Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E044807.346ON44344324040.0
NCAS0E028807.346ON42941217430.0
Kpol_530.357.346ON42540416650.0
Smik_12.2617.346ON43641516590.0
Suva_10.2977.346ON43641516530.0
YLR203C (MSS51)7.346ON43641116460.0
Skud_12.2667.346ON43641116380.0
TDEL0C020207.346ON42540216290.0
SAKL0F11286g7.346ON42341016170.0
KLLA0D12430g7.346ON41840416150.0
CAGL0A03927g7.346ON43741816170.0
TPHA0F029307.346ON43640215770.0
Ecym_47277.346ON42940215690.0
Kwal_56.246317.346ON42241615510.0
KLTH0H01342g7.346ON42241515490.0
ZYRO0F11616g7.346ON41540215420.0
KNAG0B026307.346ON43841115430.0
KAFR0B008407.346ON42640415240.0
KNAG0C037507.346ON42440215010.0
TBLA0E005007.346ON43743414860.0
NCAS0A141207.346ON42743114750.0
ACL152W7.346ON42841314590.0
NDAI0A019307.346ON45042814410.0
KLTH0G11418g8.357ON89799770.67
Skud_10.1581.319ON716139741.7
NDAI0I011806.195ON427149731.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E04480
         (443 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   930   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   676   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   645   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   643   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   641   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   638   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   635   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   632   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   627   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   626   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   627   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   612   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   608   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   602   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   601   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   598   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   598   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   591   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   582   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   577   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   572   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   566   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   559   0.0  
KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} simila...    34   0.67 
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...    33   1.7  
NDAI0I01180 Chr9 complement(284047..285330) [1284 bp, 427 aa] {O...    33   1.9  

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/443 (100%), Positives = 443/443 (100%)

Query: 1   MLCRCVSRLPTAYRSRLPTTLCFTPNPRNFRNNAHVSHHSSRSLMGFVRNALGLDPKSSP 60
           MLCRCVSRLPTAYRSRLPTTLCFTPNPRNFRNNAHVSHHSSRSLMGFVRNALGLDPKSSP
Sbjct: 1   MLCRCVSRLPTAYRSRLPTTLCFTPNPRNFRNNAHVSHHSSRSLMGFVRNALGLDPKSSP 60

Query: 61  DDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEINYTCPISGIPTHHSKNAWEM 120
           DDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEINYTCPISGIPTHHSKNAWEM
Sbjct: 61  DDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEINYTCPISGIPTHHSKNAWEM 120

Query: 121 DENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFDRMINMTNWDLFLYTRSFYS 180
           DENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFDRMINMTNWDLFLYTRSFYS
Sbjct: 121 DENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFDRMINMTNWDLFLYTRSFYS 180

Query: 181 MDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLEGLKSMAALRYTLYPFHNKS 240
           MDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLEGLKSMAALRYTLYPFHNKS
Sbjct: 181 MDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLEGLKSMAALRYTLYPFHNKS 240

Query: 241 FMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFELFFIGPEAYYDKEKKQYLK 300
           FMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFELFFIGPEAYYDKEKKQYLK
Sbjct: 241 FMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFELFFIGPEAYYDKEKKQYLK 300

Query: 301 LDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDVFFIFHPGFSAIETTEHWMND 360
           LDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDVFFIFHPGFSAIETTEHWMND
Sbjct: 301 LDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDVFFIFHPGFSAIETTEHWMND 360

Query: 361 TMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDILMKPVKNVFGSTKWELNDLNP 420
           TMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDILMKPVKNVFGSTKWELNDLNP
Sbjct: 361 TMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDILMKPVKNVFGSTKWELNDLNP 420

Query: 421 QDVYQFNMYIAGFRGKRYPTVEL 443
           QDVYQFNMYIAGFRGKRYPTVEL
Sbjct: 421 QDVYQFNMYIAGFRGKRYPTVEL 443

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/412 (76%), Positives = 368/412 (89%)

Query: 31  RNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTL 90
           RN  +V+ + +R LMGFVRNALGLDP +SPDDPTPENRFHPWDQSP  DLRERAA+IRTL
Sbjct: 17  RNAFNVAGNQTRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERAARIRTL 76

Query: 91  AHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFP 150
           A CPVT KEINYTCPISGIPTHHS+ AWE D+ YH++K YE+LKKVNIYEHDLRSGRPFP
Sbjct: 77  ARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFP 136

Query: 151 EFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPY 210
           EF FP+DQ  DRM+NMTNWDLFLYTR+FYSMDTEFQMAAVTKMLSYPITIGS+LHQFSPY
Sbjct: 137 EFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPY 196

Query: 211 SLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQ 270
           SLQPKGPI+LEGLKS+AALRYTLYP  N+  ++ TK RPMRIF+LGARAE+QLPGH+WKQ
Sbjct: 197 SLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQ 256

Query: 271 LQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQD 330
           LQYLFPEQ FE+ FIGPE+YYDK+KK+Y++L  P+ +++D+TLKL + TEYFH LHE+QD
Sbjct: 257 LQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQD 316

Query: 331 LFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILD 390
            FPYDPYMDVFFIFHPGF++ E  EHWM DTMK LL+T+CAIF TGF++ND+L D+ ++ 
Sbjct: 317 FFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQ 376

