Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E036807.127ON44444422600.0
NCAS0E021407.127ON48145018980.0
YPL259C (APM1)7.127ON47547518310.0
Smik_6.4667.127ON47647518220.0
Suva_16.457.127ON47847718210.0
TDEL0H028907.127ON44244318160.0
Skud_16.197.127ON47647518090.0
SAKL0F05346g7.127ON44744718030.0
KNAG0L009507.127ON46146117980.0
Kpol_1062.567.127ON45045117900.0
TBLA0A009507.127ON46946817830.0
CAGL0K00539g7.127ON45645517720.0
ZYRO0C05236g7.127ON44744617630.0
KAFR0L004707.127ON46546817550.0
KLTH0F12584g7.127ON44144217440.0
Kwal_55.208437.127ON44144217310.0
ADL017C7.127ON44344417320.0
Ecym_83507.127ON44544617220.0
TPHA0C043207.127ON45445317100.0
KLLA0D14311g7.127ON44344416970.0
Ecym_52393.165ON4644745667e-67
KLTH0F06534g3.165ON4664745562e-65
Kwal_33.141823.165ON4674765529e-65
SAKL0C07414g3.165ON4824915476e-64
KLLA0C03894g3.165ON4754825204e-60
TDEL0D045803.165ON4824895074e-58
NCAS0C035803.165ON4915005041e-57
CAGL0C05203g3.165ON4754894822e-54
TBLA0F008403.165ON4814894786e-54
NDAI0G029203.165ON4864944734e-53
ZYRO0B04840g3.165ON4764834724e-53
ADR315W3.165ON4923834656e-52
Kpol_1045.443.165ON4694434638e-52
SAKL0D13090g2.555ON4995204631e-51
YOL062C (APM4)3.165ON4915014438e-49
KLTH0D07502g2.555ON5045274421e-48
ABR047W2.555ON4984644342e-47
Suva_15.1033.165ON4915004235e-46
TPHA0P006603.165ON4734404112e-44
Kwal_26.81462.555ON5055284123e-44
KLLA0F25432g2.555ON5075224011e-42
Smik_15.963.165ON4912973973e-42
Skud_15.913.165ON4912983956e-42
Ecym_45912.555ON5014803834e-40
KNAG0K011503.165ON4744883797e-40
TDEL0B064302.555ON5253253624e-37
TPHA0I023902.555ON5593543485e-35
KAFR0A020602.555ON5403343362e-33
ZYRO0E05874g2.555ON5493343301e-32
CAGL0K03223g2.555ON5983653292e-32
Kpol_1056.132.555ON5413423263e-32
NCAS0A126502.555ON5883563241e-31
Skud_8.262.555ON5963623222e-31
KAFR0C010203.165ON4284663135e-31
Smik_8.232.555ON6033593179e-31
KNAG0C055502.555ON5823453099e-30
YHL019C (APM2)2.555ON6053633062e-29
Suva_8.332.555ON5963613044e-29
TBLA0B067602.555ON6572332249e-19
NDAI0B016102.555ON6722562113e-17
SAKL0A09218g2.522ON4732431614e-11
KAFR0D035602.522ON4553371597e-11
KLTH0D06556g2.522ON4561371571e-10
KLLA0E18789g2.522ON4971611581e-10
AGL061W2.522ON4111301472e-09
TPHA0C041302.522ON5331411473e-09
TDEL0A029702.522ON4963251463e-09
Kwal_26.79572.522ON4561281444e-09
ZYRO0B01738g2.522ON4921361392e-08
TBLA0I006202.522ON6091461312e-07
Suva_4.5482.522ON4841331251e-06
NCAS0A048702.522ON4893191232e-06
Kpol_1018.422.522ON5751421196e-06
YBR288C (APM3)2.522ON4831351188e-06
Smik_2.4302.522ON4843241142e-05
Skud_2.4192.522ON4841301132e-05
ZYRO0E09746g3.575ON5381291133e-05
KLLA0D11396g3.575ON5361221107e-05
CAGL0L02145g2.522ON5431501010.001
TBLA0E001403.575ON543129990.002
NDAI0B063203.575ON540114980.002
Ecym_60073.575ON537122980.002
KLTH0G00528g3.575ON633137960.003
NCAS0F040103.575ON547129950.005
YFR051C (RET2)3.575ON546115940.005
Skud_6.1423.575ON546115940.007
Suva_12.63.575ON546115930.007
NDAI0K019302.522ON612151940.007
AFR274C3.575ON532122930.008
Kwal_47.192923.575ON538137920.010
TDEL0D064303.575ON536114910.015
Ecym_72662.522ON517128900.018
Smik_7.3713.575ON598115900.019
SAKL0F00594g3.575ON545122880.033
TPHA0G037003.575ON539129870.037
KNAG0A069702.522ON505140870.042
CAGL0A04741g3.575ON536129870.048
KNAG0D030003.575ON563133860.063
Kwal_0.348singletonOFF13292800.070
Kpol_380.133.575ON535114840.084
Kpol_507.73.575ON533114760.90
TBLA0B003704.73ON34676712.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E03680
         (444 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   875   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   735   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   709   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   706   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   706   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   704   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   701   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   699   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   697   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   694   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   691   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   687   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   683   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   680   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   676   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   671   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   671   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   667   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   663   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   658   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   222   7e-67
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   218   2e-65
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   217   9e-65
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   215   6e-64
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   204   4e-60
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   199   4e-58
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   198   1e-57
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   190   2e-54
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   188   6e-54
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   186   4e-53
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   186   4e-53
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   183   6e-52
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   182   8e-52
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   182   1e-51
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   175   8e-49
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   174   1e-48
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   171   2e-47
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   167   5e-46
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   162   2e-44
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   163   3e-44
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   159   1e-42
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   157   3e-42
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   156   6e-42
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   152   4e-40
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   150   7e-40
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   144   4e-37
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   138   5e-35
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   134   2e-33
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   131   1e-32
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   131   2e-32
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   130   3e-32
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   129   1e-31
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   128   2e-31
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   125   5e-31
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   126   9e-31
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   123   9e-30
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   122   2e-29
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   121   4e-29
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    91   9e-19
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    86   3e-17
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    67   4e-11
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    66   7e-11
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    65   1e-10
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    65   1e-10
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    61   2e-09
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    61   3e-09
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    61   3e-09
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    60   4e-09
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    58   2e-08
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    55   2e-07
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    53   1e-06
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    52   2e-06
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    50   6e-06
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    50   8e-06
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    49   2e-05
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    48   2e-05
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    48   3e-05
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    47   7e-05
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    44   0.001
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    43   0.002
NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa] ...    42   0.002
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    42   0.002
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    42   0.003
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    41   0.005
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    41   0.005
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    41   0.007
Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)     40   0.007
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    41   0.007
AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON} S...    40   0.008
Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]...    40   0.010
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    40   0.015
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    39   0.018
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    39   0.019
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    39   0.033
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    38   0.037
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    38   0.042
CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {...    38   0.048
KNAG0D03000 Chr4 complement(537905..539596) [1692 bp, 563 aa] {O...    38   0.063
Kwal_0.348 s0 (164816..165214) [399 bp, 132 aa] {OFF} [contig 88...    35   0.070
Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}...    37   0.084
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    34   0.90 
TBLA0B00370 Chr2 (68828..69868) [1041 bp, 346 aa] {ON}                 32   2.9  

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/444 (96%), Positives = 428/444 (96%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQ                RPPSALTDSVSWRSEGIKYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA 240
           DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA 240

Query: 241 TSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNV 300
           TSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNV
Sbjct: 241 TSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNV 300

Query: 301 QVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILW 360
           QVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILW
Sbjct: 301 QVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILW 360

Query: 361 KIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPK 420
           KIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPK
Sbjct: 361 KIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPK 420

Query: 421 LQYKSYPWVRYITQSGDDYTIRLI 444
           LQYKSYPWVRYITQSGDDYTIRLI
Sbjct: 421 LQYKSYPWVRYITQSGDDYTIRLI 444

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/450 (78%), Positives = 394/450 (87%), Gaps = 8/450 (1%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MASA+YFCD KG PLL+R+YRDDIP++AI+KF +LL+DLEEE++++PPCL+YN  QYLFI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+YLVAI N +  N A++FAFLYK++DVLG+YLKTVEEESIRDN+VIIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQ                RPP ALT+SVSWRS  IKYKKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA 240
           DI+ESINMLMTQKGQILRSEI+G VK+KSRLSGMPDLKLGINDKGIFSK + +D  NN  
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271

Query: 241 -------TSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 293
                  T KK+N IELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL
Sbjct: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331

Query: 294 IWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVP 353
           IWCDMN+QVHS SRIEIHCRAKAQIKKKSTATNV+I+IPVPEDADTP FKYSHGSIK+VP
Sbjct: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391

Query: 354 EKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRY 413
           EK+ I+WKIRSFPGGKEYSM+A++ LPS  +  EE + K+PVQ+KFQIPYFTTSGIQV+Y
Sbjct: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGN-IEEHKAKRPVQIKFQIPYFTTSGIQVKY 450

Query: 414 LKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
           LKINEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 451 LKINEPKLQYKSYPWVRYITQSGDDYTIRL 480

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/475 (73%), Positives = 391/475 (82%), Gaps = 33/475 (6%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MASA+YFCD  G+PLLSR+YRDDIPL+AIDKF  LL+DLEE+S++IPPCL +N  +YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+Y+VAI   L  N A +F FL+K+++VL DYLKTVEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQ                RPP ALT+SVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTN--- 237
           DIVESINMLMTQKGQ+LRSEI+G VK+ S+LSGMPDLKLGINDKGIFSK L +DDTN   
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYL-DDDTNIPS 239

Query: 238 -------NN-------------ATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDG 277
                  NN             AT+KK+  IELEDLKFHQCVRLSKFE EKIITFIPPDG
Sbjct: 240 ASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 299

Query: 278 DFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDA 337
            F+LMNYRLST+IKPLIWCD+NVQVHSNSRIEIHC+AKAQIK+KSTATNVEILIPVP+DA
Sbjct: 300 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 359

Query: 338 DTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSS---------KSEE 388
           DTP FKYSHGS+K+VPEKSAILWKIRSFPGGKEYSM+AEL LPS S+         KS  
Sbjct: 360 DTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNA 419

Query: 389 VQNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
              K PVQ+KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 420 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/475 (72%), Positives = 387/475 (81%), Gaps = 32/475 (6%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MASA+YFCD  G+PLLSR+YRDD+PL+AIDKF++LL+DLEE+S++IPPCL +N  +YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+YLVAI   L  N A +F FL+K+++VL DYLKTVEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQ                RPP ALT+SVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDT---- 236
           DIVESINMLMTQKGQ+LRSEI+G VK+ S+LSGMPDLKLGINDKGIFSK L  D      
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 237 -------NNNATSKK------------QNKIELEDLKFHQCVRLSKFETEKIITFIPPDG 277
                  NN  T KK            +  IELEDLKFHQCVRLSKFE EKIITFIPPDG
Sbjct: 241 VSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 278 DFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDA 337
            F+LMNYRLST+IKPLIWCD+NVQVHSNSRIEIHC+AKAQIK+KSTATNVEILIPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 360

Query: 338 DTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSS---------KSEE 388
           DTP FKYSHGS+K+VPEKSAILWK+RSFPGGKEYSM+AEL LPS S+         KS  
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNA 420

