Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E045007.344ON32731215300.0
NCAS0E028907.344ON3152838411e-111
ZYRO0F11594g7.344ON3092897375e-96
Smik_12.2637.344ON3182907375e-96
TDEL0C020307.344ON3112907271e-94
YLR205C (HMX1)7.344ON3172817262e-94
KLLA0D12474g7.344ON3122897244e-94
Skud_12.2687.344ON3182787193e-93
Suva_10.2997.344ON3202827133e-92
Kwal_56.246247.344ON3072906854e-88
KLTH0H01386g7.344ON3072906835e-88
SAKL0F11242g7.344ON3092866829e-88
Kpol_530.367.344ON3112906602e-84
Ecym_47297.344ON3262896473e-82
TPHA0F029207.344ON3202896178e-78
CAGL0A03905g7.344ON2822686085e-77
KAFR0L014707.344ON3002835774e-72
KNAG0B026407.344ON3022965653e-70
ACL154W7.344ON3192815385e-66
TPHA0M017703.422ON21088740.68
NDAI0E041107.403ON56354694.1
YBR257W (POP4)1.346ON27962684.6
NCAS0H032702.613ON80638686.3
KAFR0D009208.20ON94537676.7
KNAG0J013207.368ON57247677.6
TBLA0A053201.69ON1629140679.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E04500
         (327 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   593   0.0  
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   328   e-111
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   288   5e-96
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   288   5e-96
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   284   1e-94
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   284   2e-94
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   283   4e-94
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   281   3e-93
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   279   3e-92
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   268   4e-88
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   267   5e-88
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   267   9e-88
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   258   2e-84
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   253   3e-82
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   242   8e-78
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   238   5e-77
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   226   4e-72
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   222   3e-70
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   211   5e-66
TPHA0M01770 Chr13 complement(366308..366940) [633 bp, 210 aa] {O...    33   0.68 
NDAI0E04110 Chr5 complement(921549..923240) [1692 bp, 563 aa] {O...    31   4.1  
YBR257W Chr2 (728885..729724) [840 bp, 279 aa] {ON}  POP4Subunit...    31   4.6  
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    31   6.3  
KAFR0D00920 Chr4 (192512..195349) [2838 bp, 945 aa] {ON} Anc_8.2...    30   6.7  
KNAG0J01320 Chr10 complement(238704..240422) [1719 bp, 572 aa] {...    30   7.6  
TBLA0A05320 Chr1 complement(1302526..1307415) [4890 bp, 1629 aa]...    30   9.0  

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/312 (95%), Positives = 298/312 (95%)

Query: 16  EALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSF 75
           EALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSF
Sbjct: 16  EALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSF 75

Query: 76  NTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQ 135
           NTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQ
Sbjct: 76  NTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQ 135

Query: 136 NKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLS 195
           NKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLS
Sbjct: 136 NKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLS 195

Query: 196 SKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEI 255
           SKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEI
Sbjct: 196 SKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEI 255

Query: 256 AKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFKAXXXXXXXXX 315
           AKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFKA         
Sbjct: 256 AKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFKAILMFVILLL 315

Query: 316 XXXXXVSRSLFT 327
                VSRSLFT
Sbjct: 316 LIQFFVSRSLFT 327

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  328 bits (841), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 167/283 (59%), Positives = 208/283 (73%), Gaps = 14/283 (4%)

Query: 16  EALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSF 75
           +ALANRINF TRDAHNKI+KKM++KLA+ALRHG IYRQGILTYYYIF+ VE EI  L + 
Sbjct: 16  KALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYYIFKVVEEEIIKLTT- 74

Query: 76  NTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQ 135
            +  T E+ + G+LLSK W+ EFNRT+ L KDL+LLY D +   + L  F+      +  
Sbjct: 75  -SPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEALQLFLETNATELPP 133

Query: 136 NKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLS 195
             +S    F+ +IH SI  NPC I AYCHVLYLALFAGGKII+SKIYKNLGFLPNFNHLS
Sbjct: 134 VLDS----FIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLGFLPNFNHLS 189

Query: 196 SKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEI 255
           SKE+F   TNFF+F        G + +  E KLKL+FK+N+ELNTR +LNE EK  IIE 
Sbjct: 190 SKEVFEKGTNFFKF--------GSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIET 241