Query: 391 EKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442
           +KY  +LDILMKP KNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRYPT++
Sbjct: 377 DKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/404 (75%), Positives = 355/404 (87%), Gaps = 2/404 (0%)

Query: 42  RSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEIN 101
           RSLMGFVRNALGLDP  SPDDPTPENRFHPWDQSPC DLRERAAKIRTLA CPVT+K+IN
Sbjct: 22  RSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDIN 81

Query: 102 YTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFD 161
           YTCP+SGIPTHH K AW MD++YH +K YEILKKVNIYEHDLRSGRPFPEF FPQDQD+D
Sbjct: 82  YTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYD 141

Query: 162 RMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLE 221
           R+IN+TNWDLF YTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LHQFSPYSL PKGP+TLE
Sbjct: 142 RLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTLE 201

Query: 222 GLKSMAALRYTLYPFHNKS--FMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQK 279
           GLKS+AALRYTLYP+ NKS      T++RPMRIF+LGARAEAQLPGH+WKQ QYLFPEQ+
Sbjct: 202 GLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQE 261

Query: 280 FELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMD 339
           FE+ FIGPE Y +KEK QY+    P+++ +DDTLKL F  +YFH  HE+QD FPYDP++D
Sbjct: 262 FEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFLD 321

Query: 340 VFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDI 399
           VFF FHPG++  ETTE W+ +TMK+LL+T+CAIF TGFS+ D+L D++++  +Y N+LD+
Sbjct: 322 VFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELDM 381

Query: 400 LMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443
           LM PVKNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRY  +E+
Sbjct: 382 LMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/415 (72%), Positives = 356/415 (85%)

Query: 28  RNFRNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKI 87
           R+  N   +SH + R LMGFVRNALGLDP  SPDDPTPENRFHPWDQSP  DLRERAAKI
Sbjct: 20  RSSHNRLVLSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKI 79

Query: 88  RTLAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGR 147
           RTLAHCPVT K+INYTCP+SGIPTHHS+ AWEMD+ YH +K YEILKKVNIYEHDLRSGR
Sbjct: 80  RTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGR 139

Query: 148 PFPEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQF 207
           PFPEF FPQ+Q +D+ +N+TNWDLF YTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LH+F
Sbjct: 140 PFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKF 199

Query: 208 SPYSLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHI 267
           SPYSL PKGPITLEGLKS+AALRYTLYP  N+S +T TKNR MRIF+LGARAEAQLPGH+
Sbjct: 200 SPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHV 259

Query: 268 WKQLQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHE 327
           WKQLQ+LFPEQ FE+ FIGPE  Y ++K++Y+K   P++Q +D+TLK    T++F   HE
Sbjct: 260 WKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHE 319

Query: 328 SQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMN 387
           +QD FPYDPYMDVFF FHPG+++ E+   WM +TMK+LLET+CAIF TGF++ D+ +D+N
Sbjct: 320 AQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLN 379

Query: 388 ILDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442
           ++  KY  ++DILM PVKNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRY T++
Sbjct: 380 LVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/415 (72%), Positives = 356/415 (85%)

Query: 28  RNFRNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKI 87
           R+ +N   VSH + R LMGFVRNALGLDP  SPDDPTPENRFHPWDQSP  DLRERAAKI
Sbjct: 20  RSPQNRLVVSHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKI 79

Query: 88  RTLAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGR 147
           RTLAHCPVT K+INYTCP+SGIPTHHS+ AWEMD+ YH +K YEILKKVNIYEHDLRSGR
Sbjct: 80  RTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGR 139

Query: 148 PFPEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQF 207
           PFPEF FPQ Q +D+ +N+TNWDLFLYTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LH+F
Sbjct: 140 PFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKF 199

Query: 208 SPYSLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHI 267
           SPYSL PKGPITLEGLKS+AALRYTLYP  N+S +  T+NR MRIF+LGARAEAQLPGH+
Sbjct: 200 SPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHV 259

Query: 268 WKQLQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHE 327
           WKQLQ+LFPEQ FE+ FIGPE  Y ++K++Y+K   P++Q ID+TLK    T++F   HE
Sbjct: 260 WKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHE 319

Query: 328 SQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMN 387
           +QD FPYDPYMDVFF FHPG+++ E+   WM +TM +LLET+CAIF TGF++ D+++D+N
Sbjct: 320 AQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDIN 379

Query: 388 ILDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442
           ++  KY  ++DILM PVKNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRY T++
Sbjct: 380 LVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/411 (72%), Positives = 353/411 (85%)

Query: 32  NNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLA 91
           N   VSH + R LMGFVRNALGLDP  SP+DPTPENRFHPWDQSP  DLRERAAKIRTLA
Sbjct: 24  NRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLA 83

Query: 92  HCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPE 151
           HCPVT K+INYTCP+SGIPTHHS+ AWEMD+ YH +K YEILKKVNIYEHDLRSGRPFPE
Sbjct: 84  HCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPE 143

Query: 152 FVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYS 211
           F FPQ Q +D+ +N+TNWDLF YTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LH+FSPYS
Sbjct: 144 FDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYS 203

Query: 212 LQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQL 271
           L PKGPITLEGLKS+AALRYTLYP  N+S  T TKNR MRIF+LGARAEAQLPGH+WKQL
Sbjct: 204 LNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQL 263

Query: 272 QYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDL 331
           Q+LFPEQ FE+ FIGPE  Y ++K++Y+K   P++Q +D+TLK  + T +F   HE+QD 
Sbjct: 264 QFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDF 323