Query: 389 VQNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
              K PVQ+KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 421 KLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/477 (72%), Positives = 391/477 (81%), Gaps = 34/477 (7%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MASA+YFCD  G+PLLSR+YRDDIPL+AIDKF +LL+DLEE+S++IPPCL +N  +YLFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+YLVAI   L  N A +F FL+K+++VL DYLKTVEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQ                RPP ALT+SVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQL--------- 231
           DIVESINMLMTQKGQ+LRSEI+G VK+ S+LSGMPDLKLGINDKGIFSK L         
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 232 ----TEDD------------TNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPP 275
               T D+            T+++  SK++  IELEDLKFHQCVRLSKFE EKIITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 276 DGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPE 335
           DG F+LMNYRLST+IKPLIWCD+NVQVHSNSRIEIHC+AKAQIK+KSTATNVEILIPVP+
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 336 DADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQN---- 391
           DADTP FKYSHGS+K+VPEKSAILWK+RSFPGGKEYSM+AEL LPS S+ ++  +     
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 392 -----KKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
                K PVQ+KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/443 (75%), Positives = 382/443 (86%), Gaps = 2/443 (0%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M S IYFCDIKGRP+LSR+YRDDIPL+AID+FA LLADLEEESSVIPPCL +   QYLFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           +H D+Y+VA++  L TN A+VF FL+K+++ LGDYLKTVEEES+RDN+VIIYELLDE+MD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQ                RPP+ LT+SVSWR++GI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA 240
           DIVESINM+M Q+GQ+LRSEI+G V ++SRLSGMPDLKLGINDKGIF++   E   +   
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTRD-PETGESQVT 239

Query: 241 TSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNV 300
             KK++  ELEDLKFHQCVRLSKFE EKIITFIPPDG+FELM+YRL+T +KPLIWCD+NV
Sbjct: 240 AGKKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTTPVKPLIWCDVNV 299

Query: 301 QVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILW 360
           QVHS SRIEIHCRAKAQIKKKS A NVEILIPVP+DADTP+F+YSHGSIKWVPEK+AILW
Sbjct: 300 QVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILW 359

Query: 361 KIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPK 420
           KIRSF GGKEYSMAA++ LPS +   E+ + K+PVQVKFQIPYFTTSGIQVRYLKINEPK
Sbjct: 360 KIRSFYGGKEYSMAAQMGLPSING-VEKPKFKRPVQVKFQIPYFTTSGIQVRYLKINEPK 418

Query: 421 LQYKSYPWVRYITQSGDDYTIRL 443
           LQYKSYPWVRYITQ+GDDYTIRL
Sbjct: 419 LQYKSYPWVRYITQNGDDYTIRL 441

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/475 (72%), Positives = 389/475 (81%), Gaps = 32/475 (6%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MASA+YFCD  G+PLLSR+YRDDIPL+AIDKF +LL+DLEE+S++IPPCL +N  +YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+YLVAI   LR N A +F FL+K+++VL DYLKTVEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQI ETKMLKQYITQ                RPP ALT+SVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDD----- 235
           DIVESINMLMTQKGQ+LRSEI+G VK+ S+LSGMPDLKLGINDKGIFSK L +D      
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 236 ----TNNNATS--------------KKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDG 277
               T++N T               K++  IELEDLKFHQCVRLSKFE EKIITFIPPDG
Sbjct: 241 TSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 278 DFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDA 337
            F+LMNYRLST+IKPLIWCD+NVQVHSNSRIEIHC+AKAQIK+KSTATNVEI+IPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360

Query: 338 DTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSS---------KSEE 388
           DTP FKYSHGS+K+VPEKSAILWK+RSFPGGKEYSM+AEL LPS S+         KS  
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420

Query: 389 VQNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
              K PVQ+KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/447 (74%), Positives = 383/447 (85%), Gaps = 5/447 (1%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MAS IYFCD KG+ +LSR+Y+DDIP  AIDKF  LL + E+ESSVIPPCL +N  QYLF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+Y++ +T  L TN+A++FAFLYK+++VL +Y+K VEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQ                RPP ALT+SVSWR EGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLT---EDDTN 237
           D+VESINML+TQ+GQ+LRSEILG VK+KS LSGMPDLKLG+NDKGIFS  ++   ED+ +
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240

Query: 238 N-NATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWC 296
           + +AT KK+  IELEDLKFHQCVRLSKFE EKIITFIPPDGDFELM+YRL+T IKPLIWC
Sbjct: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300

Query: 297 DMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKS 356
           D+ +QVHS SRIE+HCRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHGSIKW PEK+
Sbjct: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360

Query: 357 AILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKI 416
           AILWKI+SFPGGKEYSMAA+L LPS S   E V  K+PVQVKFQIPYFTTSGIQVRYLKI
Sbjct: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVM-KRPVQVKFQIPYFTTSGIQVRYLKI 419

Query: 417 NEPKLQYKSYPWVRYITQSGDDYTIRL 443
           NEPK+QY+SYPWVRYITQSGDDYTIR+
Sbjct: 420 NEPKMQYQSYPWVRYITQSGDDYTIRM 446

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/461 (72%), Positives = 388/461 (84%), Gaps = 19/461 (4%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MASA+YFCD KG+PLLSR+Y+DD+PL+AIDKF++LL DLE+ES+VIPPC+ +N  +YLFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+Y+VA+   L  NIAEVFAFL+K++ VLG+YLKTVEEESIRDN+VIIYEL+DE+MD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQ                RPPS L +SVSWR+EGIKYKKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTN--- 237
           DIVESINML+TQKGQ+LRSEI+G VKIKSRLSGMPDLKLGIND+GIF+K L  ++     
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 238 ---------------NNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELM 282
                           N   K++  IELEDLKFHQCVRLSKFE EKIITFIPPDG+F+LM
Sbjct: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300

Query: 283 NYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNF 342
           NYRL+TSIKPLIWCD+++QVHS SRIEI CRAKAQIKKKS A NV+ILIPVP+DADTP+F
Sbjct: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360

Query: 343 KYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIP 402
           KYSHGSIK+VPE+SAILWKI+SFPGGKEY+M AE+ LPS  S  EE + K+PVQVKF+IP
Sbjct: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDS-YEEPKVKRPVQVKFEIP 419

Query: 403 YFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
           YFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR+
Sbjct: 420 YFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/451 (73%), Positives = 381/451 (84%), Gaps = 10/451 (2%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M S +YFCD  G+P+LSR+YRDDIPL+AIDKF+ +L + EEESSV+PPCL Y    YLFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QHSDIY+VA+T   +TNIA++F FL++++ VLGDYLK+VEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQ                RPP ALT+SVSWR EGIKYKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDD----- 235
           DI+ESINMLM Q+GQ+LRSEI+G VK+KSRLSGMPDLKLGINDKGIFSK L  ++     
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240

Query: 236 ----TNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK 291
                +++ T+ K++ IELEDLKFHQCVRLSKFE EKIITFIPPDG+FELMNYRL+T IK
Sbjct: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300

Query: 292 PLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKW 351
           PLIWCD+N+QVHS SRIEIHCRAKAQIKKKS A NVEILIPVP+DADTP FKYSHGSIKW
Sbjct: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360

Query: 352 VPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQV 411
           +PEK+AILWK+RSF GGKEYSM A+L LPS     E  + K+PVQ+KFQIPYFTTSGIQV
Sbjct: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDG-IEPPKVKRPVQIKFQIPYFTTSGIQV 419

Query: 412 RYLKINEPKLQYKSYPWVRYITQSGDDYTIR 442
           RYLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 420 RYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/468 (72%), Positives = 387/468 (82%), Gaps = 26/468 (5%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M S+I FCD KG+ LLSRKYRDDIPLTAID FA+LL  LEEESSV+PPCLT+N   YLFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+Y+VA+T  L TN ++VF FL+K+++V+ +YLK VEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQ                RPP ALT+SVSWR EGIKYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQL--------- 231
           DIVESINMLMTQ+GQ+LRSEI+G VK++SRLSGMPDLKLGINDKGIFSK L         
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 232 -----TEDDTNNNAT-----------SKKQNKIELEDLKFHQCVRLSKFETEKIITFIPP 275
                 E +++ ++T           S+K + +ELEDLKFHQCVRLSKFE EKIITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 276 DGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPE 335
           DG+FELM+YRL+T IKPLIWCD+N+ VHS SR+EIHCRAKAQIKKKS A NVEILIPVP+
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 336 DADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPV 395
           DADTP+F+YSHGSIKWVPEK+AILWKIRSF GGKEYSMAA+L LPS    +E+ + K+PV
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDD-NEKPKLKRPV 419

Query: 396 QVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
           Q+KFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 420 QIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/455 (72%), Positives = 380/455 (83%), Gaps = 12/455 (2%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MASAIYFCD KGRPLLSRKYRDDIP +AID+F  LL++ EEE+++IPPC+ +N  Q+LFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+YLVAI   +  N A +F+FL+K+I+VL +YLK VEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITE KMLKQYITQ                RPP++LT+SVSWR EGIK+KKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTN--- 237
           DI+ESINMLMTQKGQ+LRSEI+G VK+KS+LSGMPDLKLGINDKG+FSK L  D+     
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 238 ---------NNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLST 288
                    +    K+ N +ELEDLKFHQCVRLSKFE EK ITFIPPDGDFELM+YRLST
Sbjct: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300

Query: 289 SIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGS 348
           +IKPLIWCD+N++ HS SRIEI CRAKAQIKKKSTATNVEILIPVPEDADTP FKYSHGS
Sbjct: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360

Query: 349 IKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSG 408
           IK+VPEK+AILWKIR+FPG KEYSMAAE+ LPST++  E  + K+PVQVKFQIPYFTTSG
Sbjct: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420

Query: 409 IQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
           IQVRYLKI E  LQYKSYPWVRYIT+SGDDYTIRL
Sbjct: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRL 455

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/446 (72%), Positives = 381/446 (85%), Gaps = 4/446 (0%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M SA+YFCD KGRP+LSR+YRDDIP++AIDKFA LL  LEEESSVIPPCL+++  QYLFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+Y+VA+   L TN+A+VFAFL+K+++VL +YLK+VEEES+RDN++IIYELLDE+MD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQ                RPP+ +T+SVSWR+  I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDD---TN 237
           DIVESINMLM Q+GQ+LRSEI+G +K+KS+LSGMPDLKLGINDKGIFSK +  D    T 
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT 240

Query: 238 NNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCD 297
                KK+  IELEDLKFHQCVRLSKFE EKIITFIPPDG FELMNYRLS  +KPLIWCD
Sbjct: 241 AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD 300

Query: 298 MNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSA 357
           +NVQVHS SRIEIHCRA+AQIKK+S A +VEILIPVP+DADTP+FKY+HGS+KWVP+K+A
Sbjct: 301 VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360

Query: 358 ILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKIN 417
           ILWKIRSF GGKEYSM+A++ LPS ++  ++ + K+PVQ+KFQIPYFTTSGIQVRYLKI 
Sbjct: 361 ILWKIRSFTGGKEYSMSAQMGLPSINA-LDKPKVKRPVQIKFQIPYFTTSGIQVRYLKIT 419

Query: 418 EPKLQYKSYPWVRYITQSGDDYTIRL 443
           EPKL YKSYPWVRYITQSGDDYTI+L
Sbjct: 420 EPKLLYKSYPWVRYITQSGDDYTIKL 445

