIFASITGLEYAYSKAP SMKSF+MSIFL+TNAFGS +G 
Sbjct: 453 GPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPASMKSFIMSIFLVTNAFGSAIGC 512

Query: 532 ALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQSKRHL 591
           ALS V+ DP + WL+ GLAV+C ++G LFW+CFR  N  EEEMNAMDY+ +     K  +
Sbjct: 513 ALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKYNDIEEEMNAMDYEVDATMLKKVPI 572

Query: 592 SSGADDLE 599
            +    LE
Sbjct: 573 ETDTVALE 580

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/537 (67%), Positives = 438/537 (81%), Gaps = 9/537 (1%)

Query: 48  ETYNLSNSANDSTNDFDDDEME----EGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELA 103
           ++ +L NS         DD++E    + + EPT+EE+ TLK V GKIP+RCWLI VVEL+
Sbjct: 37  DSTSLQNSDQLEITKVGDDDIEYDDNQDFVEPTEEEMKTLKHVSGKIPMRCWLIAVVELS 96

Query: 104 ERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTY 163
           ERFSYYGL+APFQNYM NGPND+PKGVLML++ GA+ LSYFFQFWCY+TP+FGG++ADTY
Sbjct: 97  ERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGASALSYFFQFWCYITPIFGGYMADTY 156

Query: 164 WGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVL 223
           WGKYN+I  GTG Y+VGIF+LFIT++PSI ++  +LGG++ +IILIGI TG IKAN+SVL
Sbjct: 157 WGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETALGGYVTAIILIGIATGMIKANISVL 216

Query: 224 IADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFW 283
           IA+Q+P+ KPRV   K G+RVIEDPNIT QNVFM FY+MIN+GS+S+MATTELESHKGFW
Sbjct: 217 IAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMMINVGSLSLMATTELESHKGFW 276

Query: 284 AAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHP 343
           AAYLLPFCFFWIAVV+LV GR  Y+   +GD ++ KSFKV WI+ KNKL+++AAKPS +P
Sbjct: 277 AAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFKVMWILVKNKLNFDAAKPSMNP 336

Query: 344 ERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQV 403
           E+NYPWND+FV+E++R + ACKVFVFYPIYW  YG MI+ FVTQ  TMELH +PNDFLQ 
Sbjct: 337 EKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMINNFVTQAGTMELHNLPNDFLQA 396

Query: 404 FDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPC 463
           FDSIA+I+FIPIFE F+YPF+RRFTP RPITKI  GF  G  AM WAAVLQ FIY  GPC
Sbjct: 397 FDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMFGSGAMIWAAVLQSFIYKAGPC 456

Query: 464 YDHPLSC-----DTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSI 518
           Y+ P+ C     +TPN++HVAWQ+PAYVLIA SEI AS+TGLEYAYS AP SMKSF+MSI
Sbjct: 457 YNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASVTGLEYAYSNAPASMKSFIMSI 516

Query: 519 FLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMN 575
           FL+TNAFGS +GIA+S    DPK+ W F GLAV+C + G LFW+CFR  N TE+ MN
Sbjct: 517 FLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAGCLFWICFRSYNNTEDAMN 573

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/527 (70%), Positives = 440/527 (83%), Gaps = 6/527 (1%)

Query: 61  NDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQ 120
           N + + + + G  EPTDEE+ TL+ V  +IP+RCWL+ VVELAERFSYYGLSAPFQNYMQ
Sbjct: 41  NQYINADSDHG-REPTDEEMKTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQ 99

Query: 121 NGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVG 180
           NGPND+PKG+L L + GAT LSYFFQFWCYV+P+ GGFVADTYWGKY +I VGTG Y+VG
Sbjct: 100 NGPNDTPKGILNLKNQGATALSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVG 159

Query: 181 IFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKS 240
           IFILFIT++PSI   +ASLGGFI S+ILIG+ TG IKAN+SVLIADQ+PK +P VK+LKS
Sbjct: 160 IFILFITSVPSITYYSASLGGFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKS 219

Query: 241 GERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVIL 300
           GERVIEDPNIT+QN+FM FYLMINIGS+SV+ATTE+E+H GFWAAYLLPFCFF++AV +L
Sbjct: 220 GERVIEDPNITVQNIFMFFYLMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVL 279

Query: 301 VFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRT 360
           + GR  YVK  +GD V+ KSFKVCWIV +NK  ++AA+PS +PE  YPW+D+F+DE+KR 
Sbjct: 280 ILGRNQYVKLPVGDKVISKSFKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRA 339

Query: 361 IAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFV 420
           IAACKVFVFYPIYWV YG M+S FV+Q   MELHG+PNDFLQ  DSIALI+FIPI E F+
Sbjct: 340 IAACKVFVFYPIYWVCYGQMLSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFL 399

Query: 421 YPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSC-----DTPNK 475
           YPFIRRFTP RPITKI  GF  G  AM WAAVLQHFIY  GPCY +P++C     +TPN+
Sbjct: 400 YPFIRRFTPFRPITKIFYGFIFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNR 459

Query: 476 IHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSS 535
           IH+AWQ+PAYVLIAFSEIFASITGLEYAYSKAP SM+SF+MSIFLLT AFGS LGIALSS
Sbjct: 460 IHIAWQVPAYVLIAFSEIFASITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSS 519

Query: 536 VTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAE 582
           V+V+PKFVW F GLAVSC + G LFW  F   N TEE MNA+DY+ +
Sbjct: 520 VSVNPKFVWTFSGLAVSCFIAGCLFWAFFHKYNDTEEAMNAIDYEED 566

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/541 (65%), Positives = 439/541 (81%), Gaps = 5/541 (0%)

Query: 46  DVETYNLSNSANDSTNDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAER 105
           D E Y L + + +  ++   D  EEGYE PT +E+ TL+RVGG+IP RC+L+ +VELAER
Sbjct: 39  DTEAYTLQDGSIEPDHE---DYQEEGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAER 95

