Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E044707.351ON26426411341e-158
NCAS0E028707.351ON2612637282e-96
YLR201C (COQ9)7.351ON2602486552e-85
Suva_10.2967.351ON2602486527e-85
Skud_12.2657.351ON2602506362e-82
Kpol_530.307.351ON2602636067e-78
Smik_12.2607.351ON2602646059e-78
KNAG0B026207.351ON2652625921e-75
TDEL0C019707.351ON2602495771e-73
TBLA0E004507.351ON2792595671e-71
CAGL0A03949g7.351ON2682515633e-71
ZYRO0F11726g7.351ON2512485597e-71
TPHA0F029807.351ON2642495598e-71
SAKL0F11396g7.351ON2542485292e-66
KLTH0H01232g7.351ON2572645292e-66
KAFR0L014807.351ON2642625242e-65
KLLA0D12320g7.351ON2502485102e-63
Kwal_56.246447.351ON2582594912e-60
ACL147W7.351ON2462484804e-59
Ecym_47227.351ON2532514799e-59
NDAI0H00700singletonON14362663.3
KLLA0F05445g7.297ON47688665.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E04470
         (264 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   441   e-158
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   285   2e-96
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   256   2e-85
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   255   7e-85
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   249   2e-82
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   238   7e-78
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   237   9e-78
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   232   1e-75
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   226   1e-73
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   223   1e-71
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   221   3e-71
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   219   7e-71
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   219   8e-71
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   208   2e-66
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   208   2e-66
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   206   2e-65
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   201   2e-63
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   193   2e-60
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   189   4e-59
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   189   9e-59
NDAI0H00700 Chr8 complement(158572..159003) [432 bp, 143 aa] {ON}      30   3.3  
KLLA0F05445g Chr6 (535675..537105) [1431 bp, 476 aa] {ON} weakly...    30   5.9  

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  441 bits (1134), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 222/264 (84%), Positives = 222/264 (84%)

Query: 1   MLLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGF 60
           MLLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGF
Sbjct: 1   MLLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGF 60

Query: 61  TDEAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPY 120
           TDEAIT                              AVMELLKFQLVSKRYQLTENITPY
Sbjct: 61  TDEAITSSLNELDLSSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPY 120

Query: 121 IETAKDKLPSLETLLIERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIY 180
           IETAKDKLPSLETLLIERLKMDQP            IIPSPLLFNVALPELFNLSDDLIY
Sbjct: 121 IETAKDKLPSLETLLIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIY 180

Query: 181 FSNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYN 240
           FSNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYN
Sbjct: 181 FSNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYN 240

Query: 241 NTEEYAWYTLMVSMNLVKARLARG 264
           NTEEYAWYTLMVSMNLVKARLARG
Sbjct: 241 NTEEYAWYTLMVSMNLVKARLARG 264

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  285 bits (728), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 156/263 (59%), Positives = 182/263 (69%), Gaps = 2/263 (0%)

Query: 2   LLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFT 61
           +LNR + K    S  R++H +  EY K ATLSPLTYNK+SVQYKILSNAL KWVPK GF 
Sbjct: 1   MLNRSILKKGLFSY-RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFK 59

Query: 62  DEAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYI 121
           ++AIT                              AVMEL+KFQLVSKRY+LTEN+ P  
Sbjct: 60  EKAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCP-D 118

Query: 122 ETAKDKLPSLETLLIERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYF 181
            T K++LPSLE+LL++RL+MD+               PS  LF+VALPEL  LSDD+IYF
Sbjct: 119 TTPKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYF 178

Query: 182 SNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNN 241
           SNEKDHHDMAWY KRLGVSCAYVSSKLYM ++N  +F+ T+ FAKDKLHRIM LGEYYNN
Sbjct: 179 SNEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNN 238

Query: 242 TEEYAWYTLMVSMNLVKARLARG 264
           TEEYAWY  MVS NLV+ARLAR 
Sbjct: 239 TEEYAWYMFMVSTNLVRARLARS 261

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  256 bits (655), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 128/248 (51%), Positives = 162/248 (65%), Gaps = 2/248 (0%)

Query: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITXXXXXXXXXX 76
           R +HSN +E+ K   + PLTY K+S QYK+LS AL K+VP+ GF++ +I           
Sbjct: 15  RLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYPS 74