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/468 (69%), Positives = 389/468 (83%), Gaps = 28/468 (5%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MASA+YFCD KG+PLLSRKYRDDIPL+AIDKF+SLL+D EEES+++PPC+++N  QY+FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+YL A+   ++ NI+ +FAFL+KIIDVL  YLKTVEEESIRDN++IIYELLDE+MD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YG+PQITETKMLK+YIT                 RPP+ LT+SVSWR EGIKYKKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLT-------- 232
           DI+ESINML+TQKGQ+LRSEI+G V++KSRLSGMPDLKLGIND+GIF+K L         
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAK 240

Query: 233 ------EDDTNNNA------TSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFE 280
                  DDTNN +      ++K++  IELEDLKFHQCVRLSKFE EKII+FIPPDG+F+
Sbjct: 241 NGDDEDADDTNNESSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGEFD 300

Query: 281 LMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTP 340
           LMNYRLSTSIKPLIWCD+++Q +   RIEIHC+AKAQIKKKS ATNVEILIPVPEDAD+P
Sbjct: 301 LMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDADSP 357

Query: 341 NFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSE-----EVQNKKPV 395
            FKYSHG IK++PEK+ +LWKI SFPGGKEYSMAA++ LPS S + +       Q+KKPV
Sbjct: 358 IFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPV 417

Query: 396 QVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
           QVKF+IPYFTTSGIQVRYLK+NEPKLQYK+YPWVRYITQSGDDYTIR+
Sbjct: 418 QVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/442 (72%), Positives = 376/442 (85%), Gaps = 3/442 (0%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MAS IYFCD KG+ +LSR+YRDD+P +AI+KF SLL + E+ESS++PPCLT+N  QYLFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+DIY++ ++  L  N+A+VF+FLYK+++VL +Y+KTVEEESIRDN+VIIYELLDE++D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQ                RPPS LT SVSWR EGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA 240
           D+ ESINML+T  GQ+LRSEILG V ++SRLSGMPDLKLG+NDKGIF+   +   +++ A
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVESA--SSSEA 238

Query: 241 TSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNV 300
           T  K++ IELEDLKFHQCVRLSKFE EKIITFIPPDGDFELMNYRLST IKPLIWCD  +
Sbjct: 239 TEGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLSTPIKPLIWCDAKI 298

Query: 301 QVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILW 360
           QVHS SRIEIHCRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHGS+K+VPEKSAILW
Sbjct: 299 QVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILW 358

Query: 361 KIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPK 420
           KI++F GGKEYS AA+L LPS +  +E  + K+P+QVKFQIPYFTTSGIQVRYLKINEPK
Sbjct: 359 KIKTFNGGKEYSFAAQLGLPSMTD-AEVPRAKRPIQVKFQIPYFTTSGIQVRYLKINEPK 417

Query: 421 LQYKSYPWVRYITQSGDDYTIR 442
           LQY+SYPWVRYITQSGDDYTIR
Sbjct: 418 LQYQSYPWVRYITQSGDDYTIR 439

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/442 (71%), Positives = 373/442 (84%), Gaps = 3/442 (0%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MAS IYFCD  G+ +LSR+YRDD+P +AI++F +LL + E+ESSV+PPCLT+N  QY+FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+DIY++ ++  L  N+A+VF+FLYK+++VL +YLKTVEEESIRDN+VIIYELLDE++D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           YGIPQITETKMLKQYITQ                RPP+ LT SVSWR EGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA 240
           D+ ESINML+T  GQ+LRSEILG VK++SRLSGMPDLKLG+NDKGIF+ +  E   N   
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTSE--EGGNNAEG 238

Query: 241 TSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNV 300
            S K++ IELEDL+FHQCVRLSKFE EKII+FIPPDGDF+LMNYRLST IKPLIWCD  +
Sbjct: 239 GSGKKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAKI 298

Query: 301 QVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILW 360
           QVHS SRIEIHCRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHGS+K+VPEKSAILW
Sbjct: 299 QVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILW 358

Query: 361 KIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPK 420
           +I++F GGKEYS AA+L LPS +   E  + K+P+QVKFQIPYFTTSGIQVRYLK++EPK
Sbjct: 359 RIKTFNGGKEYSFAAQLGLPSMTD-VEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPK 417

Query: 421 LQYKSYPWVRYITQSGDDYTIR 442
           LQY+SYPWVRYITQSGDDYTIR
Sbjct: 418 LQYQSYPWVRYITQSGDDYTIR 439

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/444 (70%), Positives = 379/444 (85%), Gaps = 2/444 (0%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M S IYFCD KG+ LLSR+Y+DDIP  AI++F  LL + E+ESSV+PPC ++N  QYLFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+Y++ +T  +  N+A+VF++L+K+I+VL +Y+K VEEESI+DN+VIIYELLDE+MD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
           +GIPQIT+TKML+QYITQ                RPP+ LT+SVSWR EGI YKKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNN-N 239
           D+VESINML+TQ+GQ+LRSEILG VK+KSRLSGMPDLKLG+NDKGIF++   +DD    +
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDEEGAS 240

Query: 240 ATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMN 299
             +KK++ IELEDLKFHQCVRL+KFE EKIITFIPPDGDFELM+YRLST IKPLIWCD+ 
Sbjct: 241 GGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVK 300

Query: 300 VQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAIL 359
           +QVHS SRIEIHCRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHG+IKWVP ++AIL
Sbjct: 301 LQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAIL 360

Query: 360 WKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEP 419
           WKI+SFPGGK+YSMAAE+ LPS S  S+  + K+PVQ+KFQIPYFTTSGIQVRYLKINEP
Sbjct: 361 WKIKSFPGGKDYSMAAEMGLPSVSDNSDH-KLKRPVQIKFQIPYFTTSGIQVRYLKINEP 419

Query: 420 KLQYKSYPWVRYITQSGDDYTIRL 443
           K+QY SYPWVRYITQSGDDYTIR+
Sbjct: 420 KMQYNSYPWVRYITQSGDDYTIRM 443

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/446 (69%), Positives = 379/446 (84%), Gaps = 4/446 (0%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M+S IYFCD KG+ LLSR+Y+DDIP++AI++F  LL + E+ES+VIPPC ++N  QYLFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           QH+D+Y++ +T  +  N+A+VF+FL+ ++DVL +Y+K VEEESI+DN+VIIYELLDE+MD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQ                RPPS+LT +VSWR EGIKYKKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDD---TN 237
           D++ESINM+MTQ+GQ+LRSEILG VK++SRLSGMPDLKLG+NDKGIF++   E++   ++
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEEEDEPSS 240

Query: 238 NNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCD 297
             + ++K++ IELEDLKFHQCVRLSKFE EKIITFIPPDGDFELM+YRLST IKPLIWCD
Sbjct: 241 QPSITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300

Query: 298 MNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSA 357
             +QVHS SR+E+HCRAKAQIK KSTA NVEILIPVP DAD+P F+YSHGSIKWVPEK+A
Sbjct: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360

Query: 358 ILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKIN 417
           ILWKI+SFPGGK+YSMAAE+ LPS +  + +   K+PVQ+KFQIPYFTTSGIQVRYLKIN
Sbjct: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIA-DYNFKRPVQIKFQIPYFTTSGIQVRYLKIN 419

Query: 418 EPKLQYKSYPWVRYITQSGDDYTIRL 443
           EPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 420 EPKLQYNSYPWVRYITQSGEDYIIRM 445

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/453 (69%), Positives = 377/453 (83%), Gaps = 11/453 (2%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M S IYFCD  G+P+L+R+YRDDI + AID F+ LL  LEEE+ VIPPC+ +    YLFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           +HSDIY+VA+T   +TN+A++F FL+++++VL +Y+K V EES+RDN+VIIYELLDE+MD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXX--XXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEA 178
           +GIPQITETKMLK+YITQ                  RPP+ LT+SVSWR EGI YKKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNN 238
           FLDI+ESINML+TQ+GQ+LRSEI+G V+++SRLSGMPDLKLGIND+GIFS  L E++ + 
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240

Query: 239 NATSK--------KQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSI 290
           +++S         K+ +IELEDLKFHQCVRLSKFE EKIITFIPPDG+F+LMNYRL+T I
Sbjct: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300

Query: 291 KPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIK 350
           KPLIWCD+N+QVHS SRIEIHCRAKAQIKKKS A NVEILIPVP+DADTP F+YSHGSIK
Sbjct: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360

Query: 351 WVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQ 410
           W+PEK+AILWK+RSF GGKEYSM+A+L LPS     E  + ++PVQVKFQIPYFTTSGIQ
Sbjct: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDG-VEPPKVRRPVQVKFQIPYFTTSGIQ 419

Query: 411 VRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
           VRYLK+NEPKLQYKSYPWVRYITQSG+DYTIRL
Sbjct: 420 VRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/444 (69%), Positives = 367/444 (82%), Gaps = 2/444 (0%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           MAS + FCD KG+PLLSR+Y+DD+  +A++ F  LL + E+ESSV+PPC  +N   Y+++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
           Q++D+Y++A+T  +  N   +FAF+YK+I+V+ +Y+K VEEESIRDNY+IIYELLDE+MD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFL 180
            G+PQ+TETKMLKQYITQ                RPP+ LT+SVSWR EGIKYKKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA 240
           D++ESINMLMTQ+GQ+LRSEILG VK++SRLSGMPDLKLG+NDKGIF+    ED      
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240

Query: 241 TSKKQN-KIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMN 299
           +SKK+N  IELEDLKFHQCVRLSKFE EKIITFIPPDG+F+LM YRLST IKPLIWCD+ 
Sbjct: 241 SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVK 300

Query: 300 VQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAIL 359
           VQVHS SRIEIHCRAKAQIKKKS A NVEILIP+PEDAD+P FKYS G+IKWVPEK+AIL
Sbjct: 301 VQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAIL 360

Query: 360 WKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEP 419
           WK  SF GGKEYSMAA+L LPS S  +E  + K+PVQ+KFQIPYFTTSGIQVRYLKI EP
Sbjct: 361 WKFSSFQGGKEYSMAAQLGLPSVSD-AEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEP 419

Query: 420 KLQYKSYPWVRYITQSGDDYTIRL 443
           KLQY SYPWVRYITQSGDDYTIRL
Sbjct: 420 KLQYNSYPWVRYITQSGDDYTIRL 443

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  222 bits (566), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 148/474 (31%), Positives = 242/474 (51%), Gaps = 43/474 (9%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKF-ASLLADLEEESSVIPPCLTYNNTQYLF 59
           M SA++    +G  ++S+  +D+I L   + F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQ-HSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDEL 118
           I+ +  ++LV ++    T+ A ++ FLY    +L  Y     E+S++ ++++ YE+LD +
Sbjct: 57  IRSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIV 114

Query: 119 MDYGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRPPSALT----------------- 161
           +D GIP+ TE   +  YI++                  PS L                  
Sbjct: 115 LDNGIPRDTELTHIMPYISKKPLSENLLGSDDIL--NTPSWLVKAGARGMSSENLGLTSK 172

Query: 162 DSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGI 221
           D   WRSEGI+YKKNE +LD+ E I++L+ + G IL+S + G V+  + LSGMP  + G 
Sbjct: 173 DMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGF 232

Query: 222 NDKGIFSKQLTEDDTNNNATSKKQN-----------KIELEDLKFHQCVRLSKFETEKII 270
           ND    S       + N+  ++++N            + LED KFHQCV+L KF+ E++I
Sbjct: 233 ND--YLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVI 290

Query: 271 TFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEIL 330
            F+PPDG FELM Y +  ++         V       +E     K+    K  A +VE+ 
Sbjct: 291 RFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELY 350

Query: 331 IPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQ 390
           IP P D        S G  K++PE++AI+WKI  + G  E   +A +      + S  ++
Sbjct: 351 IPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLE 410