Query: 106 FSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWG 165
           FSYYGLSAPFQNYMQNGP DSP GVL LNSSGATGLSYFFQFWCY+TP+FGG++ADT WG
Sbjct: 96  FSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWG 155

Query: 166 KYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIA 225
           +YN+I VGT  YI+GIFILFIT+  ++A ++ +L GFI+++ILIG  TG IK+NLSVLIA
Sbjct: 156 RYNTIGVGTVIYIIGIFILFITSFKTVAGRDGALAGFILALILIGFATGLIKSNLSVLIA 215

Query: 226 DQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAA 285
           DQ+P ++PRVK LKSGERVIED ++T+QNVFM FYLMINIGS+SV+ATTELE + GFWAA
Sbjct: 216 DQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATTELELNVGFWAA 275

Query: 286 YLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPER 345
           YLLPFCFFWIAV+++V G++ Y+ +  GD V+ KSFKVCWI+ KNK D  +AKPSYHPE 
Sbjct: 276 YLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPES 335

Query: 346 NYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFD 405
            +PW D+FVDE++R +AACKVF+FYPIYW  YG M++ F+T GS M+LHG+PND  Q  +
Sbjct: 336 EFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAIN 395

Query: 406 SIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYD 465
           SI+LIIFIPI E F+YPFIRRFTP+RP+T+I  GF     AM W+ VLQHFIY+TGP Y+
Sbjct: 396 SISLIIFIPICEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYN 455

Query: 466 HPLSCDTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAF 525
            PL     N IHV WQ+PAYV IAFSEIFASITGLEYAYSKAP +MKSF+M++FL  NAF
Sbjct: 456 RPLELGA-NDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKSFIMALFLFMNAF 514

Query: 526 GSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDY-DAEID 584
           GS +G ALS V+ DP + WL+G LAV+C ++G++FWLCFR  N  E+EMNA+D+ D+E D
Sbjct: 515 GSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEED 574

Query: 585 E 585
           E
Sbjct: 575 E 575

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/540 (67%), Positives = 434/540 (80%), Gaps = 9/540 (1%)

Query: 46  DVETYNLSNSANDSTNDFDD---DEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVEL 102
           D E+Y L N      N+FD    D  EEGYE PT+EEL TL+ V G+IP RC+LI VVEL
Sbjct: 38  DTESYKLQND-----NEFDPEHPDYQEEGYEMPTEEELRTLRHVSGRIPFRCFLIAVVEL 92

Query: 103 AERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADT 162
           +ERFSYYGLSAPFQNYM N P+DSP GVL LNS GATGLSYFFQFWCY+TPV GG++ADT
Sbjct: 93  SERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYLADT 152

Query: 163 YWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSV 222
            WG+YN+I+VGTG YIVGIF+LFIT+  SIA +N +LGGFIV++ILIGIGTGFIKANLSV
Sbjct: 153 NWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKANLSV 212

Query: 223 LIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGF 282
           LIADQ+P ++PRVK LKSGERVIED +IT+QNVFM FYLMINIGS+SV+ATTELE H GF
Sbjct: 213 LIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQHVGF 272

Query: 283 WAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYH 342
           WAAYLLPFCFFWIAV++LV GR+ Y  +   D V++KSFK CW + KNK +++A  P+ +
Sbjct: 273 WAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALTKNKFNWSAVTPAEN 332

Query: 343 PERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQ 402
           PE  + W+D+FV+E++  +AACKVF+FYPIYW  YG M + FVT GS ++LHG+PND  Q
Sbjct: 333 PEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQ 392

Query: 403 VFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGP 462
             DSIALI+FIPI E F YPFIRRFTP RPITKIT GF++   +M WA VLQ+FIY TGP
Sbjct: 393 AIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMVWACVLQYFIYKTGP 452

Query: 463 CYDHPLSCDTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLT 522
            Y HPL+ D PN +HVAWQ+PAYVLIAFSEIFASITGLEYAYSKAP SMKSF+M++FL  
Sbjct: 453 NYKHPLA-DGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAPASMKSFIMALFLFM 511

Query: 523 NAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAE 582
           NAFGS +G ALS V+ DP + WL+ GLAV+  +TG  FW CFR  N  E+EMNA++Y+ E
Sbjct: 512 NAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYNDIEDEMNALNYEDE 571

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/530 (68%), Positives = 433/530 (81%), Gaps = 6/530 (1%)

Query: 62  DFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQN 121
           D DD++ E G  EPT+EEL+TL+ V  +IP  CWLI +VELAERFSYYGLSAPFQNYMQN
Sbjct: 85  DEDDNQNENG-REPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQN 143

Query: 122 GPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGI 181
           GPND+PKGVL L S GAT LSYFFQFWCYVTP+ GG++ADT+WGKYN+I VG  FY+VGI
Sbjct: 144 GPNDTPKGVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGI 203

Query: 182 FILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSG 241
            ILF+TAIPSI  +N+SLGGFIVS+I+IGIGTGFIKANLSVLIADQ+PK +PR+K+LK+G
Sbjct: 204 LILFMTAIPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNG 263

Query: 242 ERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILV 301
           E+VIEDPN+T+QNVFM FYLMINIGS+SVMATT LE+  GFWAAYLL FCFFW+ +V+LV
Sbjct: 264 EKVIEDPNVTMQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLV 323

Query: 302 FGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTI 361
           FGRK YV+  +GD+V+ + FK+CWI   N  + N A PS +PE+ YPWND F+DE++R  
Sbjct: 324 FGRKKYVRRPIGDHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAF 383

Query: 362 AACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVY 421
            ACKVF FYPIYWV YG M++ FVTQ  TMELHG+PNDFLQ  +SIALI+FIPI E F+Y
Sbjct: 384 KACKVFAFYPIYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIY 443

Query: 422 PFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSC-----DTPNKI 476
           PFIRRFTP RP+TKI IGF  G  AM +AAVLQHFIY  GPCYD P+SC     +TPN++
Sbjct: 444 PFIRRFTPFRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRV 503