Query: 256 AKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFND 298
           +K+IF +NL +MEELG  N+++LM+  +FK++ YL EEWKFND
Sbjct: 242 SKKIFDYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFND 284

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  288 bits (737), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 141/289 (48%), Positives = 194/289 (67%), Gaps = 15/289 (5%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINFHTRDAHNKI+  M+++LA AL+HG I+RQGIL YYYIFQA+E E++ ++   
Sbjct: 12  ALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQELDRIMDHA 71

Query: 77  TDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQN 136
            +  + Q +  ++L K W+ +F RTD++F+DL LLYS  F  +  L  F+     L    
Sbjct: 72  RNEKEMQMQ--NVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGNHLA--- 126

Query: 137 KNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSS 196
               L  FV+ IH ++Q  PC ILAYCHVLYLALFAGGK+++S +Y++ G  P F HLS 
Sbjct: 127 --PTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHLSP 184

Query: 197 KELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIA 256
           +EL    TNFF F+E     EG  +   ENKL+ ++KR +EL TR  L E +K  II ++
Sbjct: 185 RELVQRGTNFFTFSE-----EGSEA---ENKLRWRYKRGYELATRDELTEEQKQKIISVS 236

Query: 257 KQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFK 305
            +IFQWN+E++ E+G+ N++ELM   SF+L+ YL EEWK  D + KN K
Sbjct: 237 SEIFQWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQK 285

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  288 bits (737), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 146/290 (50%), Positives = 198/290 (68%), Gaps = 18/290 (6%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINFHTRDAHNKI+  M +K+A+A+RHG IYRQGIL YYY+F A+E EI+ LL  N
Sbjct: 17  ALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLL--N 74

Query: 77  TDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQN 136
              T ++ +T ++L + WL +F R+ +++KDLKLLYS+ F++ + L  F      L    
Sbjct: 75  DPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEF------LATFE 128

Query: 137 KNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSS 196
           K   L QFVN IH +IQ  PC IL+YCHVLYLALFAGGK+I+S +Y+ LG  PNF  LS 
Sbjct: 129 KPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQ 188

Query: 197 KELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIA 256
           KEL    TNFF F++           + E +LKL++K+N+EL TR+ L E +KL II +A
Sbjct: 189 KELVKKGTNFFTFSDLGP--------TEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240

Query: 257 KQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFN--DSIKKNF 304
           + IF WN   + E+G+ N++ELM  FSFK + Y++EEW FN   + +K+F
Sbjct: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSF 290

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  284 bits (727), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 139/290 (47%), Positives = 199/290 (68%), Gaps = 18/290 (6%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINFHTRDAHNK++  M+++LA AL+HG IYRQGIL +Y+IF AVE E++ LL  N
Sbjct: 16  ALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQELDRLL--N 73

Query: 77  TDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQN 136
                E+++   +L + WL EF RT+++FKDL++LYS  + + + L NF+       HQ 
Sbjct: 74  DPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVE------HQP 127

Query: 137 KNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSS 196
              +L  FV+ IH ++Q + C ILAYCHVLYLALFAGGK+++S +Y++ G  P F +L+ 
Sbjct: 128 LAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYLTP 187

Query: 197 KELFNNATNFFQFT-ENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEI 255
           KEL    TNFF F+ E SD+         ENKL+ K+K  +EL TR  L+E++K  I+++
Sbjct: 188 KELVIRGTNFFTFSDEGSDA---------ENKLRWKYKEGYELATRQELSESQKTRILQV 238

Query: 256 AKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFK 305
           + QIF WN++ + E+G+ N+ ELM+ FSFKL+ YL EEWK++  + K  K
Sbjct: 239 SSQIFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSK 288

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  284 bits (726), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 143/281 (50%), Positives = 191/281 (67%), Gaps = 16/281 (5%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINF TRDAHNKI+  M +K+A+A+RHG IYRQGIL YYY+F A+E EI+ LL  N
Sbjct: 17  ALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLL--N 74

Query: 77  TDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQN 136
              T+E+ +T ++L + WL +F R+ +++KDLKLLYS+ F++ + L  F      L    
Sbjct: 75  DPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEF------LATFQ 128