Query: 391 --NKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 442
             ++ P+ V+F+I  F+ SG+ VRYLK+ E  L Y +  WV+YI++SG  Y +R
Sbjct: 411 QWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  218 bits (556), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 148/474 (31%), Positives = 248/474 (52%), Gaps = 41/474 (8%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59
           M SA++   ++G  L+S+  R  +P +  + F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQH-SDIYLVAITNLLRTNI--AEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116
           ++   ++++VA++   R+N   A ++ FLYK+  +L  +    E E ++++++  YELLD
Sbjct: 57  VKSPGNLWIVAVS---RSNADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLD 112

Query: 117 ELMDYGIPQITE-----TKMLKQYITQXXXXXXXXXXXXXXXXR------------PPSA 159
            +++ G+P  TE     +KM  +                    R              S 
Sbjct: 113 IVLEDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSN 172

Query: 160 LTDS-------VSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLS 212
           L DS       + WR  GIKYKKNE FL++ E I++L+++ G IL+S + G V+  + LS
Sbjct: 173 LHDSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLS 232

Query: 213 GMPDLKLGINDKGIFSKQLTEDD---TNNNATSKKQ-NKIELEDLKFHQCVRLSKFETEK 268
           GMP  + G+ND    S    +++   TN  A  K     + LED KFHQCV+L KF++E+
Sbjct: 233 GMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSER 292

Query: 269 IITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVE 328
            I FIPPDG FELM Y +  ++         V +   + I+     K+    K TA +V+
Sbjct: 293 TINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQ 352

Query: 329 ILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEE 388
           + IPVP +    +   S+G  K+VPE+SAI+WK   + G  E S++A       S+ + +
Sbjct: 353 LRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSALNID 412

Query: 389 VQNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 442
             +K P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y+++SG  Y +R
Sbjct: 413 QWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  217 bits (552), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 150/476 (31%), Positives = 251/476 (52%), Gaps = 44/476 (9%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59
           M +A++   ++G  L+S+  +  +  +  + F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQHS-DIYLVAITNLLRTNI--AEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116
           I+ + ++++VA++   R+N   A ++ FLY++ ++L +      E  +++ ++I YELLD
Sbjct: 57  IKSAKNLWIVAVS---RSNADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLD 112

Query: 117 ELMDYGIPQITE-----TKM----------LKQYITQXXXXXXXXXXXXXXXXRPPSA-- 159
            +++ G+P  TE     +KM             +                     PSA  
Sbjct: 113 IVLEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGN 172

Query: 160 LTD-------SVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLS 212
           L D       ++ WR  GIKYKKNE FL++ E I++L+++ G IL+S + G V+  + LS
Sbjct: 173 LQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLS 232

Query: 213 GMPDLKLGINDKGIFSKQLTEDD----TNNNATSKKQ-NKIELEDLKFHQCVRLSKFETE 267
           GMP  + G+ND    S    +DD    TN  A  K     + LED KFHQCV+L KF++E
Sbjct: 233 GMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSE 292

Query: 268 KIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATN 326
           + I FI PDG FELM Y +  ++  P     +   V SNS I+     K+    K TA +
Sbjct: 293 RTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPSKLTAKD 351

Query: 327 VEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKS 386
           V++ IPVP +  + +   S+G  K+VPE+SAI+WK   + G  E S++A       S+ +
Sbjct: 352 VQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTLN 411

Query: 387 EEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 442
            E   + P+ +KF+I  F+ SG+ VR+  ++E    YK   W++Y+++SG  Y +R
Sbjct: 412 IEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  215 bits (547), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 154/491 (31%), Positives = 250/491 (50%), Gaps = 59/491 (12%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59
           M +A++    KG  ++S+  RD I  +  + F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQHS-DIYLVAITNLLRTNI--AEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116
           I+ S ++++VA+T   R+N   A ++ FLYK   +L  Y     EES+++ ++  YELLD
Sbjct: 57  IRSSSNLWIVAVT---RSNADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLD 112

Query: 117 ELMDYGIPQITE-----TKMLKQYITQXXXX------XXXXXXXXXXXXRPPSALTDSVS 165
            +++ G+P  TE     +KM ++ +                        R P  L     
Sbjct: 113 VVLENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSR 172

Query: 166 ---------------------WRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGV 204
                                WRS GIKYKKNE FLD+ E IN+L+++ G IL+S + G 
Sbjct: 173 SSSSVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGS 232

Query: 205 VKIKSRLSGMPDLKLGINDK-----GIFSKQL---TEDDTNNNATSKK--QNKIELEDLK 254
           V + + LSG P  + G+ND      G  S+ L   +E +  N     K     ++LED K
Sbjct: 233 VDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCK 292

Query: 255 FHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHSNSRIEIHCR 313
           FHQCV+L++F T++II F+PPDG FELM Y +  ++  P     +     +N  +E    
Sbjct: 293 FHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVA 352

Query: 314 AKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSM 373
            K+    K TA +V + IPVP          S+G  ++VPE++A+LWK   + G  E ++
Sbjct: 353 LKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTL 412

Query: 374 AAELCLPSTSSKSEEVQ--NKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRY 431
           +A L +P  +  S  +Q  ++ P+ + F+I  F+ SG+ VR+ K++E    Y +  WV+Y
Sbjct: 413 SA-LTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471

Query: 432 ITQSGDDYTIR 442
           I++SG  Y +R
Sbjct: 472 ISRSG-AYEVR 481

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  204 bits (520), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 140/482 (29%), Positives = 243/482 (50%), Gaps = 48/482 (9%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNT--QYL 58
           M SAI+  + KG  L+S+  +D +  +  D F + + +   +  V  P LT  +T  Q++
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVIN---DPHVRSPILTLGSTTFQHV 57

Query: 59  FIQHSD---IYLVAIT--NLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYE 113
             + SD   ++LVA++  N+  + I E    LY++++  G      +E+ ++D ++++YE
Sbjct: 58  IRESSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFG----INDEDVLKDEFMLLYE 113

Query: 114 LLDELMDYGIPQITETKMLKQYITQXXXXXXXXXXX--------XXXXXRPP-------- 157
           +L+  ++ GIPQ T+   +   +++                        + P        
Sbjct: 114 ILELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSS 173

Query: 158 ---SALTDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGM 214
               +      WR  G+KYKKNE +LDI E I +L+ + G I++S + G V   S LSGM
Sbjct: 174 SIALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGM 233

Query: 215 PDLKLGIND--------KGIFS--KQLTEDDTNNNAT--SKKQNKIELEDLKFHQCVRLS 262
           P  +LG+ND        K   S  + ++E D  N     +     + LED KFHQCV+L+
Sbjct: 234 PLCQLGLNDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQLN 293

Query: 263 KFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKS 322
           K+E   +I F+PPDG F+LM YR+  +I         V++  NS +      ++      
Sbjct: 294 KYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNV 353

Query: 323 TATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPST 382
           +A +V + IPVP      +F  S G  K+   +  ++WK   + G  E +++ ++ +P+T
Sbjct: 354 SAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPAT 413

Query: 383 SSKSEEV--QNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 440
           S    ++   ++ P+ + F+I  F+ SG+ VR+LK  EP+L Y+   W++YI+ SG  Y 
Sbjct: 414 SHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG-AYE 472

Query: 441 IR 442
           IR
Sbjct: 473 IR 474

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  199 bits (507), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 146/489 (29%), Positives = 244/489 (49%), Gaps = 55/489 (11%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59
           M SAI     +G  ++++  +  +  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHS---DIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116
           I+      ++LVA++     N   ++ FLYK+ +V+ D     +E ++++N++  YE+LD
Sbjct: 57  IRSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILD 114

Query: 117 ELMD-YGIPQITE-----TKML----KQYITQXXXXXXXXXXXXXXXXRP---------P 157
            +++  GIP  TE     +KM     KQ                     P         P
Sbjct: 115 TVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMP 174

Query: 158 SALT---------------DSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEIL 202
             LT                ++SWR  GIKYKKNE  L++ E I++L+++ G IL+S + 
Sbjct: 175 KFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234

Query: 203 GVVKIKSRLSGMPDLKLGINDK-----GIFSKQLTEDDTNNNATSK-KQNKIELEDLKFH 256
           G + + + LSGMP  + G+ND      G  S    ED  N  A  K    ++ LED KFH
Sbjct: 235 GTIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFH 294

Query: 257 QCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHSNSRIEIHCRAK 315
           QCV L KF  +++I F+PPDG  ELM Y +  ++  P     +   +   + I+     K
Sbjct: 295 QCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLK 354

Query: 316 AQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAA 375
           +    K +A +V + IPVP          S+G  K+VPE+SA++WK   + G  E +++A
Sbjct: 355 SLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSA 414

Query: 376 ELCLPSTSSKSEEVQN--KKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYIT 433
            + +PS+ +    VQ   + P+ + F+I  F+ SG+ VRY K+++   +Y++  W++YI+
Sbjct: 415 -VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYIS 473

Query: 434 QSGDDYTIR 442
           +SG  Y IR
Sbjct: 474 KSG-SYEIR 481

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  198 bits (504), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 140/500 (28%), Positives = 249/500 (49%), Gaps = 68/500 (13%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59
           M +A+     +G  ++S+ ++  +  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHS---DIYLVAITNLLRTNI--AEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYEL 114
           I+ +   ++++VA++   R N+  A ++ FLYK+ D L D      EE +++ ++I++EL
Sbjct: 57  IKSTRGDNLWIVAVS---RNNVDSAAIWEFLYKL-DSLLDSYGLNHEEYLKEEFMIVHEL 112

Query: 115 LDELM--DYGIPQITETKMLKQYITQXXXXXXXXXXXX---------------------- 150
           LD +M    GIP +TE  ++   ++                                   
Sbjct: 113 LDVMMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMS 172

Query: 151 --XXXXRPPSALTDSVS------WRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEIL 202
                 R  ++L+  +S      WR +GI +KKNE  L + E IN+L+++ G +L++ + 
Sbjct: 173 GPKLLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVD 232

Query: 203 GVVKIKSRLSGMPDLKLGINDK-----------GIFSKQLTEDDTNNNATSKKQ------ 245
           G + +++ LSG P  + G+ND            G  +      D N + T KKQ      
Sbjct: 233 GSIDLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASV 292

Query: 246 NKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHS 304
             + LED KFHQCV L KF+ ++II F+PPDG  ELM Y +  ++  P     +     +
Sbjct: 293 GSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRN 352

Query: 305 NSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRS 364
            + +E     K+    + +A NV + IPVP +        ++GS K++PE+SA++W+   
Sbjct: 353 GTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNK 412

Query: 365 FPGGKEYSMAAELCLPSTSSKSEEVQ--NKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQ 422
           F G  E +++A + +P+  +    +Q  +K P+ + F+I  F+ SG+ VRY  I E   +
Sbjct: 413 FNGLTENTLSA-VTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQK 471

Query: 423 YKSYPWVRYITQSGDDYTIR 442
           YK+  W++YI++SG  Y IR
Sbjct: 472 YKAVKWIKYISRSG-SYEIR 490

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  190 bits (482), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 145/489 (29%), Positives = 242/489 (49%), Gaps = 62/489 (12%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59
           M SA+     +G  ++S+ +++++  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS----PILTLGSTTFQH 56

Query: 60  IQHS----DIYLVAITNLLRTNI--AEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYE 113
           I+ +    D++LV++T   R+NI    V+ FLYK   +L  Y     EE +++ +++ YE
Sbjct: 57  IRSNVHGDDLWLVSVT---RSNINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYE 112