Query: 477 HVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSV 536
           H+ WQ+PAYVLI+ SEIFASITGLEYAYSKAP +MK+F+MSIFL+TNA GS LGIALS  
Sbjct: 504 HIGWQVPAYVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPT 563

Query: 537 TVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQ 586
             +PK+VW F GLAV+C + G LFWLCF   N  EE +NA+DY  E  EQ
Sbjct: 564 AENPKYVWTFSGLAVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQ 613

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/541 (66%), Positives = 439/541 (81%), Gaps = 8/541 (1%)

Query: 80  LNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGAT 139
           L TLK VGGKIPLRCWL+ V+ELAERFSYYGLSAPFQNYMQNGPNDSP G L L+SSGAT
Sbjct: 88  LRTLKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGAT 147

Query: 140 GLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASL 199
           GLSYFFQFWCY+TPVF G++ADTYWGK+ +I +GTG YIVGIFILFIT++PSI S N ++
Sbjct: 148 GLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAM 207

Query: 200 GGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVF 259
           GGFIV++IL+GI TG IKANLSV+IA+Q+PKRK RV   K+G RVIEDP+IT+QNVFM F
Sbjct: 208 GGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTF 267

Query: 260 YLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQK 319
           Y MINIGS+SV+ATTELE+HKGFWAAYLLPFCFFW+AV++L+ G K Y+K  +GD V+ K
Sbjct: 268 YFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISK 327

Query: 320 SFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGS 379
            FKV  I+ +N+ + ++AKP+++P++NYPW+D+FVDE+ R + ACKVFVFYPIYWV YG 
Sbjct: 328 CFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQ 387

Query: 380 MISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIG 439
           M++ FV+QG TMELHG+PNDF Q  DSIALI+FIPI E FVYPFIR++TP +PITKI  G
Sbjct: 388 MLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWG 447

Query: 440 FFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDT-PNKIHVAWQIPAYVLIAFSEIFASIT 498
           F  G  +MTWA VLQHFIY   PCYDHP  CD  PN IHVA Q+PAY L+A SEIFASIT
Sbjct: 448 FTFGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASIT 507

Query: 499 GLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGI 558
           GLEYAYSKAP SMK+F+MSIFL+TNAFG+ +G ALS V+ DPK+VWL+GGLAV+C V G 
Sbjct: 508 GLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGC 567

Query: 559 LFWLCFRGLNATEEEMNAMDYDAEIDEQSKRHLSSGADDLEILPGPDNNNWRTSSLSHSD 618
           LFW+ F+  N  EEE+N +D++   D    +H    A D+E++    +   R SSL  ++
Sbjct: 568 LFWIIFKKYNDMEEELNNLDFEEGDDMLETKH----AGDIEMIQPISS---RRSSLKSNE 620

Query: 619 M 619
           +
Sbjct: 621 L 621

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/517 (69%), Positives = 427/517 (82%), Gaps = 8/517 (1%)

Query: 75  PTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLN 134
           PT+EEL TL+ V G IPLRCWLI +VELAERFSYYGLSAPFQNYM NGPND+PKG+L LN
Sbjct: 57  PTEEELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQLN 116

Query: 135 SSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIAS 194
           SSGAT +SYFFQFWCYVTP+FGG++ADT+WGKYN+I  GTG Y+ GIFILF+T+I SI +
Sbjct: 117 SSGATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESITT 176

Query: 195 QNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQN 254
           QNA+ GG+I +IILIGI TG IK+N+SVLIA+Q+PKRK RV     GERVIEDP +T+QN
Sbjct: 177 QNAARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQN 236

Query: 255 VFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGD 314
           +FM FYLMINIGS+SV+ATTELE+HKGFWAAYLLPFCFFWIAVV+L+ G+K YV++ +GD
Sbjct: 237 IFMFFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVGD 296

Query: 315 NVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYW 374
            V+ K F + WI  KNKLD+++AKPS HPE NYPW D+FV+E++R I ACKVF+FYPIYW
Sbjct: 297 KVISKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIYW 356

Query: 375 VQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPIT 434
             YG M++ FVTQ  TMELHG+PNDFLQ  DSIA+I+FIPI E F+YPFIR+FTP R IT
Sbjct: 357 CVYGQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSIT 416

Query: 435 KITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSC-----DTPNKIHVAWQIPAYVLIA 489
           KI  GF  G  AM WAAVLQ FIY  GPC+D PL+C      TPN++H+AWQ+PAYVLIA
Sbjct: 417 KIFWGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLIA 476

Query: 490 FSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGL 549
           FSEIFASITGLEYAYS AP SMKSF+MSIFLLT AFGS LGIA+S  +VDPKF W F GL
Sbjct: 477 FSEIFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTGL 536

Query: 550 AVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQ 586
           AVSC + G LFW+CFR  N TE+ M+ +D+   IDE+
Sbjct: 537 AVSCFIAGCLFWICFRKYNNTEDSMDEIDF---IDEK 570

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/547 (66%), Positives = 435/547 (79%), Gaps = 4/547 (0%)

Query: 54  NSANDSTNDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSA 113
           NS  ++ N   DD+ +E + EPT+EE+ TLKRVGG IP RCWL+ V+EL+ERFSYYGLSA
Sbjct: 50  NSNEENYNRSTDDDDDEDFIEPTEEEMRTLKRVGGYIPARCWLMAVIELSERFSYYGLSA 109

Query: 114 PFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVG 173
           PFQNYMQNGP D+P G L LN+ GATGLSYFFQFWCY+TP+FGG++ADTYWGKYN+I VG
Sbjct: 110 PFQNYMQNGPYDTPPGALSLNTQGATGLSYFFQFWCYITPIFGGYMADTYWGKYNTIWVG 169

Query: 174 TGFYIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKP 233
              YI GIFILF+T++P + S +A++GGFIVSII+IG+GTG IKANLSV+IA+Q+PKRK 
Sbjct: 170 VISYICGIFILFMTSLPKLTSYSAAMGGFIVSIIIIGLGTGMIKANLSVMIAEQVPKRKR 229

