Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E044907.345ON1511516443e-87
Suva_14.2512.201ON142136691.1
ZYRO0C15422g2.201ON142739671.9
KLLA0F03531g2.253ON1465114662.6
Suva_8.144.4ON63046662.7
YNL163C (RIA1)2.92ON111063662.8
CAGL0H06963g8.875ON51790653.0
TBLA0A106304.370ON140729619.9
NOTE: 16 genes in the same pillar as NDAI0E04490 were not hit in these BLAST results
LIST: Kpol_2001.72 Zrou_YGOB_Anc_7.345 KAFR0L01475 Skud_12.267 CAGL0A03883g Smik_12.262 YLR204W Suva_10.298 KLTH0H01364g Kwal_56.24628 ACL153C Ecym_4728 TPHA0D04575 KLLA0D12452g KNAG0B02635 SAKL0F11264g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E04490
         (151 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E04490 Chr5 (1009082..1009537) [456 bp, 151 aa] {ON}             252   3e-87
Suva_14.251 Chr14 (456403..460668) [4266 bp, 1421 aa] {ON} YNL08...    31   1.1  
ZYRO0C15422g Chr3 complement(1203357..1207640) [4284 bp, 1427 aa...    30   1.9  
KLLA0F03531g Chr6 complement(328830..333227) [4398 bp, 1465 aa] ...    30   2.6  
Suva_8.14 Chr8 complement(25217..27109) [1893 bp, 630 aa] {ON} Y...    30   2.7  
YNL163C Chr14 complement(326741..330073) [3333 bp, 1110 aa] {ON}...    30   2.8  
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    30   3.0  
TBLA0A10630 Chr1 (2628510..2632733) [4224 bp, 1407 aa] {ON} Anc_...    28   9.9  

>NDAI0E04490 Chr5 (1009082..1009537) [456 bp, 151 aa] {ON} 
          Length = 151

 Score =  252 bits (644), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 126/151 (83%)

Query: 1   MLPLFFSRMPASRPLSILKGNARFLSTQLKNTNQSYHHHGDDTMISTMMNLSKSRLINSN 60
           MLPLFFSRMPASRPLSILKGNARFLSTQLKNTNQSYHHHGDDTMISTMMNLSKSRLINSN
Sbjct: 1   MLPLFFSRMPASRPLSILKGNARFLSTQLKNTNQSYHHHGDDTMISTMMNLSKSRLINSN 60

Query: 61  DIFELSSKSALGLDRKFQCNINDISNMIPMFGRTLIENAEQVVINDVTNLSNVEMHLDSV 120
           DIFELSSKSALGLDRKFQCNINDISNMIPMFGRTLIENAEQVVINDVTNLSNVEMHLDSV
Sbjct: 61  DIFELSSKSALGLDRKFQCNINDISNMIPMFGRTLIENAEQVVINDVTNLSNVEMHLDSV 120

Query: 121 LXXXXXXXXXXXXXXXXXXXXXXXXXLSQGR 151
           L                         LSQGR
Sbjct: 121 LRKRRKKMKKHKLRKRRKRQRAEKRKLSQGR 151

>Suva_14.251 Chr14 (456403..460668) [4266 bp, 1421 aa] {ON} YNL088W
           (REAL)
          Length = 1421

 Score = 31.2 bits (69), Expect = 1.1,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 37  HHHGDDTMISTMMNLSKSRLINSNDIFELSSKSALG 72
           +HHG+D++  T++ L++S  + SN+I+ L    A G
Sbjct: 733 YHHGEDSLAQTIIGLAQS-FVGSNNIYLLLPNGAFG 767

>ZYRO0C15422g Chr3 complement(1203357..1207640) [4284 bp, 1427 aa]
           {ON} similar to uniprot|P06786 Saccharomyces cerevisiae
           YNL088W TOP2 Essential type II topoisomerase catalyzes
           topology changes in DNA via transient breakage and
           rejoining of phosphodiester bonds in the DNA backbone
           localizes to axial cores in meiosis
          Length = 1427

 Score = 30.4 bits (67), Expect = 1.9,   Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 26/39 (66%), Gaps = 1/39 (2%)