Query: 114 LLDELM-DYGIPQITE-------------TKMLKQYITQXXXXXXXXXXXXXXXXRPPSA 159
           LLD ++ + G P  T+              + ++ +                   R  S 
Sbjct: 113 LLDVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSF 172

Query: 160 LTDSVS--------------WRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVV 205
           L    S              WR +GI +KKNE FL + E I++L++++G IL+S + G +
Sbjct: 173 LNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTI 232

Query: 206 KIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNK---------IELEDLKFH 256
            + + LSG P  + G+ND    S  +  DD  ++    K  K         + LED KFH
Sbjct: 233 DLVTHLSGTPVCQFGLND----SLSVKNDDYGDSFDYIKNKKAIPKAAAGSVLLEDCKFH 288

Query: 257 QCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHSNSRIEIHCRAK 315
           QCV L KF+ ++II F+PPDG  ELM Y + ++I  P     +     S + +E     K
Sbjct: 289 QCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLK 348

Query: 316 AQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAA 375
           +    K TA NV + IPVP +        S+GS K+ PE+ A+LW    + G  E +++A
Sbjct: 349 SLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSA 408

Query: 376 ELCLPSTSSKSEEVQ--NKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYIT 433
            + + S  +    +Q   K P+ + F+I  F+ SG+ VRY  I E + +YK+  W+RY++
Sbjct: 409 -VTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVS 466

Query: 434 QSGDDYTIR 442
           +SG  Y IR
Sbjct: 467 KSG-SYEIR 474

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  188 bits (478), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 134/489 (27%), Positives = 239/489 (48%), Gaps = 56/489 (11%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M +A+     +G  L+ + ++  +  T  D F      +    ++  P LT  +T + FI
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFR---VQVINNDNIRSPILTLGSTTFHFI 57

Query: 61  Q---HSDIYLVAITNLLRTNI--AEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELL 115
           +    S ++LVA+T   R+N     ++ +LYK+  ++  Y  T  E+ ++D +++ +ELL
Sbjct: 58  RTTAGSKLWLVAVT---RSNADSGAIWEYLYKLNSLMEVYGLT-HEDILKDEFIVCHELL 113

Query: 116 D-ELMDYGIPQITE----------------------TKMLKQYITQXXXXXXXXXXXXXX 152
           D  L   G+P  TE                      + +L   +T               
Sbjct: 114 DITLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFL 173

Query: 153 XXRPPSALT---------DSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILG 203
                 ++T          ++ WRS  IKYKKNE  ++++E IN+L+ +   ILR+ + G
Sbjct: 174 SRNSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDG 233

Query: 204 VVKIKSRLSGMPDLKLGIND----KGIFSKQLTEDDTNNNATSK---KQNKIELEDLKFH 256
            + I + LSGMP  ++G+ND    +G  +   T +D  +N  +      +++ LE  KFH
Sbjct: 234 TIDITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSGDRVILEGSKFH 293

Query: 257 QCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSN-SRIEIHCRAK 315
           QCV L K+  + +I FIPPDG FELM Y +S ++         V + S+ + +    + K
Sbjct: 294 QCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAIKLK 353

Query: 316 AQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAA 375
           +   +K +A NV + IPVP          S G  K++PE++ ++W    F G  E  + A
Sbjct: 354 SLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHLNA 413

Query: 376 ELCLPSTSSKSEEVQ--NKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYIT 433
           +  +P+ S  S+ ++   + P+ + F++  F+ +G+ VRYLK+ E  + Y +  W++YI+
Sbjct: 414 Q-TVPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKYIS 472

Query: 434 QSGDDYTIR 442
            +G  Y +R
Sbjct: 473 AAG-SYEVR 480

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  186 bits (473), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 141/494 (28%), Positives = 237/494 (47%), Gaps = 59/494 (11%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59
           M + I     +G  ++S+ ++  +  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHS----DIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELL 115
           I+ S    +++LVA T     N A ++ FLYK+  +L +Y    +EE +++ ++I++ELL
Sbjct: 57  IRSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELL 114

Query: 116 DELMDY-GIPQITE-----TKM------LKQYITQXXXXXXXXXXXXXXXXRP------- 156
           D ++   GIP  TE      KM      L    T                  P       
Sbjct: 115 DVMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRND 174

Query: 157 PSALTDS------VSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSR 210
            S   DS       SWR + IK+KKNE  L + E IN+L+ + G IL++ + G + +++R
Sbjct: 175 SSQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTR 234

Query: 211 LSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQN------------------KIELED 252
           LSG P  + G+ND        +E  + N  T   ++                   + LED
Sbjct: 235 LSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILED 294

Query: 253 LKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHSNSRIEIH 311
            KFHQCV L KF+ E+II F+PPDG  ELM Y +  ++  P     +     +   ++  
Sbjct: 295 CKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYR 354

Query: 312 CRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEY 371
              K+    + +A  V + IPVP      N   S+G+ K+VP ++A++WK   + G  E 
Sbjct: 355 IALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTEN 414

Query: 372 SMAAELCLPSTSSKSEEVQN--KKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWV 429
           +++A + +PS       +Q   + P+ + F+I  F+ SG+ VRY  I+E    YK+  W+
Sbjct: 415 TLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWI 473

Query: 430 RYITQSGDDYTIRL 443
           +Y+++SG  Y +R 
Sbjct: 474 KYVSKSG-SYEVRF 486

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  186 bits (472), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 139/483 (28%), Positives = 237/483 (49%), Gaps = 49/483 (10%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59
           M +AI+    +G  ++S+ + + +  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHSDIYLVAITNLLRTNI--AEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDE 117
           I+ +    + I  + RTN     ++ FLYK   +L  Y  T +EE ++++++I YE+LD 
Sbjct: 57  IRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115

Query: 118 LMDYG-IPQITETKMLKQYIT---QXXXXXXXXXXXXXXXXRPPSALTDS---------- 163
           ++  G IP  TE   +   I+                     P S L+ S          
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 164 ----------------VSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKI 207
                             WR  GIKYKKNE FL + E IN+L+++ G IL++ + G + +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 208 KSRLSGMPDLKLGINDKGI--FSKQL---TEDDTNNNATSK-KQNKIELEDLKFHQCVRL 261
            + LSG P  + G+ND     F   L   T++  N  A  K     + LED KFHQCV L
Sbjct: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295

Query: 262 SKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKK 321
            KF  E+II F+PPDG+ ELM Y +  ++  L +    V     S +E     K+    K
Sbjct: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLN-LPFKITPVVTPCGSTVEYRITLKSLFPNK 354

Query: 322 STATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPS 381
            +A +V + IPVP          S+G  K+  E++A++W+   + G  E +++A + +P+
Sbjct: 355 LSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA-VTVPT 413

Query: 382 TSSKSEEVQN--KKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDY 439
           + +    +Q   + P+ + F+I  F+ SG+ VRY ++++   +Y+   W++YI++SG  Y
Sbjct: 414 SDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSG-SY 472

Query: 440 TIR 442
            +R
Sbjct: 473 EVR 475

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  183 bits (465), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 115/383 (30%), Positives = 192/383 (50%), Gaps = 26/383 (6%)

Query: 48  PCLTYNNTQYLFIQHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDN 107
           P LT  +T +  I+ S    + +      + A ++ FLY +  +L  Y    EE ++ D+
Sbjct: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEE-ALLDD 103

Query: 108 YVIIYELLDELMDYGIPQITETKMLKQYITQX-XXXXXXXXXXXXXXXRPPSALTDSVS- 165
           +++ YELLD ++D G+PQ TE   +   +++                 R     T +VS 
Sbjct: 104 FMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSV 163

Query: 166 ------------WRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSG 213
                       WR EGIKYKKNE +LD++E +++L+ + G IL++ + G V+  + LSG
Sbjct: 164 ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSG 223

Query: 214 MPDLKLGINDKGIFSKQLTEDDTNNNATSK-----KQNKIELEDLKFHQCVRLSKFETEK 268
           MP    G ND    S+ L +         +     ++  + LED KFHQCV+L+KF+ E+
Sbjct: 224 MPLCHFGFND----SQSLRQRSPRRQYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQER 279

Query: 269 IITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVE 328
           +I F+PPDG+FELM Y +   ++P       V   +   IE     ++    K +A +VE
Sbjct: 280 VIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVE 339

Query: 329 ILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEE 388
           + IP P    +     S G  K+VPE++AI+WKI  F G  E +++A          ++ 
Sbjct: 340 LYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQV 399

Query: 389 VQN--KKPVQVKFQIPYFTTSGI 409
           +    + P+ +K +I  F+T+ +
Sbjct: 400 LDQWPRPPISMKLEIMMFSTAAL 422

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  182 bits (463), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 138/443 (31%), Positives = 217/443 (48%), Gaps = 61/443 (13%)

Query: 45  VIPPCLTYNNTQYLFIQHSD---IYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEE 101
           V  P LT  +T +  I+ +    ++LVA+T     N   ++ FLYK  D L +      E
Sbjct: 42  VRSPILTLGSTTFHHIRSNSRDHLWLVAVTRS-NANSGAIWEFLYKF-DSLLNAFGLDNE 99

Query: 102 ESIRDNYVIIYELLDELMDY-GIPQITE---------TKMLKQ----------------Y 135
            ++++ ++  YELLD +++  G+P  TE         TK L                   
Sbjct: 100 TTLKEEFMTCYELLDLMLNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLS 159

Query: 136 ITQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQ 195
           I++                 P      +  WR  GIKYKKNE FL+I E I++L+++   
Sbjct: 160 ISKFLNRNNRSMSVDTMNTEP-----SNYPWRPNGIKYKKNEIFLNINEKISILVSKDET 214

Query: 196 ILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTN-----NNATSKKQN---- 246
           IL++ + G V + S LSG P  + G+ND       L+ D+ N     +N    +QN    
Sbjct: 215 ILKAYVDGTVDLTSHLSGTPTCQFGLND------SLSVDEPNYYNSDDNGFRNQQNIPRA 268

Query: 247 ---KIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVH 303
               + LED KFH+CV L KF  ++II F+PPDG  ELM Y +  +I        NV ++
Sbjct: 269 TAGTVVLEDCKFHECVSLDKFNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNV-IN 327

Query: 304 SNSRIEIHCR--AKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWK 361
           S SR  +  R   K+    K +A +V + IPVP          S+G  ++VPE+S I+WK
Sbjct: 328 SRSRTGLDYRITLKSLFPSKLSANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWK 387

Query: 362 IRSFPGGKEYSMAAELCLPSTSSKSEEVQN--KKPVQVKFQIPYFTTSGIQVRYLKINEP 419
              + G  E  ++A + + S  +    +Q   + P+ + F+I  F+ SG+ VRYLKI E 
Sbjct: 388 FAKYNGLTENKLSA-VTVSSNDTTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEK 446

Query: 420 KLQYKSYPWVRYITQSGDDYTIR 442
             +Y++  W++YI++SG  Y +R
Sbjct: 447 DQKYRTVKWIKYISRSG-SYEVR 468

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  182 bits (463), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 135/520 (25%), Positives = 234/520 (45%), Gaps = 98/520 (18%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIP--PCLTYNNTQYL 58
           M+S IY  D   +PL+ + ++      AI      +   ++  S  P  P   Y    ++
Sbjct: 1   MSSCIYILDETLQPLIYKNFK------AISNGEESIELFQQAHSKHPMVPVFHYKGIHFV 54