Query: 77  XXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLI 136
                               AVMEL+KFQLV KRY+LTE I P + T + KLPSLE LL+
Sbjct: 75  SMISSIGAPNSPSFFHSST-AVMELIKFQLVDKRYRLTEGINPDV-TPQYKLPSLEHLLL 132

Query: 137 ERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKR 196
           +RL+MD+P             IPS  LF  A+PEL  LSDD+IYFSNEKDHHD AWYAKR
Sbjct: 133 KRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKR 192

Query: 197 LGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNL 256
           L VS  Y+ SKL+M ++   N+ +T  FAKDKLHR+M LGEYYNNTEE+AWYTLM ++NL
Sbjct: 193 LAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNL 252

Query: 257 VKARLARG 264
           +K++L RG
Sbjct: 253 IKSQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  255 bits (652), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 159/248 (64%), Gaps = 2/248 (0%)

Query: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITXXXXXXXXXX 76
           R +HSN +E+     + PL Y K S QYK+LS AL ++VPK GFT+ +I           
Sbjct: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYPS 74

Query: 77  XXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLI 136
                               AVMELLKFQLV KRY+LTE I P + T   KLPSLE LL+
Sbjct: 75  SMISSIGASNSPSFVHSST-AVMELLKFQLVDKRYRLTEGINPDV-TPHYKLPSLEHLLL 132

Query: 137 ERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKR 196
           +RL+MD+P             IPS  LF  A+PEL  LSDD+IYFSNEKDHHD AWYAKR
Sbjct: 133 KRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKR 192

Query: 197 LGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNL 256
           L VS  Y+ S+L+M ++   +F +T  FAKDKLHR+M LGEYYNNTEE+AWYTLM ++NL
Sbjct: 193 LAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNL 252

Query: 257 VKARLARG 264
           VK++LARG
Sbjct: 253 VKSQLARG 260

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  249 bits (636), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 164/250 (65%), Gaps = 2/250 (0%)

Query: 15  INRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITXXXXXXXX 74
            +R +HSN +E+ K   + PLTY K S QYK+LS AL ++VPK GF++ +I         
Sbjct: 13  FHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGY 72

Query: 75  XXXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETL 134
                                 AVMEL+KFQLV KRY+LTE I P + T++ KLPSLE L
Sbjct: 73  PSSMVSSIGASNSPSFFHSST-AVMELVKFQLVDKRYRLTEGINPDV-TSRYKLPSLEHL 130

Query: 135 LIERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYA 194
           L++RL+MD+              +PS LLF  A+PEL  LSDD+IYFSNE+DHHD AWYA
Sbjct: 131 LLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYA 190

Query: 195 KRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSM 254
           KRL VS  Y+ SKL+M ++   +F +T  FAK+KLH++M LGEYYNNTEE+AWYTLM ++
Sbjct: 191 KRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTV 250

Query: 255 NLVKARLARG 264
           NLVK++LARG
Sbjct: 251 NLVKSQLARG 260

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  238 bits (606), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 125/263 (47%), Positives = 160/263 (60%), Gaps = 3/263 (1%)

Query: 2   LLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFT 61
           +L   + K     + R +H N  EY    TL PL Y KDS QYKILS++L+  VP+ GF 
Sbjct: 1   MLKNFVPKRTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFN 60

Query: 62  DEAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYI 121
           + AI                               A+MELLKF LV+KRYQL+E+I   +
Sbjct: 61  ERAIVNSINLLGYPSSILSVIGSSNTPSFLHSST-ALMELLKFNLVAKRYQLSEDIP--L 117

Query: 122 ETAKDKLPSLETLLIERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYF 181
           +T  ++LPSLE LLI+RLKMD P             IP P L + +LPEL  L+DD+IYF
Sbjct: 118 DTPVEELPSLEDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYF 177

Query: 182 SNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNN 241
           S+EKDH D AWYAKR+GVS AY+SSKL+M ++    +  T +FAKDKL RIM LG+YYNN
Sbjct: 178 SSEKDHPDFAWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNN 237

Query: 242 TEEYAWYTLMVSMNLVKARLARG 264
            EEYAWY LM S+N+ K++ ARG
Sbjct: 238 AEEYAWYVLMNSINMAKSKAARG 260

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  237 bits (605), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 166/264 (62%), Gaps = 4/264 (1%)

Query: 1   MLLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGF 60
           ML   IL K    +  R +H N +E+ K+  + PLTY K+S QYK+LS AL ++VPK GF
Sbjct: 1   MLCRNILRKGC--TSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGF 58