Query: 332 FPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDE 391
           FPYDPYMDVFF FHPG+++ E+   WM +TMK+LLET+CAIF TGF++ D+ +D+N++  
Sbjct: 324 FPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKS 383

Query: 392 KYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442
           KY  ++D+LM+PV+NVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRY T++
Sbjct: 384 KYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/411 (71%), Positives = 351/411 (85%)

Query: 32  NNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLA 91
           N   V H + R LMGFVRNALGLDP  SPDDPTPENRFHPWDQSP  DLRERAAKIRTLA
Sbjct: 24  NRLVVYHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLA 83

Query: 92  HCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPE 151
           HCPVT K+INYTCP+SGIPTHHS+ AWEMD+ YH +K YEILKKVNIYEHDLRSGRPFPE
Sbjct: 84  HCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPE 143

Query: 152 FVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYS 211
           F FPQ Q +D+ +N+TNWDLF YTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LH+FSPYS
Sbjct: 144 FDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYS 203

Query: 212 LQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQL 271
           L PKGPITLEGLKS+AALRYTLYP  N+S +  TKNR MRIF+LGARAEAQLPGH+WKQL
Sbjct: 204 LNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQL 263

Query: 272 QYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDL 331
           Q+LFPEQ FE+ F+GPE  Y ++K++Y+K   P++Q +D+TL+    T++F   HE+QD 
Sbjct: 264 QFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDF 323

Query: 332 FPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDE 391
           FPYDPYMDVFF FHPG+++ E+   WM +TM++LLET+CAIF TGF++ D+++D+N +  
Sbjct: 324 FPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKS 383

Query: 392 KYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442
           KY  ++DILM PV+NVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRY T++
Sbjct: 384 KYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/402 (73%), Positives = 347/402 (86%), Gaps = 1/402 (0%)

Query: 42  RSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEIN 101
           R ++GFVRNALGLDP  SPDDPTPENRFHPWDQSP  DLRERAA+IRTLA CPVT KEIN
Sbjct: 25  RFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEIN 84

Query: 102 YTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFD 161
           YTCP+SGIPTHHS+ AWE D+ YH +K YEILKKVNIYEHDLRSGRPFPEF FPQ QDFD
Sbjct: 85  YTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDFD 144

Query: 162 RMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLE 221
           R +NMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYPI+I S+LHQFSPYSL PKGP+TLE
Sbjct: 145 RTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTLE 204

Query: 222 GLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFE 281
           GLKS+AALRYTLYP  NK+ ++ TK+RPMRIF+LGARAEAQLPGH+WKQLQYLFPEQ FE
Sbjct: 205 GLKSLAALRYTLYPLENKT-ISSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMFE 263

Query: 282 LFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDVF 341
           L F+GPE   +KEK QY+    P+++ +D+T+   + T++FH LHE+QD FPYDPY+DVF
Sbjct: 264 LHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDVF 323

Query: 342 FIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDILM 401
           F FHPGF A ET+  W+N+TMK LLET+CAIF TGF++ D+L D++ + +KY  ++D+LM
Sbjct: 324 FCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVLM 383

Query: 402 KPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443
           +PVKNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRY  +E+
Sbjct: 384 EPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/410 (70%), Positives = 344/410 (83%)

Query: 34  AHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHC 93
           A  +    R ++GFVRNALGLDP  SPDDPTP+NRFHPWDQSP  DLR RAA IR LA C
Sbjct: 14  ASATRIQKRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARC 73

Query: 94  PVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFV 153
           PVT KEINYTCP SGIPTHHS+ AWE D  YH+ K YEILKKVNIYEHDLRSGRPFPEF 
Sbjct: 74  PVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFD 133

Query: 154 FPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQ 213
           FPQDQD+DRM+NMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYP T+GS+LH+FSPY+L 
Sbjct: 134 FPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALN 193

Query: 214 PKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQY 273
           PKGPITLEGLKS+AALRYTLYP  ++     TK+RPMRIF+LGARAEAQLPGH+WKQ Q+
Sbjct: 194 PKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQF 253

Query: 274 LFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFP 333
           LFPE  FEL FIGPE++YD+EK++Y+    P+++ +D+TL   + T+YFH  HE+QD FP
Sbjct: 254 LFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFP 313

Query: 334 YDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKY 393
           YDPY+D+FF FHPGF+A E+TEHWM  TM+ LLET+CAIF TGF+  D++ DM  + EKY
Sbjct: 314 YDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKY 373

Query: 394 KNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443
            N++D+LM+PV+N+FGSTKWELND+NPQ+VYQFNMYIAGFRGKRY  +E+
Sbjct: 374 GNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/404 (69%), Positives = 346/404 (85%), Gaps = 2/404 (0%)

Query: 41  SRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEI 100
           +R +MGFVRNALGLDP +SPDDPTPENRFHPWDQSP  DLRERAA+I+ +A CPVT+K+I
Sbjct: 16  TRPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDI 75

Query: 101 NYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDF 160
            +TCP+SGIPTHHS+ AWE D  YH +K YE+LKKVNIYEHDLRSGRPFPEF FPQDQD+
Sbjct: 76  QFTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDY 135

Query: 161 DRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITL 220
           DRM+NM+NWDLF YTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LHQ+SPYSL PKGPITL
Sbjct: 136 DRMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITL 195