Query: 59  FIQHSDIYLVAITNLL--------RTNIAEVFAFLYKIIDVLGDYLKT--VEEESIRDNY 108
           +I+    Y ++   L+          N+  +  +L     +L  Y  +  +    I DN+
Sbjct: 55  YIRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNF 114

Query: 109 VIIYELLDELMDYGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRP------------ 156
            +IYELLDE +D+G+PQ+T+  +++ YI                  +             
Sbjct: 115 HLIYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESY 174

Query: 157 -----PSALTDSVSWRSEGIKYKKNEAFLDIVESINMLMT-QKGQILRSEILGVVKIKSR 210
                    T ++SWR +GI Y KNE FLD++E I   M   K +I ++ + G ++ +S 
Sbjct: 175 MNSFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSY 234

Query: 211 LSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKII 270
           LSGMP LK+G+              +   ++  K+ +  + + KFHQCV L   + + I+
Sbjct: 235 LSGMPKLKIGL--------------SKITSSLPKEREQFMNNAKFHQCVSLEDLQ-KNIV 279

Query: 271 TFIPPDGDFELMNYRLSTSIK-----PLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTAT 325
           +FIPPDG+F+L  Y+L   ++      L+  D+  +     +I I        K +++ +
Sbjct: 280 SFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLTITTDFKSQNSTS 339

Query: 326 NVEILIPVP--------EDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGK---EYSMA 374
            + I IP+         + A  P FK   G++ +      +LW++ S  GG    E+SM 
Sbjct: 340 VLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSMY 399

Query: 375 AELCL---PSTSSKSEEVQN----------------------------KKPVQVKFQIPY 403
            E  L        + EE++N                             + V ++F+IPY
Sbjct: 400 CEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLVSMEFEIPY 459

Query: 404 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
           +T SG++V+YLKI E +LQY S+PWVRY T + ++Y  ++
Sbjct: 460 YTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYAYQI 499

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  175 bits (443), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 144/501 (28%), Positives = 239/501 (47%), Gaps = 70/501 (13%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKF-ASLLADLEEESSVIPPCLTYNNTQYLF 59
           M S +     +G  +L++ +++ +  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQ--HSD-IYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116
           I+  H D ++LV IT     N A ++ FLYK+  V+  Y +   EE++++ ++I++E+LD
Sbjct: 57  IRSRHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLD 114

Query: 117 ELM-DYGIPQITETKMLKQYITQXXXX-------------------XXXXXXXXXXXXRP 156
            ++   GIP  TE   L   I Q                                     
Sbjct: 115 IMLGGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHF 171

Query: 157 PSALT----------DSVS---------WRSEGIKYKKNEAFLDIVESINMLMTQKGQIL 197
           P  LT          DS S         WR +GI +KK+E FL + E IN+L+++ G IL
Sbjct: 172 PKFLTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSIL 231

Query: 198 RSEILGVVKIKSRLSGMPDLKLGINDK-GIFS-----------KQLTEDDTNNNATSK-K 244
           +S + G + I + LSG P  + G+ND  G+ S           +    D  N N   K  
Sbjct: 232 KSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAA 291

Query: 245 QNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHS 304
              + LED KFH+CV L KF    II F+PPDG  ELM Y +  +I  L +    +  HS
Sbjct: 292 AGSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNIN-LPFKVTPIVTHS 350

Query: 305 NSRIEIHCR--AKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKI 362
               EI  R   K+    K +A +V + IPVP          S+G  K+VPE++A++W+ 
Sbjct: 351 TRDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRF 410

Query: 363 RSFPGGKEYSMAAELCLPSTSSKSEEVQ-NKKPVQVKFQIPYFTTSGIQVRYLKINEPKL 421
             + G  E +++A     S +++    Q  + P+ ++F++  F+ SG+ VRY  I+    
Sbjct: 411 NKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDS 470

Query: 422 QYKSYPWVRYITQSGDDYTIR 442
           ++++  W++YI+++G  Y +R
Sbjct: 471 KHRAVKWIKYISKAG-SYEVR 490

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  174 bits (442), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 144/527 (27%), Positives = 231/527 (43%), Gaps = 107/527 (20%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M+S ++  D +  PL+ R  +    +   + +A     +  +S    P +      Y++I
Sbjct: 1   MSSCVFILDEQLNPLILRNLKS---IAHPEWYALYFKRVHPQSR--GPVIYSKGIIYIYI 55

Query: 61  QHSDIYLVAITNL-LRTNIAEVFAFLYKIIDVLGDYLKT--VEEESIRDNYVIIYELLDE 117
               +Y V+++N  LR N+  + A+L     +L  YLK   V+   I DN+ +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 118 LMDYGIPQITETKMLKQYI------------TQXXXXXXXXXXXXXXXXRPPSA------ 159
            +DYGIPQ+T+  +++  I            +Q                    A      
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 160 -------------LTDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKG-QILRSEILGVV 205
                         T ++SWR +GI Y KNE F+DI+E  + LM  K  Q+ ++ + G +
Sbjct: 176 DDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYGKI 235

Query: 206 KIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFE 265
             +S LSGMP +++ IN      K L + D            + L   KFHQCV L    
Sbjct: 236 NCRSYLSGMPIVRVCIN------KMLKDKD------------LFLGSSKFHQCVSLESLS 277

Query: 266 TEKIITFIPPDGDFELMNYRLSTSIK--PLI-WCDMNV-QVHSNSRIEIHCRAKAQIKKK 321
           ++  I FIPPDGDF+L  Y+L   I   P+I   D  + +     R+ +    +   K +
Sbjct: 278 SQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYKINERQKKHRLHLSVTIQPHFKAQ 337

Query: 322 STATNVEILIPVP--------EDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGK---E 370
           ++AT ++I IP          +    P FK  HGS+ +      +LW  +   GG     
Sbjct: 338 NSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLWDAQGIKGGHGETS 397

Query: 371 YSMAAELCLPSTSSKSEEVQNKKP-----------------VQVK--------------- 398
           YSM  E  L      + +++  K                   QVK               
Sbjct: 398 YSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKSNKEGKGQFQSNAIT 457

Query: 399 --FQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
             F++PY+T+SG++V YLKI+E  L+Y+S+ WVRY T +  +Y  ++
Sbjct: 458 AEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKTINDTEYAYQV 504

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  171 bits (434), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 120/464 (25%), Positives = 212/464 (45%), Gaps = 98/464 (21%)

Query: 48  PCLTYNNTQYLFIQHSDIYLVAITNLLRTNI-AEVFAFLYKIIDVLGDYL-KTVEEESIR 105
           P L++    Y++IQ   +Y ++++  + T +   VFA+L ++  +   YL + +  + I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNYVIIYELLDELMDYGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXRP--------- 156
           DN+ ++YEL+DE +D GIPQ+T+  +++ Y+                  +          
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 157 ----PSAL-------------TDSVSWRSEGIKYKKNEAFLDIVESINMLMT-QKGQILR 198
               P A              T ++SWR  GI Y KNE FLD+VE +  LM  ++ Q+  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQC 258
           +++ G +  +S LSGMP L +G+N      K + +D    + TS+         + FHQC
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLN------KMVAQD---RDFTSQ---------VHFHQC 262

Query: 259 VRLSKFETEKIITFIPPDGDFELMNYRLSTSI--KPLI---WCDMNVQVHSN----SRIE 309
           V L +  T++ ITF+PPDG+F+L +Y+L+     +PLI    C   V+         R+ 
Sbjct: 263 VDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVKPRRRPADADRLV 322

Query: 310 IHCRAKAQIKKKSTATNVEILIPVPEDADT--------PNFKYSHGSIKWVPEKSAILW- 360
           +        K +   + +++ +P+    +         P FK   G + +      +LW 
Sbjct: 323 LTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFNITDDYLLWD 382

Query: 361 --KIRSFPGGKEYSMAAEL-------------------------------CLPSTSSKSE 387
             K +   G + ++M ++                                 L + +  S 
Sbjct: 383 IGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEALYNQTHASA 442

Query: 388 EVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRY 431
                  ++V F++PY T SG++V +LKI EP+LQY+S+PW+RY
Sbjct: 443 PTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRY 486

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  167 bits (423), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 135/500 (27%), Positives = 241/500 (48%), Gaps = 68/500 (13%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKF-ASLLADLEEESSVIPPCLTYNNTQYLF 59
           M S +     +G  +L++ +++ +  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQH---SDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116
           I+     +++LV IT     N A ++ FLYK+  V+  Y +   EE++++ ++I++E+LD
Sbjct: 57  IRSMRGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAY-RLDREEALKEEFMIVHEMLD 114

Query: 117 ELM-DYGIPQITETKMLKQYITQXXXXXXXXXXXXXXX---------------------- 153
            ++   GIP  TE   L   I Q                                     
Sbjct: 115 IMLGGNGIPIDTE---LNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHF 171

Query: 154 -----XRPPSAL--TDSVSWRSEGIK---------YKKNEAFLDIVESINMLMTQKGQIL 197
                 R  S L   DS S  S+G K         +KK+E FL + E +N+L+++ G IL
Sbjct: 172 PKFLKKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSIL 231

Query: 198 RSEILGVVKIKSRLSGMPDLKLGINDK-GIFSKQ----LTEDDTNNNATSKKQN------ 246
           +S + G + I + LSG P  + G+ND  G+ S+     L++ D +++   + +N      
Sbjct: 232 KSYVDGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAA 291

Query: 247 --KIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVH 303
              + LED KFH+CV + KF    II F+PPDG  ELM Y +  +I  P     +     
Sbjct: 292 AGSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSA 351

Query: 304 SNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIR 363
            ++ ++     K+    K +A +V + IPVP          S+G+ K+VPE++A++W+  
Sbjct: 352 RDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFN 411

Query: 364 SFPGGKEYSMAA-ELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQ 422
            F G  E +++A  +    T+  S +   + P+ + F++  F+ SG+ VRY  I+    +
Sbjct: 412 KFNGLTENTLSAVTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSK 471

Query: 423 YKSYPWVRYITQSGDDYTIR 442
           +++  W++YI++SG  Y +R
Sbjct: 472 HRAVKWIKYISKSG-SYEVR 490

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  162 bits (411), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 123/440 (27%), Positives = 204/440 (46%), Gaps = 57/440 (12%)

Query: 48  PCLTYNNTQYLFIQHSD---IYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESI 104
           P LT  +T +  I+ S    +++VAIT     N   ++ FLYK+  +L  Y     EE +
Sbjct: 45  PILTLGSTTFHHIRSSSESKLWIVAITRS-NANSGVIWEFLYKLDSMLTAY-DLNNEEKL 102

Query: 105 RDNYVIIYELLDELM-DYGIPQITETKMLKQYIT----QXXXXXXXXXXXXXXXXRPPSA 159
            + +++ YE++D ++    +P  TE   +   I+    +                  P  
Sbjct: 103 MEKFMVYYEMIDVMLTSNAMPINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKF 162

Query: 160 LT---------------DSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGV 204
           LT                 + WR  GIKYKKNE FL + E IN+L+++   IL++ + G 
Sbjct: 163 LTRNSRSMSQEFSNITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGS 222

Query: 205 VKIKSRLSGMPDLKLGIND-----------KGIFSKQLTEDDTNNNATSKKQNKIELEDL 253
           + + S LSG P  + G+ND           +G   +    DD + +      + +++ED 
Sbjct: 223 IDLVSHLSGTPICQFGLNDYLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDC 282