Query: 234 RVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFF 293
           R+   K G RVIEDP+ITLQNVFM FY MIN+GS+SVMATTELE+ KGFWAAYLLPFCFF
Sbjct: 230 RIITRKDGTRVIEDPDITLQNVFMAFYFMINVGSLSVMATTELEARKGFWAAYLLPFCFF 289

Query: 294 WIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRF 353
           W+AVV+L+ G K ++K  +GD  + KSFKV  I+ KNK +Y +AKPS HPE NYPW D+F
Sbjct: 290 WVAVVVLMIGNKRFIKVPIGDKTISKSFKVVGILIKNKFNYESAKPSIHPECNYPWTDKF 349

Query: 354 VDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFI 413
           V+E++R I AC VF FYPIYWV YG M++ FVTQG  MELH +PNDFLQV DSIALI+FI
Sbjct: 350 VEEIRRAIKACNVFYFYPIYWVCYGQMLNNFVTQGGQMELHDLPNDFLQVIDSIALIVFI 409

Query: 414 PIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSC-DT 472
           PI E  +YPF+RRFTP+RPITKITIGFF G  +M WAAVLQ F+Y   PCY HP +C + 
Sbjct: 410 PICERLIYPFVRRFTPLRPITKITIGFFFGSFSMVWAAVLQWFVYQKPPCYYHPTNCPNG 469

Query: 473 PNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIA 532
           PN IHV WQ+PAY LIA SEIFASITGLEYAYSKAP SMKSF+MSIFL T A GS LG A
Sbjct: 470 PNHIHVCWQVPAYCLIALSEIFASITGLEYAYSKAPASMKSFIMSIFLFTTAIGSALGAA 529

Query: 533 LSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQSKRHLS 592
           LS V++DPKF W + GLAVSC + GI FWLCF   N  E+E+N +D   ++ + S  + +
Sbjct: 530 LSPVSIDPKFTWQYVGLAVSCFIAGIAFWLCFSRYNDEEDELNNIDDQPDVIQISSENEN 589

Query: 593 SGADDLE 599
              DDLE
Sbjct: 590 ---DDLE 593

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/532 (67%), Positives = 431/532 (81%), Gaps = 2/532 (0%)

Query: 67  EMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDS 126
           E+E   +EPT+EE+ TLK V G IP RCWLI VVEL+ERF+YYGLS PFQNYMQNGP+D+
Sbjct: 39  EVESYDDEPTEEEMKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDT 98

Query: 127 PKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFI 186
           P G+L L S GATGLSYFFQFWCYVTP+FGG+++DTY GKYN+I  GTG Y++GI ILF+
Sbjct: 99  PAGLLNLKSQGATGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFV 158

Query: 187 TAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIE 246
           T+IPSI +QNA+ GGFI +IILIGI TG IK+N+SVLIADQ PK++ RV   K G RVIE
Sbjct: 159 TSIPSITTQNAATGGFIAAIILIGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIE 218

Query: 247 DPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKY 306
           DPNITLQNVFM+FYLMINIGS+SV+ATTELE+H GFWAAYLLPFCFFWIAV++L  G+  
Sbjct: 219 DPNITLQNVFMIFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNS 278

Query: 307 YVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKV 366
           YVK  +GD V+ K FKV  I  KNK ++ AAKPS  P+R +PW D+FVDE+ R+++ACKV
Sbjct: 279 YVKPPVGDKVISKCFKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKV 338

Query: 367 FVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRR 426
           F+FYP+YWV YG M++TFV+ G TMELHG+PNDF Q  DSIALI+FIPI E F+YP+IR+
Sbjct: 339 FLFYPVYWVCYGQMLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRK 398

Query: 427 FTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAWQIPAYV 486
           FTP RPITKI  GF  G  AM WAAVLQHFIY +GP Y +P++ +TPN IH+AWQ+PAYV
Sbjct: 399 FTPFRPITKIFWGFMFGAAAMVWAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYV 458

Query: 487 LIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLF 546
           LIAFSEIFASITGLEYAYSKAP +MKSF+M+IFLLTNAFGS +G ALS VT DP +VWL+
Sbjct: 459 LIAFSEIFASITGLEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLY 518

Query: 547 GGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAE--IDEQSKRHLSSGAD 596
            GL V+C   G LFW CF+  N TEE MNA+DYD +  + + SK  +   AD
Sbjct: 519 VGLGVACFAAGWLFWFCFKHYNDTEEAMNALDYDEDPTMLKHSKDGIEECAD 570

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/529 (66%), Positives = 436/529 (82%), Gaps = 4/529 (0%)

Query: 74  EPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLML 133
           EPT+EEL TL R  G IP  CWL+ ++ELAERFSYYGLSAPFQNYMQN P+D+P G L L
Sbjct: 66  EPTEEELKTLPREAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSL 125

Query: 134 NSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIA 193
           NS+GATGLSYFFQFWCYVTP+F GF+ADTYWGK+N++ +GT  YI+GIFILFIT++P+I 
Sbjct: 126 NSTGATGLSYFFQFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAIT 185

Query: 194 SQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILK-SGERVIEDPNITL 252
           S N +LGGFIV+IILIGI TG IKANLSV+IADQLPK+K RV   K SG+RVIEDP +T+
Sbjct: 186 SYNTALGGFIVAIILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTI 245

Query: 253 QNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKM 312
           QNVFM FY MIN+GS+SV+ATTELE H GFWAAYLLPFCFFWIAV++L FG + +VK+ +
Sbjct: 246 QNVFMAFYFMINVGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPI 305

Query: 313 GDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPI 372
           GD V+ K F +  I+ KN  ++  AKP+Y+PE+NYPW+D+FVDE++R++ ACKVF+FYPI
Sbjct: 306 GDRVISKCFTIIGILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPI 365