Query: 61  TDEAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPY 120
           ++ +I                               AVMEL+KFQLV KRY+LTE I P 
Sbjct: 59  SERSIVESLNELGYPSSMISSISASNSPSFFHSST-AVMELIKFQLVDKRYRLTEAINPD 117

Query: 121 IETAKDKLPSLETLLIERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIY 180
           + T + KLPSLE LL+ RL+MD+P             IPS  LF  A+PEL  LSDD+IY
Sbjct: 118 V-TPQYKLPSLEHLLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIY 176

Query: 181 FSNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYN 240
           FSNEKDHHD AWYAKRL VS  Y+ SKL+M ++   N+  T DFAK KL+R+M LGEYYN
Sbjct: 177 FSNEKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYN 236

Query: 241 NTEEYAWYTLMVSMNLVKARLARG 264
           NTEE+AWYTLM ++NLVK++L RG
Sbjct: 237 NTEEFAWYTLMSTVNLVKSQLVRG 260

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  232 bits (592), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 122/262 (46%), Positives = 158/262 (60%), Gaps = 2/262 (0%)

Query: 2   LLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFT 61
           LL   +S+   LS  R +H N +EYA +  ++PLTY  DS Q +IL++ L   VP  GFT
Sbjct: 5   LLKNSVSRRALLS-TRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFT 63

Query: 62  DEAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYI 121
           + A+                               AVMEL+KF LV KR+ LTE++    
Sbjct: 64  ERAL-LKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAG 122

Query: 122 ETAKDKLPSLETLLIERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYF 181
             +   LPSLE LL++RL+MD P             +PS  + NVA+PELF LSDD+IYF
Sbjct: 123 LGSPAALPSLEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYF 182

Query: 182 SNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNN 241
           SNEKDH D AWY+KRLGVS AY +SKL+M ++N  N   TI+FA+DKLHRIM LGEYYNN
Sbjct: 183 SNEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNN 242

Query: 242 TEEYAWYTLMVSMNLVKARLAR 263
            EEYAWY++M ++N  KA  +R
Sbjct: 243 VEEYAWYSIMTTVNRAKAGFSR 264

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  226 bits (577), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 154/249 (61%), Gaps = 4/249 (1%)

Query: 17  RAFHSNTLEYAKAA-TLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITXXXXXXXXX 75
           R +     EY     +  PL Y KDS QYK+LS+ L K VP  GF + AI          
Sbjct: 15  RGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNELGYP 74

Query: 76  XXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLL 135
                                A+MELLKF LV KR  LTENI+  +ET  D+LPSLE L+
Sbjct: 75  STMLSVIGSSNGPSFFHSSP-ALMELLKFHLVDKRLNLTENIS--LETPVDQLPSLEHLV 131

Query: 136 IERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAK 195
           I+RL+M+ P             IP P L + ++PEL  LSDD+IYFS EKDH+D AWY+K
Sbjct: 132 IKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYSK 191

Query: 196 RLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMN 255
           RL VSCAYVSS+L+M ++   ++ +T +FA++KLHR+  LGEYYNNTEE+AWYTL+ ++N
Sbjct: 192 RLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLSTIN 251

Query: 256 LVKARLARG 264
           LVK++LARG
Sbjct: 252 LVKSQLARG 260

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  223 bits (567), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 121/259 (46%), Positives = 165/259 (63%), Gaps = 5/259 (1%)

Query: 6   ILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAI 65
           +LSK++K +  R ++S + +  K+  L PL Y KDS QY+IL +A+   VP  GFT+ AI
Sbjct: 26  LLSKHIKNNGIRTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAI 85

Query: 66  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYIETAK 125
                                          AV+ELLKF LVSKR +L+E I P  ET K
Sbjct: 86  INSINKLGYNSSMISVLGSSNTHNILHSSP-AVLELLKFNLVSKRLKLSEGIDP--ET-K 141

Query: 126 DKLPSLETLLIERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEK 185
           D LPSLE LL++RL+MD+              IP   L   ++PELF LSDD+IYFSNEK
Sbjct: 142 D-LPSLEYLLLKRLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEK 200

Query: 186 DHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEY 245
           DHHDMAWY+KRL VS  Y++S+++M ++   +  KT++FA+DKL+++MNLGEYYNNTEE+
Sbjct: 201 DHHDMAWYSKRLAVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEF 260