Query: 137 KNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSS 196
           K   L QF+N IH +I   PC IL+YCHVLYLALFAGGK+I+S +Y+ LG  PNF  LS 
Sbjct: 129 KPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQ 188

Query: 197 KELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIA 256
           KEL    TNFF F++           + E +LK ++K+N+EL TR+ L E +KL II +A
Sbjct: 189 KELVKKGTNFFTFSDLGP--------TEETRLKWEYKKNYELATRTELTEAQKLQIISVA 240

Query: 257 KQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFN 297
           + IF WN   + E+G+ N++ELM  FSFK I YL+EEW FN
Sbjct: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFN 281

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  283 bits (724), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 139/289 (48%), Positives = 200/289 (69%), Gaps = 16/289 (5%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINF TRD HNKI+  M++K+A A+RHG IYRQGI+ YYY+F A+E EI+ LL   
Sbjct: 17  ALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIEQEIDRLL--E 74

Query: 77  TDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQN 136
              T + ++   +L + W  EF R+DKL  DL++LY+D +   + L  F++  F+L    
Sbjct: 75  HPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDG-FQL---- 129

Query: 137 KNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSS 196
             +KL +FV+ IH ++Q  P  ILAYCHVLYLALFAGG+++KS +Y+++G  P F HLS 
Sbjct: 130 -PAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGHLSP 188

Query: 197 KELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIA 256
           KEL   ATNFF F+E     EG++   +EN+L+ ++K+ +EL TR+ L E EKL IIE++
Sbjct: 189 KELVRRATNFFTFSE-----EGVD---DENRLRWQYKKGYELATRTELTEAEKLRIIEVS 240

Query: 257 KQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFK 305
           + IFQ N+E + E+G+ N+ ELM  FS+KLI++L EEWK+++ +    K
Sbjct: 241 QTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVK 289

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  281 bits (719), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 139/278 (50%), Positives = 191/278 (68%), Gaps = 16/278 (5%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINFHTRDAHNKI+  M +++A+A+RHG IYRQGIL YYY+F A+E EI+ LL  +
Sbjct: 17  ALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLL--H 74

Query: 77  TDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQN 136
              T+++ +T ++L + WL +F R+ +++KDLKLLYS+ F++ + L  F      L    
Sbjct: 75  DPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEF------LAKFE 128

Query: 137 KNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSS 196
           K   L QFVN IH +I+  PC IL+YCHVLYLALFAGGK+I+S +Y+ LG  PNF  LS 
Sbjct: 129 KPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERLSQ 188

Query: 197 KELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIA 256
           KEL    TNFF F++           + E +LKL++K+N+EL TR+ L E +KL II +A
Sbjct: 189 KELVKKGTNFFTFSDLGP--------TEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240

Query: 257 KQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEW 294
             IF WN   + E+G+ N++ELM  FSFK + Y++EEW
Sbjct: 241 GGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEW 278

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  279 bits (713), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 140/282 (49%), Positives = 193/282 (68%), Gaps = 18/282 (6%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINFHTRDAHNKI+  M +K+A+A+RHG IYRQGIL YYY+F A+E EI+ LL+  
Sbjct: 19  ALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLN-- 76

Query: 77  TDATKEQK-RTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQ 135
            DA  E++ +   +L + WL +F R+ +++KDLKLLYS+ F++ + L  F      L   
Sbjct: 77  -DAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEF------LATF 129

Query: 136 NKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLS 195
            K   L QFV+ IH +I+  PC IL+YCHVLYLALFAGGK+I+S +Y+ LG  PNF  L+
Sbjct: 130 EKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLT 189

Query: 196 SKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEI 255
            KEL    TNFF F+E           + E +LK ++K+N+EL TR+ L E +KL II +
Sbjct: 190 QKELVKKGTNFFTFSELGP--------TEETRLKWEYKKNYELATRTELTEAQKLKIISV 241

Query: 256 AKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFN 297
           A+ IF WN   + E+G+ N++ELM+ FSFK + Y++EEW F+
Sbjct: 242 AEGIFDWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFS 283