Query: 373 YWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRP 432
           YWV YG M++ FVTQGSTM+LHG+PNDF Q  +SIALI+FIPI E FVYPFIR+FTP++P
Sbjct: 366 YWVCYGQMLNNFVTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKP 425

Query: 433 ITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSC-DTPNKIHVAWQIPAYVLIAFS 491
           ITK+TIGF  G  AM WAAVLQHFIY  GPCYDHP+ C + PN +HVAWQ+PAY LI+ S
Sbjct: 426 ITKVTIGFVFGSLAMVWAAVLQHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLS 485

Query: 492 EIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAV 551
           EIFASITGLE AYSKAP SMKSF+MS+FL+TNAFG+ +G ALSSV+ DPK+VWL+ GLAV
Sbjct: 486 EIFASITGLEIAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAV 545

Query: 552 SCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQSKRHLSSGADDLEI 600
           +C   GI FW  F+  N  E+ MN +D+++  D +++++  S  ++LE+
Sbjct: 546 TCFCAGIAFWFTFKHYNDEEDAMNNIDFES--DNENEKNEYSQIENLEL 592

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/387 (74%), Positives = 330/387 (85%), Gaps = 2/387 (0%)

Query: 216 IKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTE 275
           IKANLSVLIADQLPKRKP +K+LKSGERV+ DPNITLQNVFM FY MIN+GS+S+MATTE
Sbjct: 2   IKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTE 61

Query: 276 LESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYN 335
           LE HKGFWAAYLLPFCFFWIAVV L+ G+K Y++  +GD V+ KSF+VCWI+AKNK D+N
Sbjct: 62  LEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDFN 121

Query: 336 AAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHG 395
           AAKPS HPER+YPWND+FVDE+KR +AACKVF+FYPIYW QYG+MIS+F+TQ S MELHG
Sbjct: 122 AAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHG 181

Query: 396 IPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCAMTWAAVLQH 455
           IPNDFLQ FDSIALIIFIPIFE F+YPFIRR+TP +PITKI  GF  G  AMTWAAVLQ 
Sbjct: 182 IPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQS 241

Query: 456 FIYNTGPCYDHPLSCDTPNKIHVAWQIPAYVLIAFSEIFASITGLEYAYSKAPPSMKSFV 515
           FIY  GP YD PL  +TPN++HV WQIPAYVLI+FSEIFASITGLEYAYSKAP SMKSF+
Sbjct: 242 FIYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFI 301

Query: 516 MSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFWLCFRGLNATEEEMN 575
           MSIFLLT AFGS +G ALS VTVDPKF WLF GLAV+C ++G LFW CFR  N TEEEMN
Sbjct: 302 MSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEEMN 361

Query: 576 AMDYDAEIDEQSKRHLSS-GADDLEIL 601
           AMDY+ E DE     +S+  A+D+EIL
Sbjct: 362 AMDYEEE-DEFDLNPISAPKANDIEIL 387

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  275 bits (702), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 180/585 (30%), Positives = 283/585 (48%), Gaps = 53/585 (9%)

Query: 57  NDSTNDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQ 116
           +  + DFD+ + +  + EPT+ E + L+RV G      + I ++E +ER SYYG      
Sbjct: 15  DGHSEDFDELDTQT-FPEPTERERSELRRVLGHPKWYVYFICLIEFSERASYYGTGDRLN 73

Query: 117 NYMQN-------------GPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTY 163
           N++Q                +++  G L +    AT L+    F  Y  P+  G+VAD Y
Sbjct: 74  NFIQKPLPAGGNGAGAPAPGSEATAGALGMGLQVATALNLLLTFLAYCFPLITGYVADRY 133

Query: 164 WGKYNSISVGTGFYIVGIFILFITAIPSIASQ-NASLGGFIVSIILIGIGTGFIKANLSV 222
           WG+   + +G    IV   +  I ++P +    +A+L   I+ II + I T F+K  L  
Sbjct: 134 WGRMRMLWIGVFVGIVSHVVFIIGSLPVVLGHGSAALAPCIIGIITLAIATAFVKPILLP 193

Query: 223 LIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGF 282
            +  Q P     VK L SGERVI D + +LQ + M FY  IN+GS   +AT+      G+
Sbjct: 194 TLLSQYPHATDVVKTLPSGERVIIDRDASLQRMTMTFYWSINVGSFLSVATSYSARDVGY 253

Query: 283 WAAYLLPFCFFWIAVVILVFGRKYYVKE-KMGDNVVQ---KSFKVC-------------- 324
           W A+L+P   F I   +L+  R+Y   E   G +++    K  KVC              
Sbjct: 254 WLAFLIPLALFMIMPAVLLVLRRYIKDEPPSGRSLIADCLKVLKVCFERNWWSRYRAGTF 313

Query: 325 WIVAK-------NKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQY 377
           W  AK        +  +  +KP ++PE         V + + TI+AC +F++Y IY +  
Sbjct: 314 WDYAKPSNLRSLGRQGWRKSKPGFYPE-------SLVQDARVTISACTIFLYYVIYNIND 366

Query: 378 GSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFT-PIRPITKI 436
           G + S   +Q +++   G+PND +  F+ + +I+F+PI +  VYP +R+     RP+ +I
Sbjct: 367 GGIGSIMNSQTASLTSKGVPNDLMSNFNPLCIIVFMPILDRVVYPLLRKLRWNFRPVFRI 426

Query: 437 TIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAWQIP-AYVLIAFSEIFA 495
             GF V   A    A++QH IY T PC ++   C+        W +   Y L  FSE  A
Sbjct: 427 FAGFMVAALASAVGAIIQHAIYQTSPCGNYATECEKGVSPISMWVVAIEYALTGFSECLA 486

Query: 496 SITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLA-VSCG 554
             TG E A+ ++PP MK+FVM++FL  +A  + LG  ++   VDP  V  FG LA +   
Sbjct: 487 MTTGYEIAFERSPPHMKTFVMALFLFMSALSAALGEIVTPSLVDPHLVIPFGVLAGLGAA 546

