Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E044607.352ON1061065382e-72
NCAS0E028607.352ON1051033864e-49
ZYRO0F11748g7.352ON1091033733e-47
TDEL0C019607.352ON1071033724e-47
KAFR0L014907.352ON1071033656e-46
YLR200W (YKE2)7.352ON1141023622e-45
Smik_12.2597.352ON1141023612e-45
TPHA0F029907.352ON1071033586e-45
KNAG0B026107.352ON1191023553e-44
Suva_10.2957.352ON1141023526e-44
TBLA0E004407.352ON1151033501e-43
Skud_12.2647.352ON1141023482e-43
KLLA0D12298g7.352ON1151043473e-43
Ecym_47217.352ON1071013464e-43
Kpol_530.297.352ON1071033456e-43
ACL146C7.352ON1071043394e-42
SAKL0F11418g7.352ON1151043405e-42
CAGL0A03971g7.352ON1061023352e-41
Kwal_56.246487.352ON1131013232e-39
KLTH0H01210g7.352ON1131053213e-39
KLLA0D13904g7.139ON111103680.30
KLLA0C17094g8.143ON22540641.6
Kpol_1039.612.101ON129102631.6
TBLA0D046107.186ON117486632.9
KAFR0G003201.162ON69051623.0
Kwal_47.191843.546ON71240614.5
ACR060W5.260ON66896605.4
KAFR0D004301.46ON45629606.8
KLTH0F13728g7.171ON417755810.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E04460
         (106 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   211   2e-72
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   153   4e-49
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   148   3e-47
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   147   4e-47
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   145   6e-46
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   144   2e-45
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   143   2e-45
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   142   6e-45
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   141   3e-44
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   140   6e-44
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   139   1e-43
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   138   2e-43
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   138   3e-43
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   137   4e-43
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   137   6e-43
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   135   4e-42
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   135   5e-42
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   133   2e-41
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   129   2e-39
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   128   3e-39
KLLA0D13904g Chr4 complement(1195920..1196236,1196332..1196350) ...    31   0.30 
KLLA0C17094g Chr3 complement(1495879..1496556) [678 bp, 225 aa] ...    29   1.6  
Kpol_1039.61 s1039 complement(169465..169854) [390 bp, 129 aa] {...    29   1.6  
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    29   2.9  
KAFR0G00320 Chr7 complement(101116..103188) [2073 bp, 690 aa] {O...    28   3.0  
Kwal_47.19184 s47 complement(1126237..1128375) [2139 bp, 712 aa]...    28   4.5  
ACR060W Chr3 (463771..463771,463861..465866) [2007 bp, 668 aa] {...    28   5.4  
KAFR0D00430 Chr4 complement(62690..64060) [1371 bp, 456 aa] {ON}...    28   6.8  
KLTH0F13728g Chr6 complement(1124633..1125886) [1254 bp, 417 aa]...    27   10.0 

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  211 bits (538), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 106/106 (100%), Positives = 106/106 (100%)

Query: 1   MASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPV 60
           MASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPV
Sbjct: 1   MASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPV 60

Query: 61  DQEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMRQ 106
           DQEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMRQ
Sbjct: 61  DQEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMRQ 106

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  153 bits (386), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 92/103 (89%)

Query: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62
           ++LP++YQ LQ ELE  I+ARQKLETQLQENKIV++EF QL  E++VYKLTGNVLLPV+Q
Sbjct: 2   ADLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVEQ 61

Query: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105
           +EA SNV+KRLEFIQ+EI++CE NIK KQ+EL+ VR+EI+KMR
Sbjct: 62  DEARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKMR 104

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  148 bits (373), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 90/103 (87%)

Query: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62
           S L ++YQ LQGELE+ I+ARQKLETQLQENKIV +EFN L S+S+VYKLTGNVLLPV+Q
Sbjct: 2   SELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQ 61

Query: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105
           ++A +NV KRLEFIQTEI RCENNIK KQ+E + V++E++K+R
Sbjct: 62  DDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLR 104

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  147 bits (372), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 89/103 (86%)

Query: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62
           S+L + YQ LQ ELE L++ARQKLETQLQENKIV EEF++L  ++QVYKLTGNVLLPV+Q
Sbjct: 2   SDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQ 61

Query: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105
            EA+SNV KRLEFIQTEI RCENN+K KQQE + +R+E++K+R
Sbjct: 62  SEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLR 104

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  145 bits (365), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 70/103 (67%), Positives = 89/103 (86%)