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  268 bits (685), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 124/290 (42%), Positives = 193/290 (66%), Gaps = 16/290 (5%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINF+TRD HNKIDK+M++K A A++HG IYRQG+L ++Y+FQA+E EI+ LL   
Sbjct: 12  ALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAIEQEIDRLL--Q 69

Query: 77  TDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQN 136
              T E+ +T  +L + W++ F+RT ++++DLKLLY+  F +D+ L  F+ +      Q 
Sbjct: 70  NAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQQNTLPPEQQ 129

Query: 137 KNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSS 196
                  FV+F+H S++  P  ILA+CHVLYLALFAGG++++S IY++ G  P F  L+ 
Sbjct: 130 G------FVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPDLTP 183

Query: 197 KELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIA 256
           +E+    TNFF F++        + +  EN+L+ ++KR +EL TR  L E++KL I+E+A
Sbjct: 184 EEVVRKGTNFFTFSD--------DGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVA 235

Query: 257 KQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFKA 306
              F+WN   + E+G+ N++ELM   SFKL+++  +EWK  + + +  K+
Sbjct: 236 AATFEWNTRVISEIGEINRQELMGKLSFKLVSFAIDEWKHTEKLTRRQKS 285

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  267 bits (683), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 124/290 (42%), Positives = 191/290 (65%), Gaps = 16/290 (5%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINFHTRD HNKIDK+M+ K A A++HG IYRQG+L ++Y+FQA+E E++ L    
Sbjct: 12  ALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQELDRLR--Q 69

Query: 77  TDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQN 136
              T E+++T  +L++ W  EF R  ++ +DL+LLY+  F     L  F+ E        
Sbjct: 70  EAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEE------TT 123

Query: 137 KNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSS 196
              +L  FV+++H SI++ P  ILAYCHVLYLALFAGG++++S IY++ G  P F +L++
Sbjct: 124 LAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNLTT 183

Query: 197 KELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIA 256
           +E+    TNFF F   SD+      +  EN+L+  +KR +EL TR  L E +KL I++++
Sbjct: 184 EEVVRRGTNFFTF---SDA-----GVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVS 235

Query: 257 KQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFKA 306
             IF+WN   + E+G+ N++ELM   SF+L+ ++ EEW+++D + +  K+
Sbjct: 236 NAIFEWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKS 285

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  267 bits (682), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 190/286 (66%), Gaps = 16/286 (5%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINFHTRD+HNKI+  M++KLA A++HG IYRQGIL +YYIF AVE EI+ LL   
Sbjct: 14  ALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVEQEIDNLL--Q 71

Query: 77  TDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQN 136
             +T  + +T  +L++ W  EF R++ +F+DL+LLYS  +    +L  F+++      Q 
Sbjct: 72  NASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDDNVLPPQQQ 131

Query: 137 KNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSS 196
                  FV +IH +++  P  ILAYCHVLYLALFAGGK++KS IY++ G  P F HL+ 
Sbjct: 132 A------FVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQHLTP 185

Query: 197 KELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIA 256
           +++    TNFF F+E     EG        KL+ ++K+ +EL TR  L E +K  II+++
Sbjct: 186 EQIVRRGTNFFTFSEEGADAEG--------KLRWEYKKGYELATRKELTEEQKQEIIKVS 237

Query: 257 KQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKK 302
            +IF WN++ + ELG+ N+ ELM  FSFKL++++ EEWK+++ + K
Sbjct: 238 SEIFDWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSK 283

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  258 bits (660), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 135/290 (46%), Positives = 192/290 (66%), Gaps = 15/290 (5%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINF TRD HNK+   M ++LA+AL+HG IYR+G++ +Y+IF  +E+EI+ +L+  
Sbjct: 13  ALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIETEIDLVLNNQ 72

Query: 77  TDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQD-LLNFINEEFKLIHQ 135
            D+     +   +LS  +L EF R DK+ KDL+LLY   FQND+  LL FIN +      
Sbjct: 73  DDS-----QMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINSDR---FT 124

Query: 136 NKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLS 195
           N + +L  FV +I  +   +PC +LAYCHVLYLALFAGGKI+KS + K+LG  P F HLS
Sbjct: 125 NDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPKFEHLS 184