Query: 34  QSYHHHGDDTMISTMMNLSKSRLINSNDIFELSSKSALG 72
           Q+ +HHG D++  T++ L++S  + SN+I+ L+   + G
Sbjct: 730 QTDYHHGPDSLAQTIIGLAQS-FVGSNNIYVLNPIGSFG 767

>KLLA0F03531g Chr6 complement(328830..333227) [4398 bp, 1465 aa] {ON}
            some similarities with uniprot|P40477 Saccharomyces
            cerevisiae YIL115C NUP159 Subunit of the nuclear pore
            complex that is found exclusively on the cytoplasmic side
            forms a subcomplex with Nup82p and Nsp1p
          Length = 1465

 Score = 30.0 bits (66), Expect = 2.6,   Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query: 11   ASRPLSILKGNARFLSTQLKNTNQSYHHHGDDTMISTMMNLSKSRLINSNDIFELSSKSA 70
            A+  L IL   A+  S +LK   QSY    D +   T  ++  + L    DI ELS++++
Sbjct: 1279 AATLLDILTSKAK-QSYELK---QSYQRLADSSSAVTNFDMLITTLKRQYDILELSNRTS 1334

Query: 71   LGLDRKFQCNINDISNMIPM----FGRTLIENAEQVVINDVTNLSNVEMHLDSV 120
               +RK   + + IS M+          L E  E + +  + NL+N +  L +V
Sbjct: 1335 NHSNRKLSWSQHHISTMVKRKLEEVSSKLDEIRESIQVLKLYNLTNTKEALHAV 1388

>Suva_8.14 Chr8 complement(25217..27109) [1893 bp, 630 aa] {ON}
           YHL038C (REAL)
          Length = 630

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 71  LGLDRKFQCNINDISNMIPMFGRTLIENAEQVVINDVTNLSNVEMH 116
           L L  KF+  I D  N IP   +TL+    Q   N V +L+++E+H
Sbjct: 533 LTLSEKFKIVILDKQNAIPETFKTLLMFLTQTRTNFVEDLTDIELH 578

>YNL163C Chr14 complement(326741..330073) [3333 bp, 1110 aa] {ON}
           RIA1Cytoplasmic GTPase involved in ribosomal biogenesis;
           with Sdo1p, promotes release of Tif6p from 60S ribosomal
           subunits in the cytoplasm so that they can assemble with
           40S subunits to generate mature ribosomes
          Length = 1110

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%)

Query: 30  KNTNQSYHHHGDDTMISTMMNLSKSRLINSNDIFELSSKSALGLDRKFQCNINDISNMIP 89
           KNT+  Y    D  M   +   +K +   +ND+F + S+ +  LD +F+    D S+   
Sbjct: 468 KNTSDLYKRAKDTVMTPEVGEQTKPKPSRNNDVFCVVSEPSSALDLEFEYEGEDDSDSQD 527

Query: 90  MFG 92
            FG
Sbjct: 528 NFG 530

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 10/90 (11%)

Query: 8   RMPASRPLSILKGNARFLSTQLKNTNQSYHHHGDDT-MISTMMNLSKSRLINSNDIFELS 66
           R P ++  SI+ GN   L    +  N      G+DT  +S ++     + I+ +DIF + 
Sbjct: 71  RQPFTKQ-SIVIGNKYVLQFNGELYNDEIIESGNDTQFLSGLL----KKCISEDDIFNIL 125

Query: 67  SKSALGLDRKFQCNINDISNMIPMFGRTLI 96
                GLD +F   I D+ N +  FGR  I
Sbjct: 126 H----GLDGEFAFTIQDLENNLIYFGRDTI 151

>TBLA0A10630 Chr1 (2628510..2632733) [4224 bp, 1407 aa] {ON}
           Anc_4.370 YJR137C
          Length = 1407

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 1/29 (3%)

Query: 84  ISNMIPMFGRTLIENAEQVVINDVTNLSN 112
           I N+ P FG+ LIEN + VV+ D+ + SN
Sbjct: 184 IINLTP-FGKQLIENTKSVVVYDLLSYSN 211

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.132    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,445,286
Number of extensions: 480532
Number of successful extensions: 2141
Number of sequences better than 10.0: 32
Number of HSP's gapped: 2139
Number of HSP's successfully gapped: 32
Length of query: 151
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 51
Effective length of database: 42,014,799
Effective search space: 2142754749
Effective search space used: 2142754749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)