Query: 555 VTGILFWLCFRGLNATEEEMNAMDYDAEIDE---QSKRHLSSGAD 596
           V     W  +   +  E+E    +  A+ +E    + R   SGAD
Sbjct: 547 VAFAFLWRYWNLHHVMEQERIEREALAKQEEPALNTIRSYISGAD 591

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  254 bits (650), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 173/600 (28%), Positives = 278/600 (46%), Gaps = 51/600 (8%)

Query: 51  NLSNSANDSTNDFDDDEMEEG-------YEEPTDEELNTLKRVGGKIPLRCWLIGVVELA 103
            LS+         + D   EG         EPT+ E  TL+RV        + I ++E +
Sbjct: 6   KLSSVEKSQVAVLETDTYSEGGSGTPLSLPEPTEHERTTLRRVLEHPKWYVYFICLIEFS 65

Query: 104 ERFSYYGLSAPFQNYMQN----------------GPNDSPKGVLMLNSSGATGLSYFFQF 147
           ER SYYG      N++Q                   + +  G L +    AT L+    F
Sbjct: 66  ERASYYGTGDRLNNFIQQPLPAGGNGAGAPAHGAAGDSATAGALGMGLQTATALNLLLTF 125

Query: 148 WCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSI-ASQNASLGGFIVSI 206
             Y  P+  G++AD YW +   + +G    I+   I  I A+P +  +  A+L   ++ I
Sbjct: 126 LAYCFPLVTGYIADRYWSRMRMLWIGVFVGIISHVIFIIGALPPVLGNGQAALAPCVIGI 185

Query: 207 ILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIG 266
           I + I T F+K  L   +  Q P     V+ L SGERV+ D + +LQ + M FY  INIG
Sbjct: 186 ITLAIATSFVKPVLLPTLLSQYPHETDVVRTLASGERVLVDRDASLQRMTMTFYWSINIG 245

Query: 267 SMSVMATTELESHKGFWAAYLLPFCFFWIA-VVILVFGRKYYVKEKMGDNVVQ---KSFK 322
           S   +AT+      G+W A+L+P   + I   V+LV GR    +   G +++    K  +
Sbjct: 246 SFLSVATSYAARDIGYWLAFLIPLILYLIMPAVLLVLGRYLRDEPPSGRSMLADCCKVLR 305

Query: 323 VC-----WIVAKNKLDYNAAKPSYHPERNYP----------WNDRFVDEMKRTIAACKVF 367
           VC     W   ++   +N A+PS   +              + +  V + + T++A  +F
Sbjct: 306 VCFERGWWRRYRSGDFWNYARPSRLRQAGRAGWRRKGAGGFYAESLVQDTRVTLSASAIF 365

Query: 368 VFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRF 427
           ++Y IY +  G + S   +Q +++  +G+PND +  F+ + +I+F+P+ ++ +YP +R+ 
Sbjct: 366 LYYVIYNINDGGIGSIMNSQTASLTSNGVPNDLISNFNPLCIIVFMPVLDHVLYPVLRKM 425

Query: 428 T-PIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAWQIPA-Y 485
               +P+ +I  GF +   A    A++Q  IYNT PC  +   CD        W +   Y
Sbjct: 426 RWNFKPVYRIFCGFMIAALASAVGAIIQTVIYNTSPCGRYATECDKGVSPVSMWVVAVEY 485

Query: 486 VLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWL 545
            L   SE  A  TG E A+ ++P  MKSFVM++FL T+A  + LG  ++   VDP  V  
Sbjct: 486 ALTGLSECLAMTTGYEIAFERSPAHMKSFVMALFLFTSALSAALGEIVTPSLVDPHLVIP 545

Query: 546 FGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDE------QSKRHLSSGADDLE 599
           FG LA        +F   +  L+ T E   A     E +E       S R   SGA+D++
Sbjct: 546 FGVLAGLGAFMAFVFLWRYWSLDKTMELERAERRALEAEEGAMPAITSVRSYVSGAEDVD 605

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  228 bits (580), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 159/522 (30%), Positives = 249/522 (47%), Gaps = 38/522 (7%)

Query: 95  WLIGVVELAERFSYYGLSAPFQNYMQ-----------NGPNDSPKGVLMLNSSGATGLSY 143
           ++I ++ELAER SYYG      N+ Q            GP+D   G L      AT L+ 
Sbjct: 58  YMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPGALGRGLQVATSLNL 117

Query: 144 FFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPS-IASQNASLGGF 202
             +F  Y  P+  G+VAD Y G+   + +G    +V   I  I A+P+ I   N  +   
Sbjct: 118 VLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAALPAVIKHNNLCMALA 177

Query: 203 IVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLM 262
           ++ ++ + + T F+K  L  ++  Q P     VK L +GERVI + + +LQ + M FY  
Sbjct: 178 VLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNRDASLQRMSMTFYWC 237

Query: 263 INIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQ---K 319
           IN+GS   +AT       G+W ++L+P   F I   IL+  +   V   +G+++     K
Sbjct: 238 INVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKVTPPLGESLFAECLK 297

Query: 320 SFKVC--------------WIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACK 365
             KVC              W  AK        +  +   +   + +  V++ + T+AAC 
Sbjct: 298 VIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKESLVEDTRITLAACV 357

Query: 366 VFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIR 425
           +F++Y IY +    + S    Q  +M   G+PND +  F+ +A+II +PI +  + P +R
Sbjct: 358 IFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAIIITMPIIDYGLNPLLR 417

Query: 426 RFT-PIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSC-DTPNKIH--VAWQ 481
           R     +P+ +I  GF +   A    A++Q  IYNT PC  H  +C +T  ++     W 
Sbjct: 418 RLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHASTCSETIRQVSPLSRWL 477

Query: 482 IPA-YVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDP 540
           +   YVL   SE FA  TG E A+ ++P  MK+FVMS+FL+T A  SIL    + +  DP
Sbjct: 478 VGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTTALSSILTQIFNGIMTDP 537

Query: 541 KFVWLFGGLAVSCGVTGILF----WLCFRGLNATEEEMNAMD 578
             V  F   AV   +  ILF    W   + + A   E   +D
Sbjct: 538 YLVIPFILFAVLGTLFAILFLYRYWNLDKVMEAERRERAILD 579

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  215 bits (547), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 168/611 (27%), Positives = 289/611 (47%), Gaps = 58/611 (9%)

Query: 46  DVETYNLSNSANDSTNDFDDDEMEEGYE----EPTDEELNTLKRVGGKIPLRCWLIGVVE 101
           DV T  L + +N +T      E++E  +     PT+EE  TL+R+        +LI  +E
Sbjct: 13  DVST--LGSGSNAATVQEAPQEVKERSDIEIGLPTEEEERTLRRIVVHPSWYVYLICFIE 70

Query: 102 LAERFSYYGLSAPFQNY----MQNGPN---------DSPKGVLMLNSSGATGLSYFFQFW 148
           LAER SYYG      NY    +  G N         ++  G L    + AT L    +F 
Sbjct: 71  LAERASYYGTGDRLNNYYTYPLPEGGNGAGATAHGSEANSGALGKGLATATSLGLLLKFT 130

Query: 149 CYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQ-NASLGGFIVSII 207
            Y  P+  G++ D Y G   ++  G    +    I  ++A+P +    +A++   ++ +I
Sbjct: 131 SYFFPLVTGYLCDMYMGHVRTLWYGIWTGVASHIIFILSALPVVLKHPDAAMALSLIGLI 190

Query: 208 LIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIGS 267
            + + T F+K  L  L+  Q P     VK L++GERVI D + +LQ + M FY  INIG+
Sbjct: 191 TLSVCTAFVKPVLLPLLLQQYPHETNVVKTLETGERVIIDRDASLQRMTMTFYWAINIGA 250

Query: 268 MSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKM--GDNVVQKSFKVCW 325
              +AT+      GFW A+L+P   +    V+    +  ++K++   G +++    KV +
Sbjct: 251 FMSLATSYAAKEVGFWLAFLIPLIIYMAMPVVFSLVQP-HIKDRAPSGYSLLADCMKVLY 309

Query: 326 IV--------AKNKLDYNAAKPSYHPE-------RNYP-WNDRFVDEMKRTIAACKVFVF 369
           +          K  + ++ A PS   +       +  P + +  V + K T++AC +F +
Sbjct: 310 VAFGKGWNARRKEGVFWDYALPSNQRQMGKVGWRKKSPFYKESLVQDTKITLSACFIFCY 369

Query: 370 YPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFT- 428
           Y IY +    + +   +Q  +M  +G+PND +  F+ +++I+ IPI +  +YP +RR   
Sbjct: 370 YIIYNMNDNQLTTIINSQTGSMTKNGVPNDVISNFNPLSIIVLIPILDYGLYPLLRRLRI 429

Query: 429 PIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPN---KIHVAWQIPA- 484
             +P+ +I  GF +   +    A++Q  IY T  C  H  +C           +W +   
Sbjct: 430 NFKPVYRIFTGFMLAVASSVAGALIQWRIYETSSCGYHATTCSEKGLGVSPLSSWIVAVE 489

Query: 485 YVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVW 544
           Y L   SE  A  T  E AY ++P  MKSFV+++FL T+A  + +   ++ +  DP  + 
Sbjct: 490 YTLSGASECLAMTTAYEIAYDRSPEHMKSFVLALFLFTSAVSAAITQIVNPILKDPLLIV 549

Query: 545 LFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQSKRHL---SSGADDLEIL 601
            F   A    ++G  F   FR L   ++EM        + E+ +R L   SS +D+LE++
Sbjct: 550 PFALFAGIGFISGCHFLWKFRNL---DKEM--------LQEKRERELLQESSESDELEVV 598

Query: 602 PGPDNNNWRTS 612
              D    R++
Sbjct: 599 EIKDVKGSRSN 609

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  199 bits (505), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 152/531 (28%), Positives = 256/531 (48%), Gaps = 44/531 (8%)

Query: 70  EGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQ--------- 120
           E  + PT+ E  TL+R+     +  + I ++E AER S+YG      N+ Q         
Sbjct: 26  ETLQIPTEHEELTLRRIVTSPKIHLYFICLIEFAERGSFYGTGNRMGNFYQYPLPIGGNG 85

Query: 121 ---NGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFY 177
               GP +   G L    + AT +    +F  Y   +  G+++D Y G+   + +G  + 
Sbjct: 86  AGAPGPGEQDPGALGKGLAVATAMGLLLKFTSYTFSIITGYISDVYIGQIKMLWIGV-WL 144

Query: 178 IVGIFILFI-TAIPSI-ASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRV 235
            VG  ILFI  A+PS+ A  N +    +V+++ + + T F+K  L  L+  Q P +   V
Sbjct: 145 GVGSHILFIIAALPSVLAHTNVAYALSVVALLSLSLCTSFVKPVLLPLLLQQYPYKTNIV 204

Query: 236 KILKSGERVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWI 295
           K L SGERVI D + +LQ + MVFY  IN+G+   +AT       G+W A+ +P   + +
Sbjct: 205 KTLLSGERVIVDRDASLQRMTMVFYWAINVGAFLSLATAYSAQRVGYWLAFTVPLIIYLL 264

Query: 296 AVVIL-VFGRKYYVKEKMGDNVVQKSFKVC-----------------WIVAKNKLDYNAA 337
             ++L          E   ++V+ +S KV                  W  AK        
Sbjct: 265 MPIVLWKLQEDIKTNEPSRESVLAESLKVLKVCYEWGWIKRYWSGQFWDYAKPTNLIQQG 324

Query: 338 KPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIP 397
           +  +  ++   +++++V + K TI+AC +F++Y IY + + ++     +Q  +ME  G+P
Sbjct: 325 RIGWRKKKAGFYDEKYVYDTKLTISACTIFLYYVIYQM-HSNLDEPMRSQAGSMEGEGVP 383