Query: 196 SKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEI 255
            KE+    TNF+QFT+++      N  + + KL+  +K+N+EL+TR  L E +KLT+I+ 
Sbjct: 185 HKEIIARGTNFYQFTDST------NPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKT 238

Query: 256 AKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFK 305
           +K +F      + E+G RN+ ELMN+FS+KL  ++ EEWK+N SI    K
Sbjct: 239 SKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLK 288

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  253 bits (647), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 130/289 (44%), Positives = 187/289 (64%), Gaps = 16/289 (5%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINF TRD H K D  +  K+A+A+RHG IYRQGIL +YYIF AVE +I+ LL   
Sbjct: 30  ALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQIDRLLE-- 87

Query: 77  TDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQN 136
           T +TKE+ +  ++L + W  EF R+ +L +DL+  Y   +    +L  F+N+ F+L    
Sbjct: 88  TPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLND-FEL---- 142

Query: 137 KNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSS 196
              KL +FV+FI      NP  ILAYCHVLY ALFAGGK+++S IY+N+G  P    +S+
Sbjct: 143 -PPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGISA 201

Query: 197 KELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIA 256
            E   N TNFF F+++         +  ENKL+ ++K+N+EL TR  L+EN+KL II+++
Sbjct: 202 AESSRNGTNFFTFSDDG--------VDEENKLRWQYKKNYELATREGLDENQKLEIIDVS 253

Query: 257 KQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFK 305
              FQ  ++ + E+G+ N+KELMN+FSFKL+ +L  EW++N  +    K
Sbjct: 254 IANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVK 302

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  242 bits (617), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 127/289 (43%), Positives = 193/289 (66%), Gaps = 11/289 (3%)

Query: 16  EALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLL-S 74
           +ALANRINF TRD HNKI   M+++LA+ALRHG IYRQG++ +Y+IF  +E+EI+ LL +
Sbjct: 14  KALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENEIDNLLNT 73

Query: 75  FNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQ-NDQDLLNFINEEFKLI 133
            +++    Q +T  +L   ++ EF R D L +DL +LY   F+ N QD+L+F+N E    
Sbjct: 74  LDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFLNSE--TF 131

Query: 134 HQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNH 193
           ++    +L  F ++I  + +  P  I+AYCHVLYLALFAGGKI+KS + KN+G  P F+H
Sbjct: 132 NKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLFPKFDH 191

Query: 194 LSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTII 253
           +S +E+ N  +NFF+FT+        ++   ++KL+ ++K+N+EL+TR  LNE +K  II
Sbjct: 192 MSHEEVTNQGSNFFRFTQE-------DTADFDSKLRFEYKKNYELSTRDELNEMQKNDII 244

Query: 254 EIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKK 302
           E++K IF      + E+G +N+ +LM  F+ K I YL EEWK+N+ + K
Sbjct: 245 EVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTK 293

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  238 bits (608), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 174/268 (64%), Gaps = 23/268 (8%)

Query: 37  MTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFNT--------DATKEQKRTGS 88
           M+++ AVALRHG +YRQGIL +YY+FQA+E EI+ LLS +T        D + ++     
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 89  LLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQNKNSKLYQFVNFI 148
           ++ + W+ EF RT++L+KDL LLYS  +    +L      +  L+      +L  FV+ +
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTEL------DAMLVDHQLPPQLQGFVDMV 114

Query: 149 HISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSSKELFNNATNFFQ 208
           H +++ NP  +LAYCHV+YLALFAGGK+++S +Y+N G  P F HLSSKEL    TNFF 
Sbjct: 115 HATVRQNPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFT 174

Query: 209 FTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIAKQIFQWNLESME 268
           F++          +  EN+LK ++K+N+EL TR  L EN+KL II++AK+IF+ N++ ++
Sbjct: 175 FSD--------AGVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQ 226

Query: 269 ELGQRNQKELMNLFSFKLINYLFEEWKF 296
           E+GQ N++ L N     L+ Y+FEE KF
Sbjct: 227 EIGQLNKEALTN-NKLDLLQYVFEELKF 253

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  226 bits (577), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 186/283 (65%), Gaps = 29/283 (10%)