Query: 221 EGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKF 280
           EGLKS+AALRYTLYP  +  F    ++ P+RIF+LG RAEAQLPGH+WKQLQYL P+   
Sbjct: 196 EGLKSLAALRYTLYPEQSGRFRA-GQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSI 254

Query: 281 ELFFIGPEAYYDKEKKQYLKLD-KPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMD 339
           EL F+GPE++YD+EK+ Y++   + +++ ID+ ++L + T++FH  HE+QD FPYDPY D
Sbjct: 255 ELHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYND 314

Query: 340 VFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDI 399
           VFF FHPGF+A ET E+WM DTMK+L++T+CA+F TGFS+ D+L D++I+ +KY ++LD+
Sbjct: 315 VFFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDM 374

Query: 400 LMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443
           LM+PV NVFGSTKWELND NP +VYQFNMYIAGFRGKRY  +EL
Sbjct: 375 LMEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/418 (68%), Positives = 344/418 (82%), Gaps = 14/418 (3%)

Query: 40  SSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKE 99
           S R LMGFVRNALGLDP  SPD+PT +NRFHPWDQSP  DLRERAA+I+TLA CPVT+K 
Sbjct: 20  SKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKP 79

Query: 100 INYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQD 159
           I YTCPISGIPTHHS+ AWE D+ YH++K YEILKKVNIYEHDLRSGRPFPEF FP+DQ 
Sbjct: 80  IQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQG 139

Query: 160 FDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPIT 219
            DR +N+TNWDLFLYTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LHQFSPYSL PKGPIT
Sbjct: 140 PDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPIT 199

Query: 220 LEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQK 279
           LEGLKS+AALRYTLYP  N++  T  KN+PMRIF+LGARAEAQLPGH+WKQLQ+LFP+Q 
Sbjct: 200 LEGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQN 259

Query: 280 FELFFIGPEAYYDKEKKQYLKLDK--------------PLIQTIDDTLKLTFITEYFHTL 325
           FE+ FIGPE+ YD+E+ +Y++                 P+ + ID+T+K  + T+YFHTL
Sbjct: 260 FEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTL 319

Query: 326 HESQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLND 385
           H +QD FPYDPY DVFF+FHPG ++ E+ + WM DT+K LL+T+CAIF TGF++ DM +D
Sbjct: 320 HTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADD 379

Query: 386 MNILDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443
           + IL + Y  ++D+LM PVKNVFGSTKWEL+D +P  VYQFNMYIAGFRGKRY  +++
Sbjct: 380 IQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIKV 437

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/402 (71%), Positives = 346/402 (86%), Gaps = 1/402 (0%)

Query: 42  RSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEIN 101
           RSLMGFV+NALGLDP  SPDDPTPENRFHPWDQSP  DLRERAA+IRTLA CPVT KEIN
Sbjct: 34  RSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEIN 93

Query: 102 YTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFD 161
           YTCP+SGIPTHHS+ AWE D++YH +K YEILKKVNIYEHDLRSGRPFPEF FP DQ  D
Sbjct: 94  YTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHD 153

Query: 162 RMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLE 221
           R++N+TNWDLF YTR+FYSMDTEFQ+AAVTKMLSYP+TIGSILHQFSPYSL PKGPITLE
Sbjct: 154 RVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLE 213

Query: 222 GLKSMAALRYTLYPFHNKSFMTLT-KNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKF 280
           GLKS+AALRY+LYPF  KS ++L   +RPMRIF+LGARAEAQLPGH+WKQLQ+LFP+Q F
Sbjct: 214 GLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTF 273

Query: 281 ELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDV 340
           E+ FIG E   + EK +Y+K   P+++ ID+T+KL + ++YFH  HE+QD  PYDPY+DV
Sbjct: 274 EIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDV 333

Query: 341 FFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDIL 400
           FF FHPGF+A ET++ WM DTMK+LLET+CAIF TGF++ D+ ND+ I+  +Y  ++D L
Sbjct: 334 FFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDTL 393

Query: 401 MKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442
           M P+KN +GSTKWELND+NPQ+++QFNMY+AGFRGKRY T++
Sbjct: 394 MDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/402 (67%), Positives = 338/402 (84%), Gaps = 1/402 (0%)

Query: 42  RSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEIN 101
           R +MGFVRNALGLDP +SPD+PT +NRFHPWDQSP  +LRERAA+I+ LA CPVT K I 
Sbjct: 29  RQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKNIQ 88

Query: 102 YTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFD 161
           ++C  SGIPTHHS+ AW+ D  YH +K Y +LKKVNIYEHDLRSGRPF EF FP+ QD+D
Sbjct: 89  FSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQDYD 148

Query: 162 RMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLE 221
           RM+NM NWDL+ YTRSF+SMDTEFQ+AAVTKMLSYPITIGSILHQ+SPYSL PKGPITLE
Sbjct: 149 RMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPITLE 208

Query: 222 GLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFE 281
           GLKS+AALRYTLYP  N+   ++ +++P+R+F+LGARAEAQLPGH+WKQLQYLFPE   E
Sbjct: 209 GLKSLAALRYTLYPEQNRRVRSI-QDKPLRVFILGARAEAQLPGHVWKQLQYLFPESLIE 267

Query: 282 LFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDVF 341
           L F+GPE+ YD+EK++Y+    P+++ IDDT+K+ + T+YFH  HE+QD FPYDPY D+F
Sbjct: 268 LHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDPYNDIF 327