Query: 246 AWYTLMVSMNLVKARLARG 264
            W+TLM S+N+VK++LAR 
Sbjct: 261 LWFTLMTSVNIVKSQLARS 279

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  221 bits (563), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 155/251 (61%), Gaps = 3/251 (1%)

Query: 13  LSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITXXXXXX 72
           LS  R +H  + EY       PLTY  +S ++K+LS+ +   VP+ GFT++AI       
Sbjct: 20  LSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAM 79

Query: 73  XXXXXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLE 132
                                   AVMEL+KFQLV KR+++ E IT   E +K  LPSLE
Sbjct: 80  KMPSGMLTTIGASNSATFLHSSP-AVMELIKFQLVEKRHRMVEGITEIAEASK--LPSLE 136

Query: 133 TLLIERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAW 192
           +LL++RLKMD P            ++PS  + NV+LPEL  L+DD+IY+SNEKDHHD AW
Sbjct: 137 SLLLKRLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAW 196

Query: 193 YAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMV 252
           Y KR  ++  Y++SK +M ++   NF +T++FA+DKLH++M LG+YYNN EE+ W+TLM 
Sbjct: 197 YTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMS 256

Query: 253 SMNLVKARLAR 263
           ++NL K+++AR
Sbjct: 257 AVNLTKSQMAR 267

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  219 bits (559), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 111/248 (44%), Positives = 150/248 (60%), Gaps = 7/248 (2%)

Query: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITXXXXXXXXXX 76
           R +H +  E+  ++ L PL Y  DS QY +LS+AL   VP  GF + AI           
Sbjct: 11  RRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYPS 70

Query: 77  XXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLI 136
                               AVMEL+KF LV KR QL+++++       ++ PSLE L I
Sbjct: 71  TMLSVIGASNSPSLLHSSP-AVMELVKFHLVQKRLQLSQDLS------SEEKPSLEDLFI 123

Query: 137 ERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKR 196
           +RL+++ P             +P P   + ALPEL  LSDDLIY+SNEKDHHD AWY+KR
Sbjct: 124 KRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKR 183

Query: 197 LGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNL 256
           LG+SCAYVSS+L+M ++   N+++T  FA+DKL R M LGEYYNNTEE+ WYTL+ S+NL
Sbjct: 184 LGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINL 243

Query: 257 VKARLARG 264
            K+++ARG
Sbjct: 244 AKSQMARG 251

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  219 bits (559), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 160/249 (64%), Gaps = 2/249 (0%)

Query: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITXXXXXXXXXX 76
           R FH  T EY     LSP TY KDS Q+KILS+A++  V K GF++ AI           
Sbjct: 17  RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELKIEN 76

Query: 77  XXXXXXXXXXXXXXXXXXXX-AVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLL 135
                                +VMELLKF LV KRY++ E + P +   +++LPSLE+LL
Sbjct: 77  QSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDP-LTMQQEELPSLESLL 135

Query: 136 IERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAK 195
           ++RL+MD P            +IP P L + ALPEL  L+DD+IYFSNEKDHHD AWY+K
Sbjct: 136 LKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSK 195

Query: 196 RLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMN 255
           RLGVS AY+SSKL+M ++N  N+ +T+ FAKDKL ++M LG+YYNNTEEYAWY L+ S+N
Sbjct: 196 RLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVN 255

Query: 256 LVKARLARG 264
           +VK+R++R 
Sbjct: 256 MVKSRMSRA 264

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  208 bits (529), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 108/248 (43%), Positives = 148/248 (59%), Gaps = 5/248 (2%)

Query: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITXXXXXXXXXX 76
           R +H N LE+A +  L PL Y+KDS Q+KIL+NAL++ VPK GF + A+T          
Sbjct: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71

Query: 77  XXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLI 136
                               AV+ELLKF LVSKRY LT+ +         + PSLE L +
Sbjct: 72  SFLSVLGASNSPSFFNSSP-AVLELLKFHLVSKRYSLTDGVA----DGTLESPSLENLFL 126

Query: 137 ERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKR 196
           +RL+M++P             +P   L   A+PEL  LSDD++YFSNE DH+D AWY+KR
Sbjct: 127 KRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKR 186

Query: 197 LGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNL 256
           L +S AYVSS+L+M ++   ++  T+ FAK+KL  I  LGE YNN EEYAWYTL+ S++L
Sbjct: 187 LAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISL 246