Query: 16  EALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSF 75
           +ALANRINFHTRD HN IDK M++K   ALRH  IY+  +L+YYY+F+ +E EI++++S 
Sbjct: 12  DALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDEIDFIIS- 70

Query: 76  NTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQ 135
                 ++   G +L   +  +F R D++ KDLK L   + Q+D   L+           
Sbjct: 71  -----NDRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDDQWLS----------- 114

Query: 136 NKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGF--LPNFNH 193
               +L +F+NFI  ++  +P  +LAYCHVLYLALFAGG+I+++ + KNL F  +P F+ 
Sbjct: 115 -SRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDK 173

Query: 194 LSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTII 253
           +S  ++  NATNFF+F ++         I +ENKLK ++KRN+++ T++ LNE+EKL II
Sbjct: 174 MSHTDVIMNATNFFKFDKD---------IVSENKLKSEYKRNYDILTKAKLNEDEKLEII 224

Query: 254 EIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKF 296
           +I+++IF++N   ++E+G  N+ ELM  F++K++ Y+ EEWKF
Sbjct: 225 DISREIFKFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKF 267

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  222 bits (565), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 118/296 (39%), Positives = 173/296 (58%), Gaps = 36/296 (12%)

Query: 16  EALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSF 75
           +ALANRINFHTRD HN++DK  ++K  +ALRH  IY   + T+Y +F  VE  I+ L+  
Sbjct: 12  DALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVEQRIDELI-- 69

Query: 76  NTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYS-DRFQNDQDLLNFINEEFKLIH 134
              A++     G++L + ++ EF R DK+ +DL  L   D  ++ Q              
Sbjct: 70  ---ASEGGDGVGAILGEFYVPEFRRADKIKRDLVFLGEWDTVESGQ-------------- 112

Query: 135 QNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFN-- 192
                +L  F+ ++   +  +P  +LA CHVLYLALFAGG++ KS ++KNLGFLPNF   
Sbjct: 113 WTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDK 172

Query: 193 -----HLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNEN 247
                 +S   L +NATNFFQF E         +I +ENKL+  +KRN+EL TR  L E+
Sbjct: 173 NGPGEEMSDHTLVSNATNFFQFAE---------TIEDENKLRWTYKRNYELATRDTLTED 223

Query: 248 EKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKN 303
           +KL +I  ++ +F+     +EE+ Q+N  ELM+  SFK++ Y  EEWKFN + K+ 
Sbjct: 224 QKLAVIAASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKRG 279

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  211 bits (538), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 111/281 (39%), Positives = 162/281 (57%), Gaps = 17/281 (6%)

Query: 17  ALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFN 76
           ALANRINFHTR+ H+K D  ++ K AVALRH  IYRQG+L  YYIF++VE  I+ LL   
Sbjct: 26  ALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVEQHIDRLL--R 83

Query: 77  TDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQN 136
             AT ++ R G +L   W  EF R   L +D ++ Y+  +     L  F++  ++L    
Sbjct: 84  APATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLD-SYEL---- 138

Query: 137 KNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSS 196
              +L   V  I  +    P  ILA+CHVLYLALFAGG++++S + + LG LP    LS+
Sbjct: 139 -PPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAAGLSA 197

Query: 197 KELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIA 256
           +E     T+FF F   +           ENK ++ +KR +EL TR+ L+E EK  +I+ A
Sbjct: 198 RETQLRGTHFFTFGAGA---------GEENKARVAYKRAYELATRTALSEAEKADVIDAA 248

Query: 257 KQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFN 297
           +  F      M EL  RN++EL+   S++L+ +L EEW++ 
Sbjct: 249 RADFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYR 289

>TPHA0M01770 Chr13 complement(366308..366940) [633 bp, 210 aa] {ON}
           Anc_3.422 YPR107C
          Length = 210

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 167 YLALFAGGKIIKSKIYKNLGFL---PNFN--HLSSKELFNNATNFFQFTENSDSLEGINS 221
           YL +    KI K + Y+ LG+    PN N  H+S        T F    +  DS   + +
Sbjct: 111 YLHIDPLNKIPKCEDYE-LGYCAQGPNCNKRHISKTLCQRYLTGFCPLGKGCDSAHPVFN 169