Query: 398 NDFLQVFDSIALIIFIPIFENFVYPFIRRFT-PIRPITKITIGFFVGGCAMTWAAVLQHF 456
           ND    F+ I++I+ +PI +  +YP +RR+    +P+ +I  GF +G    T  A++Q  
Sbjct: 384 NDLFSNFNPISIIVVMPILDYVLYPLLRRYRINFKPVYRIFCGFMIGCLGSTVGAIIQWR 443

Query: 457 IYNTGPC-YDHPLSCDTPNKIHVA-----WQIP-AYVLIAFSEIFASITGLEYAYSKAPP 509
           +YNT PC Y    +C  P   H       W +   Y L   SE  A  TG E A+ ++P 
Sbjct: 444 VYNTSPCGYMGATTC--PELHHKKSPLSRWLVAIEYALGGTSECLAMTTGYEIAFERSPK 501

Query: 510 SMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILF 560
            MK FV+++F+ T A  S + + ++    DP  +  F   A    +T I+F
Sbjct: 502 KMKGFVLALFMFTVAISSAIILPITPFFKDPYLIQPFAVCAGVGALTAIIF 552

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 52/115 (45%), Gaps = 9/115 (7%)

Query: 117 NYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGF 176
           +++Q     +  GVL L++     L   F   C +  VF G + D Y G+   +  GT  
Sbjct: 102 DFIQRFGTKNEDGVLYLSTIRMGLLVSIFNIGCAIGSVFLGKLGDLY-GRRWGLIFGTSI 160

Query: 177 YIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKR 231
           ++VG+ I        IAS +     FI  II  GIG G I     +LI++  PK 
Sbjct: 161 FVVGVII-------QIASVSKWFQYFIGRIIA-GIGMGVIAVLSPMLISEVAPKE 207

>ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 483

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 77/186 (41%), Gaps = 44/186 (23%)

Query: 54  NSANDSTNDFDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLS- 112
            +A ++TN+ D   +EE Y +            GG    R WL  +      F  +G + 
Sbjct: 56  KAATEATNELD---VEEEYPD------------GG---YRAWLTVLGSFVGIFPIWGTAN 97

Query: 113 --APFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQFW---CYVTPVFGGFVADTYWGKY 167
               ++ Y+ N           L SSGA  +S+ F      C+V  VF G   D   G+ 
Sbjct: 98  ALGAYEGYISNH---------QLASSGAGEVSWIFALHMIACFVGCVFSGSYFDRNGGQ- 147

Query: 168 NSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSIIL-IGIGTGFIKANLSVLIAD 226
            +I VG+  Y+ GIF++         S+   L  FI++  L  G+G G +   L   +A 
Sbjct: 148 KAIIVGSVLYVFGIFMM---------SECTKLWHFILAFSLSSGVGAGILTTPLISCVAT 198

Query: 227 QLPKRK 232
              +R+
Sbjct: 199 WFHRRR 204

>NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 50/115 (43%), Gaps = 9/115 (7%)

Query: 117 NYMQNGPNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGF 176
           +Y+    +  P G   ++      L   F   C +  VF G + D+  G+   I VG   
Sbjct: 88  DYINRFGSTHPSGTKYMSKVRTGLLVSIFNVGCAIGSVFLGRLGDSI-GRRKGIVVGASI 146

Query: 177 YIVGIFILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKR 231
           YIVGI I        IAS +     FI  II  G+G+G I     +LI++  PK 
Sbjct: 147 YIVGIVI-------QIASIDKWFQYFIGRIIG-GLGSGAIAVLSPMLISEVSPKH 193

>ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} similar
           to uniprot|P36029 Saccharomyces cerevisiae YKL174C TPO5
           Protein involved in excretion of putrescine and
           spermidine putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 591

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 73/164 (44%), Gaps = 23/164 (14%)

Query: 144 FFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFI 203
           +++ W YV P      +++   KY+ +   +  YI+G+  LF          NA+   FI
Sbjct: 383 YYRLWTYVDPQ-----SESRVPKYSILLSMSISYILGLLPLF---------SNAAFNAFI 428

Query: 204 VSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMI 263
              +L       I   L VL+         R ++LK+    I+     + N+  V +L++
Sbjct: 429 GCAVLCLCSATLIPL-LLVLVT--------RRRVLKNAPVKIKYKLGWIANIGSVCWLLL 479

Query: 264 NIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYY 307
           ++ S+ +     + +    +A  +  FCFF I ++   +GRK++
Sbjct: 480 SMFSVCLPPQIPVTAKTMNYALLVFLFCFFIICILYYKWGRKHF 523

>NCAS0A09260 Chr1 (1829435..1831219) [1785 bp, 594 aa] {ON}
           Anc_1.305 YJL069C
          Length = 594

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 55  SANDSTNDFDDDEMEEGYEEPTDEELNTLKRV 86
           S+++ TND  DDE E+G E   D ++N L +V
Sbjct: 177 SSDEDTNDSSDDENEDGLEHVIDGDINALSKV 208

>NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 39/87 (44%), Gaps = 9/87 (10%)

Query: 145 FQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIV 204
           F   C +  VF G + DT  G+   I V    Y+VGI I     I S+      L G I+
Sbjct: 103 FNIGCAIGSVFLGRLGDTI-GRRKGIVVAVSIYMVGIVI----QIASVKKWFQYLIGRII 157

Query: 205 SIILIGIGTGFIKANLSVLIADQLPKR 231
           S    G+G G I     +LI++  PK 
Sbjct: 158 S----GLGAGCIAVLSPMLISEVSPKH 180

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.140    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,373,288
Number of extensions: 2887867
Number of successful extensions: 12070
Number of sequences better than 10.0: 53
Number of HSP's gapped: 12346
Number of HSP's successfully gapped: 53
Length of query: 619
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 503
Effective length of database: 40,180,143
Effective search space: 20210611929
Effective search space used: 20210611929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)