Query: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62
           S L ++YQ LQ ELE+LI+ARQKLETQLQENKIV +EF  L  E+QVYKLTGNVLLP++Q
Sbjct: 2   SELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIEQ 61

Query: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105
           +EA  NVDKRLEFI+ EI+RCE NIK+KQ E++N+R+E++K+R
Sbjct: 62  DEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLR 104

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  144 bits (362), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 89/102 (87%)

Query: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62
           S L +KYQ LQ ELE+ I+ARQKLETQLQENKIV EEF+QL  ++ VYKLTGNVLLPV+Q
Sbjct: 2   SELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQ 61

Query: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKM 104
            EA +NVDKRLEFI+TEI+RCE NI++KQ+EL+ +RSE++K+
Sbjct: 62  SEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKL 103

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  143 bits (361), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 87/102 (85%)

Query: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62
           S L +KYQ LQGELE+ I+ARQKLETQLQENKIV EEF+QL   + VYKLTGNVLLPVDQ
Sbjct: 2   SELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQ 61

Query: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKM 104
            EA  NVDKRLEFI+ EI+RCE NIK+KQ++L+ VR++++K+
Sbjct: 62  SEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKL 103

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  142 bits (358), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 69/103 (66%), Positives = 87/103 (84%)

Query: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62
           S++ +KYQ +QGELE+LI+ARQKLETQLQENKIV +EFN L  ++ +YKLTGNV+LP++Q
Sbjct: 2   SDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQ 61

Query: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105
            EA SNV+KRLEFI+ EI RCE NIK KQ ELD +R E++KMR
Sbjct: 62  FEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMR 104

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  141 bits (355), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 85/102 (83%)

Query: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62
           SN  +KYQ  Q  LE+LI+ARQKLETQLQENKIVIEEF+ L  +S+VYKLTG+VLLPVDQ
Sbjct: 2   SNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQ 61

Query: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKM 104
           +EA +NVDKRLEFI  EI RCE NIK KQ+ L+ +RSE++K+
Sbjct: 62  DEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  140 bits (352), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 86/102 (84%)

Query: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62
           S L +KYQ LQ ELE+ I+ARQKLETQLQENKIV EEF+QL  ++ VYKLTGNVLLPV+Q
Sbjct: 2   SELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQ 61

Query: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKM 104
            EA  NV+KRLEFI+TEI RCE NI+ KQ+EL+ VR+E++K+
Sbjct: 62  SEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKL 103

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  139 bits (350), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 85/103 (82%), Gaps = 1/103 (0%)

Query: 1   MASN-LPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLP 59
           M+SN L +KYQ  Q ELE  I+ RQKLETQLQENKIV +EF +L  E++V+KLTGNVLLP
Sbjct: 1   MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60

Query: 60  VDQEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEIL 102
           ++Q+EA SN+DKRLEFIQTEI RCE NIK KQ E++ +RSE++
Sbjct: 61  IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  138 bits (348), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 85/102 (83%)

Query: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62
           S L ++YQ LQ ELE+ I+ARQKLETQLQENKIV EEF+Q+  ++ VYKLTGNVLLPV+Q
Sbjct: 2   SELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQ 61

Query: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKM 104
            EA  NVDKRLEFI+TEI RCE NI+ KQ EL+ VR+E++K+
Sbjct: 62  SEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKL 103

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  138 bits (347), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (79%)

Query: 2   ASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVD 61
           A     KY  LQGELE+LI+ARQKLETQLQENKIV +EF+ L  ++ VYKLTG VLLPV+
Sbjct: 3   AEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVE 62

Query: 62  QEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105
           Q EA  NV+KRLEFI+ EI RCE NIK+KQQEL+  RSE++K+R
Sbjct: 63  QFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLR 106

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  137 bits (346), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 80/101 (79%)

Query: 5   LPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQEE 64
           + +KY  LQGELE LI+ RQKLETQLQENKIV EE   L  + QVYKLTG VLLPV+ EE
Sbjct: 6   VAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVEHEE 65

Query: 65  AHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105
           A+SNV KRLEFIQ EI RCE NIKNKQQEL+  R E++K+R
Sbjct: 66  ANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLR 106

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  137 bits (345), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 88/103 (85%)

Query: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62
           S+L +KYQ +QGELE++I+AR++LETQLQENKIV EEF  L  ++QVYKLTGNVLLPV+Q
Sbjct: 2   SDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQ 61

Query: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105
            EA SNV+KRLEFI+ EI +CE+NIK+KQ EL+ +R E++K R
Sbjct: 62  FEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGR 104