Query: 342 FIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDILM 401
           F FHPGF + ET + WMN T+++LL+T+CAIF TGF++ D+++D+  + EKY ++LD+L+
Sbjct: 328 FCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDELDMLV 387

Query: 402 KPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443
            P KNVFGSTKWELNDLNP +VYQFNMYIAGFRGKRY  +EL
Sbjct: 388 DPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/416 (68%), Positives = 342/416 (82%), Gaps = 1/416 (0%)

Query: 28  RNFRNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKI 87
           R+   N+H S    R +MGFVRNALGLDP  SPD+PTPENRFHPWDQSP  DLRERAA I
Sbjct: 8   RSSLRNSHCSLQK-RHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATI 66

Query: 88  RTLAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGR 147
           R LA CPVT +EINYTCP SGIPTHHS+ AWE D +Y  +K  EILKKVNIYEHDLRSGR
Sbjct: 67  RALAKCPVTGREINYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGR 126

Query: 148 PFPEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQF 207
           PFPEF FP DQDFDRM+N+TNWDLF YTR F+SMDTEFQ+AAVTKMLSYPITIGS+LHQF
Sbjct: 127 PFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQF 186

Query: 208 SPYSLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHI 267
           SPYSL PKGPITLEGLKS+AALRYTLYP  N+   ++ KN P+RIF+LGARAEAQLPGH+
Sbjct: 187 SPYSLNPKGPITLEGLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHV 246

Query: 268 WKQLQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHE 327
           WKQLQ++FPE + E+ F+GPE+YYD+ K++Y+    P+I+ +D+TL   + T+YFH  HE
Sbjct: 247 WKQLQFMFPETQMEIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFHVFHE 306

Query: 328 SQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMN 387
           +QD FPYDPY D+FF FHPGF+A E+ E+WM  TM++LLET+CAIF TGF+  D+  D++
Sbjct: 307 AQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLD 366

Query: 388 ILDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443
            +  +Y  +LDI+M P KN FGSTKWELND+NPQ+VYQFNM++AGFRGKRY  +E+
Sbjct: 367 AVVAEYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIEV 422

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/415 (67%), Positives = 339/415 (81%), Gaps = 2/415 (0%)

Query: 31  RNNAHVSHHS--SRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIR 88
           RN      H+   R +MGFVRNALGLDP  SPD+PTPENRFHPWDQSP  DLRERAA IR
Sbjct: 8   RNTVRSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIR 67

Query: 89  TLAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRP 148
            LA CPVT +EINYTCP SGIPTH+S+ AWE D  Y  +K  EILKKVNIYEHDLRSGRP
Sbjct: 68  ALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRP 127

Query: 149 FPEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFS 208
           FPEF FP DQDFDRM+N+TNWDLF YTR FYSMDTEFQ+AAVTKMLSYP+TIGS+LHQFS
Sbjct: 128 FPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFS 187

Query: 209 PYSLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIW 268
           PYSL PKGP+TLEGLKS+AALRYTLYP  N+   ++TKN P+RIF+LGARAEAQLPGH+W
Sbjct: 188 PYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVW 247

Query: 269 KQLQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHES 328
           KQLQ++FPE   EL F+GPE+YYD+ K++Y+    P+++ +D+TL   + T+YFH  HE+
Sbjct: 248 KQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEA 307

Query: 329 QDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNI 388
           QD FPYDPY D+FF FHPGF+A E+ E+WM  TM++LLET+CA+F TGF+  D+  D+  
Sbjct: 308 QDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGT 367

Query: 389 LDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443
           +  K+  +LD+LM+PV N FGSTKWELND+NPQ+VYQFNM+IAGFRGKRY  +E+
Sbjct: 368 VVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/402 (70%), Positives = 338/402 (84%), Gaps = 1/402 (0%)

Query: 42  RSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEIN 101
           R+++GFVRNALGLDP  SPDDPTPENRFH WDQSP  DLRERAA+IR LA CPVT KEIN
Sbjct: 15  RTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVTGKEIN 74

Query: 102 YTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFD 161
           YTCP+SGIPTHHSK AWE D+ YH +K +E+LKKVNIYEHDLRSGRPFPEF FPQD +FD
Sbjct: 75  YTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLEFD 134

Query: 162 RMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLE 221
           R +NMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYPITI S+L+QFSPYSL PKGPITLE
Sbjct: 135 RTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPITLE 194

Query: 222 GLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFE 281
           GLKS+AALRYTLYPF NK+ +  TK+RPMR+F+LGARAEA LPGH+WKQLQ+LFPE  FE
Sbjct: 195 GLKSLAALRYTLYPFENKT-VAATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETAFE 253

Query: 282 LFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDVF 341
           L FIGPE   +KEK QY+    P+++ ID+TL   + T+YFH  H++QD FPYDPY+D F
Sbjct: 254 LHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLDAF 313

Query: 342 FIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDILM 401
           F FHPGF A E+T+ W+  T+  LLET+CAIF TG +++ +L D+N + +K+  ++DILM
Sbjct: 314 FCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDILM 373

Query: 402 KPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443
           +P KN++GSTKWELND+NPQ+VYQFNMYIAGFRGKRY  +E+
Sbjct: 374 EPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/411 (68%), Positives = 339/411 (82%), Gaps = 8/411 (1%)