Query: 257 VKARLARG 264
            K+++ R 
Sbjct: 247 AKSQMTRS 254

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  208 bits (529), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 106/264 (40%), Positives = 154/264 (58%), Gaps = 8/264 (3%)

Query: 1   MLLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGF 60
           + L+RIL++       R +H + LE+  A + +PLTY   S Q+K+L +ALNK VP  GF
Sbjct: 2   LALSRILAR-------RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGF 54

Query: 61  TDEAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPY 120
            + A+                               AV+EL+KF LV+KRY LT+ + P 
Sbjct: 55  NERALVASLNDLDLGPSLLSVIGASNSPSFLNASP-AVLELIKFHLVTKRYALTKELDPA 113

Query: 121 IETAKDKLPSLETLLIERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIY 180
             ++  + P+LETL   RL++++P             IP   L   ALPEL  LSDD++Y
Sbjct: 114 RTSSPAEPPALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVY 173

Query: 181 FSNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYN 240
           FS E D +D AWY+KR+ +SCA+VSS+L+M ++   N+  T +FA +KLH +  LG+YYN
Sbjct: 174 FSKEPDANDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYN 233

Query: 241 NTEEYAWYTLMVSMNLVKARLARG 264
           NTEEY WYTL++S+NL K++L R 
Sbjct: 234 NTEEYMWYTLLMSVNLAKSQLTRS 257

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  206 bits (524), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 115/262 (43%), Positives = 164/262 (62%), Gaps = 8/262 (3%)

Query: 3   LNRILSKNVKL-SINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFT 61
           LN+ L +  +   + R +H  + EY    T+SPLTY+ DS+Q KILS++L ++VP  GF 
Sbjct: 9   LNKSLLRTTQFKCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFN 68

Query: 62  DEAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYI 121
           +++I                               AV+EL+K+ LVSKR +LT+      
Sbjct: 69  EKSI-LKSINDLGYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTK------ 121

Query: 122 ETAKDKLPSLETLLIERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYF 181
           +T  +   +L+ LL++RL+MD P              P   +F+V+LPELF L+DD+I+F
Sbjct: 122 DTNDNTTTTLKELLLKRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFF 181

Query: 182 SNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNN 241
           SNEKDHHDMAWY+KRL VS AYV+SK++M+++   NF  T+DFA DK+ R+MNLGEYYNN
Sbjct: 182 SNEKDHHDMAWYSKRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNN 241

Query: 242 TEEYAWYTLMVSMNLVKARLAR 263
            EEYAW+TLM S+NLVK++ +R
Sbjct: 242 VEEYAWFTLMNSINLVKSQFSR 263

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  201 bits (510), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 149/248 (60%), Gaps = 4/248 (1%)

Query: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITXXXXXXXXXX 76
           R +H N LE+A    + PLTY  DSVQ+K+LSNALNK VP+ GF + AI           
Sbjct: 7   RLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGMGS 66

Query: 77  XXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLI 136
                               +V+EL+KF LVSKR QL   IT     +   LP L+TL +
Sbjct: 67  SYLSVLGSSNSPSFFNVSP-SVLELVKFHLVSKRNQL---ITDLPLDSDKPLPDLKTLFL 122

Query: 137 ERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKR 196
           +RLK+++              +P   L + AL EL  L+DD+I++SNE+DH+D AWY+KR
Sbjct: 123 QRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKR 182

Query: 197 LGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNL 256
           + +S AYVSS+L+M ++   NF +T++FA+ KL+++  LG  YNNTEEY W+TL+ S+NL
Sbjct: 183 IALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINL 242

Query: 257 VKARLARG 264
            K+++ RG
Sbjct: 243 AKSQITRG 250

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  193 bits (491), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 99/259 (38%), Positives = 145/259 (55%), Gaps = 1/259 (0%)

Query: 6   ILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAI 65
           +L+++ +    R +  N LEY     L+PL Y   S+Q+K+L +AL   VP  GF + A+
Sbjct: 1   MLARSFRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERAL 60

Query: 66  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYIETAK 125
                                          AV+EL+KF LV+KRY LT+++      + 
Sbjct: 61  VASLNDLGLGSQVLSSIGAPNSPPLLNSSP-AVLELVKFHLVTKRYALTKDLDIARCASP 119