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  135 bits (339), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 81/104 (77%)

Query: 2   ASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVD 61
           A  + +KY  LQGELE+L++ RQKLETQLQENKIV EE   L  E+QVYKLTG VLLPV+
Sbjct: 3   AEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVE 62

Query: 62  QEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105
           QEEA  NV KRLEFI+ EI RCE NIK KQ+E++  R+ ++K+R
Sbjct: 63  QEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLR 106

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  135 bits (340), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (81%)

Query: 2   ASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVD 61
           A  L  +Y  +Q ELEDL++ARQKLETQLQENKIV +EF+ L  ESQVYKLTG VLLPV+
Sbjct: 6   AQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVE 65

Query: 62  QEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105
           QEEA  NV+KRL+FI+ EI+RCE NIK KQ +L+ +R+E++++R
Sbjct: 66  QEEAKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLR 109

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  133 bits (335), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 84/102 (82%)

Query: 1   MASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPV 60
           M++ L +KYQ LQ ELE+L+ ARQKLETQLQENKIV EEF  L  ++ VYKLTGNVLLPV
Sbjct: 1   MSAELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPV 60

Query: 61  DQEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEIL 102
           + ++A +NVDKRLEFI  EI RCE+NI++KQQEL+ +R +++
Sbjct: 61  EHDDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  129 bits (323), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%)

Query: 2   ASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVD 61
           A  L   Y   Q ELE+L+ ARQ+LETQLQENKIV +EF+ L  E+QVYKLTG VLLPV+
Sbjct: 5   AQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVE 64

Query: 62  QEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEIL 102
           Q EA SNV KRLEFI TEI RCE+NIKNKQ  L+ +R+E+L
Sbjct: 65  QFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELL 105

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  128 bits (321), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 67/105 (63%), Positives = 82/105 (78%)

Query: 2   ASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVD 61
           A +L   Y   Q ELE+L++ARQKLETQLQENKIV +EF+ L  E+QVYKLTGNVLLPV+
Sbjct: 5   AQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVE 64

Query: 62  QEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMRQ 106
           Q EA SNV KRLEFI  EI+RCE NIK KQ  L+ +R+E+L+ +Q
Sbjct: 65  QFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQ 109

>KLLA0D13904g Chr4 complement(1195920..1196236,1196332..1196350)
           [336 bp, 111 aa] {ON} similar to uniprot|P40005 YEL003w
           Saccharomyces cerevisiae GIM4 subunit of the
           heterohexameric cochaperone prefoldin complex
          Length = 111

 Score = 30.8 bits (68), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 15/103 (14%)

Query: 2   ASN-LPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPV 60
           ASN L  KY   +G LE+L     +L     E+ IV++  N+   E + Y++ G+ L+  
Sbjct: 4   ASNVLQLKYNEFKGTLEELQSKIIELGRDKDEHDIVLKTLNETDPERKCYRMVGSALVDT 63

Query: 61  DQEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILK 103
           D              ++T I   +NN    +Q +  ++ +++K
Sbjct: 64  D--------------VKTTIPVLQNNRDKLEQTVSTLKGQLIK 92

>KLLA0C17094g Chr3 complement(1495879..1496556) [678 bp, 225 aa]
           {ON} similar to uniprot|P53102 Saccharomyces cerevisiae
           YGL183C MND1 Protein required for recombination and
           meiotic nuclear division forms a complex with Hop2p
           which is involved in chromosome pairing and repair of
           meiotic double-strand breaks
          Length = 225

 Score = 29.3 bits (64), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 27/40 (67%), Gaps = 3/40 (7%)

Query: 67  SNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMRQ 106
           SN++KR+E  ++EI+RC+      Q+E+   RS+ LK R+
Sbjct: 89  SNIEKRIEHEKSEIARCQELY---QKEIQGQRSDTLKNRR 125

>Kpol_1039.61 s1039 complement(169465..169854) [390 bp, 129 aa] {ON}
           complement(169465..169854) [390 nt, 130 aa]
          Length = 129

 Score = 28.9 bits (63), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 13/102 (12%)

Query: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQ---ENKIVIEEFN---QLPSESQV--YKLTG 54
           +N+  K Q L  E   LIM +  +E QL    E K  +E+ +   +L  E Q+  YK+ G
Sbjct: 12  TNVSYKDQQLINEFSKLIMRKDSIEEQLNLQNEEKSYLEDVSLEIELIDEDQLVHYKI-G 70