Query: 40  SSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKE 99
           + R LMGFVRNALGL+P  SP DPTPENRFHPWDQSP   LRERAA+I+TLA CPVT   
Sbjct: 27  ARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGLN 86

Query: 100 INYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQD 159
           + YTCP+SGIPTHHS+ AWE D  YH+ K YE LKKVNIYEHDLRSGRPFPEF FPQ+Q 
Sbjct: 87  VEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQG 146

Query: 160 FDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPIT 219
           +D+++NMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYP+TI S+L QFSPYSL PKGPIT
Sbjct: 147 YDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPIT 206

Query: 220 LEGLKSMAALRYTLY--PFHNKSFM------TLTKNRPMRIFLLGARAEAQLPGHIWKQL 271
           LEGLKS+AA+RYTLY   F+N +           KNRPMR+F+LGARAEAQLPGH+WKQL
Sbjct: 207 LEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQL 266

Query: 272 QYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDL 331
            YLFPEQ FE+ FIGPE+YYD+ + QY++   P+++ +D+TLK    T+YFH LHESQD 
Sbjct: 267 SYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQDF 326

Query: 332 FPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDE 391
           FPYDPY D FF FHPGF++ E  + W+++T+ +LL+T+CAIF TGF R+D++ND+ +L+E
Sbjct: 327 FPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNE 386

Query: 392 KYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442
           K+ +++DILM+P KNVFGSTKWELNDLNP +VYQFNMYIAGFRGKRY T++
Sbjct: 387 KFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/404 (67%), Positives = 329/404 (81%), Gaps = 2/404 (0%)

Query: 41  SRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEI 100
           SR+L+GFVRNALGL+P  +PD+P   NRF+PWDQSP  +LRERAAKI+ +A CP+T KEI
Sbjct: 24  SRTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGKEI 83

Query: 101 NYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDF 160
           NYTCPISGIPTHHS+ AWE DE YH NKI +ILKKVNIYEHDLRSGR FPEF FP DQ F
Sbjct: 84  NYTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQTF 143

Query: 161 DRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITL 220
           DR +N+ NWDL+ YTRSFYSMDTEFQ+A VTKMLSYPITI S+LHQ+SPYSL P GPITL
Sbjct: 144 DRAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPITL 203

Query: 221 EGLKSMAALRYTLYPF-HNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQK 279
           EGLKS+AALRY+LYP  H  S   L K RPMRIF+LGARAE+QLPGH+WKQ QYLFP Q 
Sbjct: 204 EGLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGARAESQLPGHVWKQFQYLFPLQT 263

Query: 280 FELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMD 339
           FE+ FIGPE    +E    +     +++ IDDT+ L +  + FH +H++QD FPYDPY D
Sbjct: 264 FEIIFIGPECQL-REPSNSVGGANNIVKRIDDTISLVYHPKLFHDIHKAQDFFPYDPYND 322

Query: 340 VFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDI 399
           VFF+FHPGF++ ET E WMNDT+K+LL+T+CA+F+TGFS+ D+ ND+ +L++ Y + LD 
Sbjct: 323 VFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNKMYGDKLDT 382

Query: 400 LMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443
           LM PVKN+FGSTKWELNDLNPQ+VYQFNMYI+ FRGKRY  +E+
Sbjct: 383 LMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIEI 426

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/402 (66%), Positives = 329/402 (81%), Gaps = 6/402 (1%)

Query: 42  RSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEIN 101
           R++MG+VRNA GL+P+ SPD P   NRFHPW++SPC DLR+RAA+I+TLA CPVT K IN
Sbjct: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88

Query: 102 YTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFD 161
           YTCPISGIPTHHS+ AWE D +YH NK YE LKKVNIYEHDLRSGR FPEF FP +Q  D
Sbjct: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148

Query: 162 RMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLE 221
           R +N+ NWDLFLYTR FYSMDTEF +A VTKMLSYPITI S+LH+FSPY LQP+GP+TLE
Sbjct: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208

Query: 222 GLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFE 281
           GLKS+AALRYTLYP   K+  +L+ N PMRIF++G RAE+QLPGH+WKQLQYLF E+ FE
Sbjct: 209 GLKSIAALRYTLYPKLGKT--SLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFE 266

Query: 282 LFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDVF 341
           + FIGPE    + K        PLI+ +DDTL L +  +YFH LH+S DLFPY+PY DVF
Sbjct: 267 IHFIGPECQLKEPKNT----STPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVF 322

Query: 342 FIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDILM 401
           FIFHPGF+  +T + W+++T+ +LLET+CAIF+TGF+  D+ ND+ ++D+ Y+N++D+LM
Sbjct: 323 FIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLM 382

Query: 402 KPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443
           KP+KNVFGS KWELND+NPQ+VYQFNMYIAGFRGKRY  +++
Sbjct: 383 KPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/434 (64%), Positives = 341/434 (78%), Gaps = 12/434 (2%)

Query: 19  TTLCFTPNPRNFRNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQ 78
           T L  T  P   +N    S++S R+LMGFVR+ LGLDP  SP+DPTPENRFHPW+ SPC 
Sbjct: 2   TLLYNTTKPILSKNIIACSNYSKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCD 61

Query: 79  DLRERAAKIRTLAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNI 138
           DLRERAA+I+T+A CPV+N +INYTCPISGIPTHHS+  WEMD NYH N I +ILKKVNI
Sbjct: 62  DLRERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNI 121

Query: 139 YEHDLRSGRPFPEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPI 198
           YEHDLRSGRPFPEF FP++Q++D +IN+ NWDL+ YTR+F+SMDTEFQ+AAVTKMLSYP+
Sbjct: 122 YEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPM 181

Query: 199 TIGSILHQFSPYSLQPKGPITLEGLKSMAALRYTL-------YPFHNKSFMTLT---KNR 248
           TI S+LHQFSPYSL PKGP+TLEGLKS+AALRYTL           N    T+T   KNR
Sbjct: 182 TIASVLHQFSPYSLTPKGPVTLEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNR 241

Query: 249 PMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQT 308
           PMRIF+LGARAEAQLP H+WKQLQYLFP   FE+ FIGPE+   K+K  Y+    P+ + 
Sbjct: 242 PMRIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKR 301

Query: 309 IDDTLKLTFITEYFHTLHESQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLET 368
           IDD++ L + T+YFH  H++QD +PYDPY D+FF+FHPG +A  T E W+N+TM+ LL++
Sbjct: 302 IDDSMSLVYHTDYFHVYHKAQDFYPYDPYFDIFFMFHPGLAA--TKETWLNETMQGLLDS 359

Query: 369 QCAIFNTGFSRNDMLNDMNILDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNM 428
           +C IF TGF   D+  D+++L++ +  D+DILMKPVKNVFGSTKWELND NPQ+VYQFNM
Sbjct: 360 KCPIFMTGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNM 419

Query: 429 YIAGFRGKRYPTVE 442
           YIAG+RGKRY   E
Sbjct: 420 YIAGYRGKRYHATE 433

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/431 (62%), Positives = 336/431 (77%), Gaps = 7/431 (1%)

Query: 12  AYRSRLPTTLCFTPNPRNFRNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHP 71
           A++S   T L   P    F  ++ +S H  R+L+GFV+NALG+DP   P +P   NRF+P
Sbjct: 3   AFKSPAATQLSLHPVSL-FAIDSRISSH--RTLVGFVKNALGIDPPPLPTEPVFANRFYP 59

Query: 72  WDQSPCQDLRERAAKIRTLAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYE 131
           WD+SP   +RERAA+I+  A CPVT KEI +TCP+SGIPTH+SK AWE D NYH NKIYE
Sbjct: 60  WDESPSPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYE 119

Query: 132 ILKKVNIYEHDLRSGRPFPEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVT 191
            L+KVNIYEHDLRSGRPFPEF FP +Q  D  +NMTNWDLF YTR FYSMDTEFQ+A VT
Sbjct: 120 KLRKVNIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVT 179

Query: 192 KMLSYPITIGSILHQFSPYSLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMR 251
           KMLSYPITIGSIL+++SPY+L PKGP+TLEGLKS+AALRYTL    N +F T TK RPMR
Sbjct: 180 KMLSYPITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL---RNNAFAT-TKTRPMR 235

Query: 252 IFLLGARAEAQLPGHIWKQLQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDD 311
           IF+LGARAE+QLP HIWKQLQ+LFP Q FE+ FIGPE    ++   YL  D  +++ +D+
Sbjct: 236 IFILGARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDE 295

Query: 312 TLKLTFITEYFHTLHESQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCA 371
           +L L +  +YF   H++QD FPYDPY D+FF FHPGF++ E+++ WM DTMK+LL+T+CA
Sbjct: 296 SLTLAYYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCA 355

Query: 372 IFNTGFSRNDMLNDMNILDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIA 431
           IF TGFS++D++ D+  + + Y  ++D+LM P+KNVFGSTKWELNDLNPQ VYQFNMYIA
Sbjct: 356 IFTTGFSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIA 415

Query: 432 GFRGKRYPTVE 442
           GFRGKRY TV+
Sbjct: 416 GFRGKRYHTVK 426

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/413 (65%), Positives = 324/413 (78%), Gaps = 2/413 (0%)

Query: 31  RNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTL 90
           R  A  +    R +MGFVRNALGLDP +SPD+PT ENRFH W+QSP  DLRERAA+IR L
Sbjct: 18  RGCAAGACGQRRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRAL 77

Query: 91  AHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFP 150
           A CPVT K+I Y+C  SGIPTHHS+ AWE DE YH +K +  L+KVN+YEHDLRSGRPF 
Sbjct: 78  ARCPVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFA 137

Query: 151 EFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPY 210
           EF FPQ+Q  DRM+NM NWDLFLYTR FYSMDT+FQ+AAVTKMLSYPITIGS+LHQFSPY
Sbjct: 138 EFDFPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPY 197

Query: 211 SLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQ 270
           +L+P+GPITLEGLKS+AALRYTLYP          +++PMRIF+LGARAEAQLPGH+WKQ
Sbjct: 198 ALEPRGPITLEGLKSLAALRYTLYP--ESESARAVRSKPMRIFILGARAEAQLPGHVWKQ 255

Query: 271 LQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQD 330
           LQYLFP    E+ FIGPEA YD+++K+Y+    P+ + +D TLKL   T+Y H  HE+QD
Sbjct: 256 LQYLFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQD 315

Query: 331 LFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILD 390
            FPYDPY DVFF FHPGF++ E    WM+ T+ +LLET+CAIF TGF R+DM  D   L 
Sbjct: 316 FFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALR 375