Query: 222 ISNENKLKLKFKRNFELNTRSNLNENEK 249
           I N N   ++ K++ E+NTR +  E E+
Sbjct: 170 IWNMNDDSIRIKKDEEINTRQSDAEKER 197

>NDAI0E04110 Chr5 complement(921549..923240) [1692 bp, 563 aa] {ON}
           Anc_7.403 YBL080C
          Length = 563

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 5/54 (9%)

Query: 192 NHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLN 245
           +H SS E  N+ TNFF       SL G   I N   +    K +  LN++ NLN
Sbjct: 54  HHPSSSETPNSHTNFFDL-----SLPGTQPILNHESILFALKLSLALNSKINLN 102

>YBR257W Chr2 (728885..729724) [840 bp, 279 aa] {ON}  POP4Subunit of
           both RNase MRP and nuclear RNase P; RNase MRP cleaves
           pre-rRNA, while nuclear RNase P cleaves tRNA precursors
           to generate mature 5' ends and facilitates turnover of
           nuclear RNAs; binds to the RPR1 RNA subunit in RNase P
          Length = 279

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 6/62 (9%)

Query: 91  SKIWLTEF--NRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQNKNSKLYQFVNFI 148
           SKI L E+  N      K LKL Y ++  + +DLL++I E+   I+++    L Q+V+F+
Sbjct: 85  SKIALREYINNCKKNTKKCLKLAYENKITDKEDLLHYIEEKHPTIYES----LPQYVDFV 140

Query: 149 HI 150
            +
Sbjct: 141 PM 142

>NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.613
           YMR049C
          Length = 806

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 233 KRNFELNTRSNLNENEKLTIIEIAKQIFQWNLESMEEL 270
           K N E+N   + N+ E   +  + KQI QWN  S ++L
Sbjct: 545 KSNMEVNGSDDENDAEANNVAAVKKQIAQWNKPSQKQL 582

>KAFR0D00920 Chr4 (192512..195349) [2838 bp, 945 aa] {ON} Anc_8.20
           YLR067C
          Length = 945

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (64%)

Query: 192 NHLSSKELFNNATNFFQFTENSDSLEGINSISNENKL 228
           NHL +KE+F+  T+F++    S S+  +  + NE++L
Sbjct: 452 NHLVAKEIFHIMTDFYKIKPTSLSISALMKVLNESEL 488

>KNAG0J01320 Chr10 complement(238704..240422) [1719 bp, 572 aa] {ON}
           Anc_7.368 YER087W
          Length = 572

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 97  EFNRT-DKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQNKNSKLY 142
           E NR  D +FK+LK+ Y   + ++ D+   I++E+ L+H++    ++
Sbjct: 179 ETNRAYDLIFKELKVPYVKAWADNGDMGGDISKEYHLVHESGEDTIF 225

>TBLA0A05320 Chr1 complement(1302526..1307415) [4890 bp, 1629 aa]
           {ON} Anc_1.69 YLR189C
          Length = 1629

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 59/140 (42%), Gaps = 19/140 (13%)

Query: 111 LYSDRFQNDQDLLNFINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLAL 170
           LY  + QN+++  +  NE    I+ N ++ + +  N   ISI+  P C         L  
Sbjct: 375 LYQSQTQNNKNK-SIENESISDINSNGSTGINRKPNLFSISIE--PACD-------SLED 424

Query: 171 FAGGKIIKSKIYKNLGFLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKL 230
            A     K+    N G LP     S+ E     T   Q    S +  GI+ +S  NKL  
Sbjct: 425 MASKGTSKTDTESNKGTLPKIIVGSANEDIPTQTLQRQL---SKTESGISQLSPTNKLLE 481

Query: 231 KFKRNFELNTRSNLNENEKL 250
           KF+  F      NL+ +EK+
Sbjct: 482 KFRETF------NLSSDEKI 495

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,384,041
Number of extensions: 1692422
Number of successful extensions: 8523
Number of sequences better than 10.0: 141
Number of HSP's gapped: 8865
Number of HSP's successfully gapped: 142
Length of query: 327
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 217
Effective length of database: 40,868,139
Effective search space: 8868386163
Effective search space used: 8868386163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)