Query: 55  NVLLPVDQEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDN 96
           +V L + QEE  + ++   E I ++I    +N++N + E+D+
Sbjct: 71  DVFLMLPQEEVVNLLESDTEVIDSKI----DNLQNSKSEIDD 108

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (55%), Gaps = 7/86 (8%)

Query: 26  LETQLQENKIVIEEFNQLPSESQVYKLTGNVL---LPVDQEEAHSN----VDKRLEFIQT 78
           LE  L++ KI + E  ++ S S+V +   N+    L + Q    SN    + KR E I  
Sbjct: 697 LEENLRDIKIKLNEQEKIYSASKVIQNDLNLAEHKLAMAQRSVDSNQSTQLIKRNEAISL 756

Query: 79  EISRCENNIKNKQQELDNVRSEILKM 104
           EI  CEN+I  +Q +L+++++ I+++
Sbjct: 757 EIKSCENSITQEQNKLESIQNSIIQI 782

>KAFR0G00320 Chr7 complement(101116..103188) [2073 bp, 690 aa] {ON}
           Anc_1.162 YKL179C
          Length = 690

 Score = 28.5 bits (62), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%)

Query: 55  NVLLPVDQEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105
           N+LL    E+ HSN+ K+    Q+E      N+KN   EL++ +SE+  +R
Sbjct: 291 NILLSASLEKEHSNLSKK----QSEFDESMKNVKN---ELESYKSELQALR 334

>Kwal_47.19184 s47 complement(1126237..1128375) [2139 bp, 712 aa]
           {ON} YGL228W (SHE10) - lethal when overexpressed [contig
           344] FULL
          Length = 712

 Score = 28.1 bits (61), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 27/40 (67%), Gaps = 3/40 (7%)

Query: 65  AHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKM 104
           AH++V++RLEF++ ++   E  +    +E+D +R E L++
Sbjct: 373 AHAHVEERLEFVRAQL---EKFVAMVNKEVDEIRQESLEL 409

>ACR060W Chr3 (463771..463771,463861..465866) [2007 bp, 668 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL041W
           (NSP1); 1-intron
          Length = 668

 Score = 27.7 bits (60), Expect = 5.4,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 47/96 (48%), Gaps = 15/96 (15%)

Query: 16  LEDLIMARQKLETQLQENKIVIEEFNQLPSE---------SQVYKLTGNVLLPVDQEEAH 66
           L+DL+    KL TQL  +    E + +  +E          Q+ +L  + L+    E+  
Sbjct: 482 LDDLVT---KLTTQLTGSAGHFETYAKKINEWDQVLVQGGEQISQLYSDTLI---AEQTQ 535

Query: 67  SNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEIL 102
           S VD+ L++I+ + +  E  + N +++ + + SEI 
Sbjct: 536 SRVDQHLQYIERQQNELETFLDNYEKKAETLLSEIF 571

>KAFR0D00430 Chr4 complement(62690..64060) [1371 bp, 456 aa] {ON}
           Anc_1.46 YCL029C
          Length = 456

 Score = 27.7 bits (60), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 73  LEFIQTEISRCENNIKNKQQELDNVRSEI 101
           LE IQ  I  CENNI+  +QE D +++++
Sbjct: 211 LEEIQPTIDACENNIREIEQERDQLKAQL 239

>KLTH0F13728g Chr6 complement(1124633..1125886) [1254 bp, 417 aa]
           {ON} highly similar to uniprot|P10363 Saccharomyces
           cerevisiae YIR008C PRI1 Subunit of DNA primase which is
           required for DNA synthesis and double-strand break
           repair
          Length = 417

 Score = 26.9 bits (58), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 8/75 (10%)

Query: 17  EDLIMAR--QKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQEEAHSNVDKRLE 74
           EDL++A    KL+ ++ +  I +     L +   ++  TGNV +P+++    SN  K +E
Sbjct: 312 EDLVLATLYPKLDVEVTKQTIHL-----LKAPFCIHPATGNVCVPINETFIPSNAPKLIE 366

Query: 75  FIQTEISRCENNIKN 89
            +Q E+    N ++N
Sbjct: 367 -LQREMEANGNKVEN 380

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.331 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,243,790
Number of extensions: 461462
Number of successful extensions: 2789
Number of sequences better than 10.0: 279
Number of HSP's gapped: 2776
Number of HSP's successfully gapped: 309
Length of query: 106
Length of database: 53,481,399
Length adjustment: 76
Effective length of query: 30
Effective length of database: 44,766,783
Effective search space: 1343003490
Effective search space used: 1343003490
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)