Query: 391 EKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443
             +  ++D+LM P KN+FGSTKWELND+NP +VYQFNMYIAGFRGKRY  +++
Sbjct: 376 ASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/428 (62%), Positives = 328/428 (76%), Gaps = 20/428 (4%)

Query: 30  FRNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRT 89
           F+NN      S+R  +GFV+NALG++P  SP++P  ENRFHPWDQSP  DLRERAA+IR 
Sbjct: 29  FKNN--YQKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRA 86

Query: 90  LAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPF 149
           LA CPVT KEINYTCPISGIPTHHSK AWE D NYH NKIY+ILKKVN++EHDLRSGR F
Sbjct: 87  LAKCPVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSF 146

Query: 150 PEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSP 209
           PEF FPQ QD D  ++M NWD+F YTR F SMD+EFQ+A VTKMLSYPITI SILH++ P
Sbjct: 147 PEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCP 206

Query: 210 YSLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWK 269
           Y+L+P GPITLEGLKS+AAL+Y+L   HN+     TK RPMRIF+LGARAE+QLP HIWK
Sbjct: 207 YALEPNGPITLEGLKSIAALKYSLR--HNE--FETTKERPMRIFILGARAESQLPEHIWK 262

Query: 270 QLQYLFPEQKFELFFIGPEAYY------------DKEKKQYLKLDKP--LIQTIDDTLKL 315
           Q  YLFP Q FE+ FIGPE               +      +   +P  +++ ID+ L L
Sbjct: 263 QFSYLFPFQNFEINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNL 322

Query: 316 TFITEYFHTLHESQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNT 375
            + T++FHTLH ++D FPYD Y DVFF FHPGF++ E T+ WM +TMK+LL+T+CAIF T
Sbjct: 323 VYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTT 382

Query: 376 GFSRNDMLNDMNILDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRG 435
           GF++ D+L D++I+ E Y  ++D+LMKP KNVFGSTKWELND++PQ+VYQ+NMYIAGFRG
Sbjct: 383 GFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRG 442

Query: 436 KRYPTVEL 443
           KRY  V++
Sbjct: 443 KRYHAVKV 450

>KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} similar
           to uniprot|P89102 Saccharomyces cerevisiae YDR166C SEC5
           Essential 107kDa subunit of the exocyst complex (Sec3p
           Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and Exo84p) which
           has the essential function of mediating polarized
           targeting of secretory vesicles to active sites of
           exocytosis
          Length = 897

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 48/99 (48%), Gaps = 4/99 (4%)

Query: 190 VTKMLSYPITIGSILHQFSPYSLQPKGPITLEGLKSMAALRYTLYP----FHNKSFMTLT 245
           V +++S    + SIL + +     P+ P T+  L ++  ++ +++P    + ++SF T  
Sbjct: 661 VQQIVSMEAVLESILKEAAKEKENPRNPRTILTLTNLQYIKGSVFPQVLRYFDESFETQL 720

Query: 246 KNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFELFF 284
             + + IF L A+ E  + G+    L+    +   E F+
Sbjct: 721 SRKNLEIFTLLAKMETSILGNYLSDLKVTLRDILEERFY 759

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 61/139 (43%), Gaps = 21/139 (15%)

Query: 117 AWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPE-----FVFPQDQDFDRMINMTNWDL 171
           +W++D   H+N +  +++++ I E D++S +  PE     +VF ++      ++ TNW  
Sbjct: 336 SWDVDNYVHNNSLV-LIERIKIQETDIKSLKTLPEELGKLYVFSENS--VHQLDSTNWSA 392

Query: 172 FLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILH----------QFSPYSLQPKGPITLE 221
            L   S    +++       K  S    I +I H            S   L  +G +T +
Sbjct: 393 IL---SRCIEESDLNALGDVKFESKLENIVTIEHPSNLAYISWNDTSNLVLTARGKLTFQ 449

Query: 222 GLKSMAALRYTLYPFHNKS 240
            + +   L+ T +  +NKS
Sbjct: 450 NISNDKELQTTKFDANNKS 468

>NDAI0I01180 Chr9 complement(284047..285330) [1284 bp, 427 aa] {ON}
           Anc_6.195
          Length = 427

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 60/149 (40%), Gaps = 30/149 (20%)

Query: 280 FELFFIG------------PEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHE 327
           F LF +G            P AY    K  Y    + L+Q+ D       I +    +  
Sbjct: 135 FRLFNVGIVHGWIIDGENDPAAYNHVAKYTYESAQRMLVQSYD-------IKKNNLNVEN 187

Query: 328 SQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAI------FNTGFSRND 381
           SQ++     Y+  F       SA + TE+ +    + L+E   A+      F T +  N 
Sbjct: 188 SQEILEDAQYVKAFL----ARSATQLTEYGLRHLRELLVEKSYAVLFRNDTFVTIYKNNG 243

Query: 382 MLNDMNILDEKYKNDLDILMKPVKNVFGS 410
            L  M   D  YKND DI+ K +++V GS
Sbjct: 244 ELY-MLETDPTYKNDRDIIWKSLRSVNGS 271

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,921,759
Number of extensions: 2488696
Number of successful extensions: 6558
Number of sequences better than 10.0: 43
Number of HSP's gapped: 6721
Number of HSP's successfully gapped: 44
Length of query: 443
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 330
Effective length of database: 40,524,141
Effective search space: 13372966530
Effective search space used: 13372966530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)