Query: 126 DKLPSLETLLIERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEK 185
            + P+LETL  +RL+++ P             +P   L   ALPEL  LSDD+IYFS E 
Sbjct: 120 AEPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEP 179

Query: 186 DHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEY 245
           D +D AWY+KR  +SCA+VSS+L+M ++   N+  T +FA DKLH +  LG+YY NTEEY
Sbjct: 180 DANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEY 239

Query: 246 AWYTLMVSMNLVKARLARG 264
            WYTL++S+NL K+++ R 
Sbjct: 240 MWYTLLMSVNLAKSQITRS 258

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  189 bits (480), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 99/248 (39%), Positives = 138/248 (55%), Gaps = 8/248 (3%)

Query: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITXXXXXXXXXX 76
           R +H NTLE+A    L PL Y +DS QYK+L  AL   VP  GF + AI           
Sbjct: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGS 66

Query: 77  XXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLI 136
                               AV+EL+KF LV+KR  L +        A     S+E L +
Sbjct: 67  AVLSALAAPNSPALLNVPS-AVLELVKFHLVTKRVALAD-------AAAQGNVSMEQLFL 118

Query: 137 ERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKR 196
           +R++ D+P             +P   L N A+PELF LSDDLIY+S EKDH D+AWY+KR
Sbjct: 119 QRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKR 178

Query: 197 LGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNL 256
             V+ AYVS+ L+M ++     ++T+ FA+ +L ++ +LG  YNN EE+AWY L+++MNL
Sbjct: 179 AAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNL 238

Query: 257 VKARLARG 264
           VK++L RG
Sbjct: 239 VKSQLTRG 246

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  189 bits (479), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 143/251 (56%), Gaps = 9/251 (3%)

Query: 14  SINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITXXXXXXX 73
              R +H N+ EYA   TL PL Y + S QYK+L+ AL K+VP KGF D AI        
Sbjct: 12  GFRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELG 71

Query: 74  XXXXXXXXXXXXXXXXXXXXXXXAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLET 133
                                  +V EL+KF LV+KRY L E+        ++   +LE 
Sbjct: 72  YNSAVLAAIGANNSPAMFNVST-SVQELVKFHLVTKRYGLQED--------QEGTKTLEE 122

Query: 134 LLIERLKMDQPXXXXXXXXXXXXIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWY 193
           L ++RL+ ++              IP   L N  LPELF L+DD+IY+S EKD +D+AWY
Sbjct: 123 LFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWY 182

Query: 194 AKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVS 253
           +KRL VS AY+S++L+M K++  NF  T++FAK ++++I  +G  YNN EE+AW+ L+ +
Sbjct: 183 SKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTT 242

Query: 254 MNLVKARLARG 264
           +NL +++L RG
Sbjct: 243 VNLARSQLVRG 253

>NDAI0H00700 Chr8 complement(158572..159003) [432 bp, 143 aa] {ON} 
          Length = 143

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 12/62 (19%)

Query: 165 NVALPELFNLSDDLIYFSNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDF 224
           ++ALP++ N  D L Y    KD H     A+ L    A+       ++ NGE F K ++F
Sbjct: 24  DIALPDILNNDDALAYLGMLKDKH-----AQTLEEEMAH-------MRENGEEFKKHLEF 71

Query: 225 AK 226
            K
Sbjct: 72  QK 73

>KLLA0F05445g Chr6 (535675..537105) [1431 bp, 476 aa] {ON} weakly
           similar to uniprot|Q12516 Saccharomyces cerevisiae
           YDL133W
          Length = 476

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 14/88 (15%)

Query: 163 LFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTI 222
           +FN  +PE + LS       N++D ++   Y  +L        +  Y+ K++ +   +T 
Sbjct: 215 IFNAPIPESYELS-------NQRDKNEWLKYVSQL-------KAFYYLNKDSAKQSSETH 260

Query: 223 DFAKDKLHRIMNLGEYYNNTEEYAWYTL 250
                + H I+N G    N+++ +W TL
Sbjct: 261 SSDDGRFHSILNKGRNSVNSKKNSWATL 288

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,049,373
Number of extensions: 931187
Number of successful extensions: 2586
Number of sequences better than 10.0: 23
Number of HSP's gapped: 2615
Number of HSP's successfully gapped: 41
Length of query: 264
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 157
Effective length of database: 41,212,137
Effective search space: 6470305509
Effective search space used: 6470305509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)