Query: 254 KFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEI--- 310
            FHQCV L KF  E++I F+PPDG FELM Y +          D+N+      R+ I   
Sbjct: 283 TFHQCVSLDKFNDERLINFVPPDGSFELMRYHVRD--------DLNIPFKVTPRVSISSS 334

Query: 311 HCRAKAQIKKKS------TATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRS 364
            C  + +I  KS      +A +  + IP+P          S G   +    +  +WK   
Sbjct: 335 RCSMRYKIILKSLFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNK 394

Query: 365 FPGGKEYSMAAELCLPSTSSKSEEVQ--NKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQ 422
           + G  E  +  E  +PS+S+    +Q   + P+ + F+I  F+ SG+ V+YLK+ E   +
Sbjct: 395 YKGLTENELILE-TVPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQK 453

Query: 423 YKSYPWVRYITQSGDDYTIR 442
           Y+   W++Y+++SG  Y IR
Sbjct: 454 YRPVKWIKYVSKSG-SYEIR 472

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  163 bits (412), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 143/528 (27%), Positives = 239/528 (45%), Gaps = 108/528 (20%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M+S+I+  D +  PL+ + ++    +   + FA    ++ + S+V  P + +    ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHSDIYLVAIT-NLLRTNIAEVFAFLYKIIDVLGDYLK--TVEEESIRDNYVIIYELLDE 117
               +Y V+++   LR++I     +L     +L  YL+   ++   I DN+ +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 --------LMDYGI--------------PQIT-------ETKMLKQYITQXXXXXXXXXX 148
                   L D+ I              P+I        E++  +  + +          
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 149 XXXXXXRPPSAL---TDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKG-QILRSEILGV 204
                      L   T ++SWR +GI Y KNE F+D++ES   +M  K  Q+ ++ I G 
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 205 VKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKF 264
           +  +S LSGMP +K+ IN      K L + D              L   KFHQCV L   
Sbjct: 236 IICRSYLSGMPVVKICIN------KMLKDRDQF------------LSSAKFHQCVSLESL 277

Query: 265 ETEKIITFIPPDGDFELMNYRLSTSI--KPLIWCDMN--VQVHSNSRIEIHCRAKAQIKK 320
            ++  I FIPPDGDF+L  Y++   I   P+I       V+     +++I  + +   K 
Sbjct: 278 SSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKVVEKPKKHKLQISMKIQPHFKA 337

Query: 321 KSTATNVEILIPVPEDADT--------PNFKYSHGSIKWVPEKSAILWKIRSFPGGKE-- 370
           +++AT ++I +P+ +  +T        P FK   GSI +      +LWK     GG    
Sbjct: 338 QNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKANGMKGGHGET 397

Query: 371 -YSMAAELCL---PSTSSKSEEVQN---------------------------KKPVQ--- 396
            +SM  E  L    +   ++EE++N                             PV+   
Sbjct: 398 YHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKGQINNPVRNMI 457

Query: 397 -VKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
             +F++PYFT+SG++V YLKI E +LQY+S+PWVRY T +  +Y  ++
Sbjct: 458 TAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRYKTINDTEYAFQM 505

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  159 bits (401), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 134/522 (25%), Positives = 226/522 (43%), Gaps = 104/522 (19%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAID-KFASLLADLEEESSVIPPCLTYNNTQYLF 59
           M+S     D    PL+ R  R   P+  +D     L  +L+       P    N   Y  
Sbjct: 1   MSSCFLLLDETYEPLIRRALR---PIHFLDDAILQLQNNLKHHKGCTKPIFEGNGWHYAV 57

Query: 60  IQHSDIYLVAITNLLRT-NIAEVFAFLYKIIDVLGDYLKT-VEEESIRDNYVIIYELLDE 117
           I   ++Y   I  +  + +   V  +L +I  +   ++   + + ++RDN+ +I+E+++E
Sbjct: 58  ITRDNLYFAMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNVRDNFHLIFEVIEE 117

Query: 118 LMDYGIPQITETKMLKQYITQXXXXXXXXXXXXXXXXR--PPS-------------ALTD 162
             DYGI Q+T   ++  +I                     PP               +T 
Sbjct: 118 SSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYILRTMTS 177

Query: 163 SVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEIL-GVVKIKSRLSGMPDLKLGI 221
           +VSWR +GI Y KNE FLD++E +  +M  +  ++R+ ++ G +  +S LSGMP L +G+
Sbjct: 178 AVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIGL 237

Query: 222 NDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKF--ETEKIITFIPPDGDF 279
           N                     ++N   ++ LKFH+CV L     E   +I FIPPDG+F
Sbjct: 238 N------------------KLMQKNVHFMKRLKFHECVDLHTLIKEESPVIKFIPPDGEF 279

Query: 280 ELMNYRLSTSI--KPLIWCD---MNVQVHSNSRIEIHCRAKAQIKK--KSTATNVEILIP 332
           EL NY+L+  +  +P+I      ++ +   N   +     KA I    K+  +  E+LI 
Sbjct: 280 ELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAITTHFKAQDSAKELLIK 339

Query: 333 VP----------EDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGG---KEYSM------ 373
           +P          +    P FK   G + +     +I+WKI +  GG   K Y +      
Sbjct: 340 IPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNLKGGHGNKNYGLKCMFEI 399

Query: 374 -------AAELCLPST-----------------------------SSKSEEVQNKKPVQV 397
                  A E+ L ++                              ++ E+V     + +
Sbjct: 400 WDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYDGNENQKEDVDKFALIAM 459

Query: 398 KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDY 439
            F+IPY+  SG++V Y KI EP+L Y+S+PWVRY T + ++Y
Sbjct: 460 SFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYKTVNDNEY 501

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  157 bits (397), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 160/297 (53%), Gaps = 18/297 (6%)

Query: 162 DSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGI 221
           + ++WR +GI +KK+E FL + E +N+L+++ G IL+S + G + I + LSG P  + G+
Sbjct: 196 NKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255

Query: 222 NDK-GIFS----KQLTEDDTNNNATSKKQNKIE--------LEDLKFHQCVRLSKFETEK 268
           ND  G+ S    K L +   ++    + +N I         LED KFH+CV L KF    
Sbjct: 256 NDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDCKFHECVSLDKFNKNH 315

Query: 269 IITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCR--AKAQIKKKSTATN 326
            I F+PPDG  ELM Y +  +I  L +    +  HS    EI  R   K+    K +A +
Sbjct: 316 TIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHSTRDNEIDYRITLKSLFPGKLSAKD 374

Query: 327 VEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKS 386
           V + IPVP          S+G  K+VPE++A++W+   + G  E +++A     S +++ 
Sbjct: 375 VTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENTLSAVTVSTSDTTQL 434

Query: 387 EEVQ-NKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 442
              Q  + P+ + F++  F+ SG+ VRY  I     ++++  W++YI++SG  Y +R
Sbjct: 435 NLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKYISRSG-SYEVR 490

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 73/133 (54%), Gaps = 11/133 (8%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKF-ASLLADLEEESSVIPPCLTYNNTQYLF 59
           M S +     +G  +L++ +++ +  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQ--HSD-IYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116
           I+  H D ++LV IT     N A ++ FLYK+  V+  Y +   EE++++ ++I++E+LD
Sbjct: 57  IRSRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLD 114

Query: 117 ELM-DYGIPQITE 128
            ++   GIP  TE
Sbjct: 115 IMLGGNGIPIDTE 127

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  156 bits (395), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 97/298 (32%), Positives = 160/298 (53%), Gaps = 18/298 (6%)

Query: 161 TDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLG 220
           ++ ++WR+ GI +KK+E FL + E +N+L+++ G IL+S + G + I + L+G P  + G
Sbjct: 195 SNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDIVTHLNGTPVCRFG 254

Query: 221 IND---------KGIFSKQLTE---DDTNNNATSK-KQNKIELEDLKFHQCVRLSKFETE 267
           +ND         K   ++Q      D  N N   K     + LED KFH+CV + KF   
Sbjct: 255 LNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAAGSVLLEDCKFHECVSIEKFNKN 314

Query: 268 KIITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCR--AKAQIKKKSTAT 325
            II FIPPDG  ELM Y +  +I  L +    +  HS    EI  R   K+    K +A 
Sbjct: 315 HIIEFIPPDGSMELMKYHVRDNIN-LPFKITPIVSHSTRDNEIDYRITLKSLFPGKLSAK 373

Query: 326 NVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSM-AAELCLPSTSS 384
           +V + IPVP          S+G  K+VPE++A++W+   + G  E ++ AA +    T+ 
Sbjct: 374 DVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENTLSAATVSTSDTTQ 433

Query: 385 KSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 442
            S +   + P+ + F++  F+ SG+ VRY  I+    ++++  W++YI++SG  Y +R
Sbjct: 434 LSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAVKWIKYISKSG-SYEVR 490

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 73/133 (54%), Gaps = 11/133 (8%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKF-ASLLADLEEESSVIPPCLTYNNTQYLF 59
           M S +     +G  +L++ +++ +  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQ--HSD-IYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLD 116
           I+  H D ++LV IT     N A ++ FLYK+  V+  Y +   EE++++ ++I++E+LD
Sbjct: 57  IRSKHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLD 114

Query: 117 ELM-DYGIPQITE 128
            ++   GIP  TE
Sbjct: 115 IMLGGNGIPIDTE 127

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  152 bits (383), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 123/480 (25%), Positives = 216/480 (45%), Gaps = 103/480 (21%)

Query: 48  PCLTYNNTQYLFIQHSDIYLVAITNLLRTNIAE--VFAFLYKIIDVLGDYL-KTVEEESI 104
           P L   +  Y+FIQ   +Y ++++  L TN+    VF++L ++  +   YL + + +  I
Sbjct: 41  PILQNMDYDYIFIQRDGLYFLSLSYQL-TNVYPMVVFSYLNQLHMLFQKYLGENLNKVLI 99

Query: 105 RDNYVIIYELLDELMDYGIPQITETKMLKQYI---------------------------- 136
             N+ +I+EL+DE +  G PQ+T+  +++ YI                            
Sbjct: 100 TGNFHLIHELIDESIFMGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKD 159

Query: 137 TQXXXXXXXXXXXXXXXXRPPSALTDSVSWRSEGIKYKKNEAFLDIVESINMLMT-QKGQ 195
           ++                      T ++SWR +GI Y KNE +LD++E +  L+  Q   
Sbjct: 160 SKKKEEDTEATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMN 219

Query: 196 ILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKF 255
           I  + + G ++ +S LSGMP L +G+N                      +N+  +    F
Sbjct: 220 IKSNTVYGYIQCRSYLSGMPMLTIGLNKLN------------------SENEYFMRRANF 261

Query: 256 HQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK--PLIW---CDMNVQVHSN----S 306
           HQCV L +  T+K+I+F PPDG+F+L NY+L+ ++   P+I    C + ++         
Sbjct: 262 HQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKDGLD 321

Query: 307 RIEIHCRAKAQIKKKSTATNVEILIPVPE-----DAD---TPNFKYSHGSIKWVPEKSAI 358
           R+ +        K + + + + I +P+ +     D D    P FK   G + +      +
Sbjct: 322 RLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYL 381

Query: 359 LWKIRSFPGG---KEYSMAAELCLPSTSSKSEEVQ------NKKPVQ------------- 396
           LW++    GG   K   M +E  L +   ++   Q      + KP++             
Sbjct: 382 LWEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTH 441

Query: 397 -------------VKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443
                        V+F+IPY+T SG++V +LKI E +LQ++S+PWVRY T + D Y  +L
Sbjct: 442 ELNSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRYKTINHDIYAYQL 501

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  150 bits (379), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 116/488 (23%), Positives = 233/488 (47%), Gaps = 61/488 (12%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKF-ASLLADLEEESSVIPPCLTYNNTQYLF 59
           M +A+     +G  ++S+ ++  +  +  D F   ++  L+  S    P LT  +T + +
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRS----PILTLGSTTFHY 56

Query: 60  IQ--HSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDE 117
           ++     +++V+++     N A  + FLYK   +L  Y +   EE +++ +++ +ELLD 
Sbjct: 57  VRTPGEGLWVVSVSRN-NENSAATWEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDT 114

Query: 118 LMDYG-IPQITETKML--------------------KQYITQXXXXXXXXXXXXXXXXRP 156
           +++ G IP  T+   +                    +Q  T                   
Sbjct: 115 MVEGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASN 174

Query: 157 PSALTDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPD 216
           P  ++       +G + K+NE  + + ESI++L+++ G IL++ + G + + ++L G   
Sbjct: 175 PGGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAV 234

Query: 217 LKLGINDKGIFSKQLTEDDTNNNA----TSKKQNKIELE------------DLKFHQCVR 260
            + G+ND       L+ D+++N+      SK+     LE            D KFHQCV 
Sbjct: 235 CQFGLND------SLSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCKFHQCVS 288

Query: 261 LSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHSNSRIEIHCRAKAQIK 319
           L +F+ ++II F PP+G  ELM Y +  ++  P     M +   +N+  +     K+   
Sbjct: 289 LERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPT-ANNETDYRVTIKSLFP 347

Query: 320 KKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCL 379
            K +A NV + IPVP          S+G+ K++PE++A++WK   + G  E  ++A + +
Sbjct: 348 GKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITV 406

Query: 380 PSTSSKSEEVQ--NKKPVQVKFQIPYFTTSGIQVRYLKI---NEPKLQYKSYPWVRYITQ 434
           P+  +    +Q  ++ P+ + F+I  ++ +G+ VRY  +   +    ++K+  W++Y++ 
Sbjct: 407 PTRDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSH 466

Query: 435 SGDDYTIR 442
           SG  Y +R
Sbjct: 467 SG-SYEVR 473

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  144 bits (362), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 107/325 (32%), Positives = 153/325 (47%), Gaps = 68/325 (20%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMT-QKGQILRSEILGVVKIKSRLSGMPDLKLGIN 222
           VSWR++GI Y +NE FLD+VE +  LM    G I ++ I G +  KS LSGMP LK+  N
Sbjct: 216 VSWRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN 275

Query: 223 DKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELM 282
                  +L++ D    + SK           FHQCV       EK I FIPPDGDF L 
Sbjct: 276 -------KLSQKDEQFISHSK-----------FHQCVTWPS-SNEKEIEFIPPDGDFVLC 316

Query: 283 NYRLSTSIK--PLI-WCDMNVQVH-SNSRIEIHCRAKAQIKKKSTATNVEILIPVPE--- 335
            Y L   +K  P++      V+      +I++ C  +   K +++ + + + IP+     
Sbjct: 317 QYELKRHVKDQPMLKLVSFGVKPKLKKYKIQMSCTIETHFKARNSTSTLNLKIPLARLFQ 376

Query: 336 ----DADTP-NFKYSHGSIKWVPEKSAILWKIRSFPGGK---EYSMAAELCL-------- 379
               D   P  FK   G + +      +LW I    GG    + SMAAE  L        
Sbjct: 377 EYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEFEE 436

Query: 380 -----------------PSTSSKSEEVQNKKP--------VQVKFQIPYFTTSGIQVRYL 414
                            P      ++V N+K         + +KF+IPY T SG+QV YL
Sbjct: 437 EQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVEYL 496

Query: 415 KINEPKLQYKSYPWVRYITQSGDDY 439
           KI+E +LQY+S+PWVRY T + ++Y
Sbjct: 497 KIDEEQLQYQSFPWVRYKTVNDEEY 521

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 71/140 (50%), Gaps = 9/140 (6%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M+S I+  D    PL+S+  +    L  I +    +   E +     P ++ ++  ++ I
Sbjct: 1   MSSCIFITDENLEPLISKNIKAIPNLQGILRLFKSVYTPESQ-----PVISASSFHFVHI 55

Query: 61  QHSDIYLVAITNL--LRTNIAEVFAFLYKIIDVLGDYL--KTVEEESIRDNYVIIYELLD 116
           + S +  V++ +      N+  +  FL +   +L  YL    +++  + DN ++I EL+D
Sbjct: 56  KRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELID 115

Query: 117 ELMDYGIPQITETKMLKQYI 136
           E +D+G+ QIT+  +++ YI
Sbjct: 116 ESIDFGVIQITDASIMRDYI 135

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  138 bits (348), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 105/354 (29%), Positives = 162/354 (45%), Gaps = 91/354 (25%)

Query: 161 TDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEIL-GVVKIKSRLSGMPDLKL 219
           T +VSWR++GI Y KNE FLD+VES+  LM  K +++R  ++ G +K KS LSGMP L++
Sbjct: 222 TMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRI 281

Query: 220 GINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLS----------------- 262
            +N       ++ +DD           K  L   KFHQCV L+                 
Sbjct: 282 ALN-------KILQDD-----------KQFLGHAKFHQCVSLNSINIKDLEKDLEGPNDI 323

Query: 263 ---KFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNVQVHSN---SRIEIHCRAK 315
               F  +K I FIPPDG+F L  Y L   +K P +    +  +  N    R++I  + +
Sbjct: 324 SNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKKFRVQISLKIE 383

Query: 316 AQIKKKSTATNVEILIPVPE--------DADTPNFKYSHGSIKWVPEKSAILWKIRSFPG 367
              K++++ + + I IP+ +         +  P FK   G + +   +  ++W+I +  G
Sbjct: 384 THFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEIDALKG 443

Query: 368 G---KEYSMAAELCL-------------------------PSTSSKSEEVQNKKPVQ--- 396
           G    E  M AE  L                         P      EE+   +  +   
Sbjct: 444 GHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHENEDAEDTA 503

Query: 397 ---------VKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTI 441
                    ++F+IPY T SG++V YLKI E  L+Y+S+PWVRY T + D+Y  
Sbjct: 504 LKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRYKTLNDDEYAF 557

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEE-SSVIPPCLTYNNTQYLF 59
           M+S ++  D    PL+S+  +       +     ++   +E  +   PP +T +N  Y++
Sbjct: 1   MSSCLFILDELLEPLISKNTK------PVRNLPDIIKSFKESWTPTSPPIITVSNWHYVY 54

Query: 60  IQHSDIYLVAITNLLR---TNIAEVFAFLYKIIDVLGDYLKT--VEEESIRDNYVIIYEL 114
           ++   ++ VA  + +     N+  +  +L ++  +L +Y K   + +  I DN +++ EL
Sbjct: 55  VKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTEL 114

Query: 115 LDELMDYGIPQITETKMLKQYI 136
           +DE +D+GI Q+T+  +++ YI
Sbjct: 115 MDESIDFGIIQMTDPSIIRDYI 136

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  134 bits (336), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 102/334 (30%), Positives = 155/334 (46%), Gaps = 74/334 (22%)

Query: 163 SVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEIL-GVVKIKSRLSGMPDLKLGI 221
           SVSWR++GI+Y KNE FLD++E +   M     I++  ++ G +  KS LSGMP LK+ +
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 222 NDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFEL 281
           N K I+                 Q+K  L   KFHQCV     +  K++ F+PPDGDF L
Sbjct: 282 N-KIIY-----------------QDKQFLSSCKFHQCVMPDSVDEGKVLEFVPPDGDFVL 323

Query: 282 MNYRLSTSIKPLIWCDM-NVQVH---SNSRIEIHCRAKAQIKKKSTATNVEILIPV---- 333
             Y L   +  L    + + +V       ++++    ++  KK ++ T + I IP+    
Sbjct: 324 CKYELKRHVNDLPLLKLISYEVKPKLDKYKLKLFVTIESTFKKTNSTTKLNIKIPLKVLL 383

Query: 334 -PEDAD-TPNFKY--SHGSIKWVPEKSAILWKIRSFPGGK-EYSMAAELCLPS------- 381
              D D + N K     G I +      +LW+I +  GG  +  M A+  L +       
Sbjct: 384 EKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFALFNEEEYLRQ 443

Query: 382 --------------TSSKSEEVQNK---------------------KPVQVKFQIPYFTT 406
                         T  K EE+  +                       +++ F+IPY T+
Sbjct: 444 QEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIKMDFEIPYNTS 503

Query: 407 SGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 440
           SG++V YLKI EP LQY+++PWVRY T S D Y 
Sbjct: 504 SGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 73/142 (51%), Gaps = 14/142 (9%)

Query: 1   MASAIYFCDIKGRPLLSRKYRD----DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQ 56
           M+S +Y  +     LLS+  +     DIPL       SL      +  V  P + Y +  
Sbjct: 1   MSSILYILNEDLESLLSKSIKALESPDIPL-------SLFKKQFHKHQVTTPVIIYEDYI 53

Query: 57  YLFIQHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDY--LKTVEEESIRDNYVIIYEL 114
           +  IQ   +Y V+  +  +TNI E   +L +   +L +Y  +K +++  I DN V I EL
Sbjct: 54  FTCIQRDTLYFVSSIDC-KTNILETLHYLNEFYILLKNYFNVKQLDKNIIMDNLVPILEL 112

Query: 115 LDELMDYGIPQITETKMLKQYI 136
           ++E +D+GI QIT++ ++K YI
Sbjct: 113 IEESVDFGIIQITDSNLMKDYI 134

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  131 bits (330), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 105/334 (31%), Positives = 155/334 (46%), Gaps = 74/334 (22%)

Query: 161 TDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEIL-GVVKIKSRLSGMPDLKL 219
           T  VSWR++GI Y KNE FLD+VE +  L   K +++R  ++ G +  KS LSGMP LK+
Sbjct: 233 TMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKI 292

Query: 220 GINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDF 279
            +N       +L + D    + S           KFHQCV L     EK + FIPPDG+F
Sbjct: 293 ALN-------KLLQRDAQFMSHS-----------KFHQCVALETL-NEKELEFIPPDGEF 333

Query: 280 ELMNYRL-----STSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVP 334
            L  Y L      T I  +   ++  Q+    ++ I    +   K +++ + + + IP+ 
Sbjct: 334 ILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLRILLTIETHFKTRNSTSILNVKIPLA 392

Query: 335 E-------DADTPN-FKYSHGSIKWVPEKSAILWKIRSFPGGK---EYSMAAELCL---- 379
           +       D   P  FK + G + +      +LW+I    GG    ++SM AE  L    
Sbjct: 393 KLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFSLFNKE 452

Query: 380 -----------------------------PSTSSKSEEVQNK----KPVQVKFQIPYFTT 406
                                         + S K  EV  K    + V + F+IPY T 
Sbjct: 453 EFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEIPYTTC 512

Query: 407 SGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 440
           SG++V YLKI E +LQY+S+PWVRY T S ++Y 
Sbjct: 513 SGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  131 bits (329), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 106/365 (29%), Positives = 163/365 (44%), Gaps = 106/365 (29%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMT-QKGQILRSEILGVVKIKSRLSGMPDLKLGIN 222
           VSWR++GI Y KNE FLD++E +  L+  + G + RS I G +  +S LSGMP LK+ +N
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 223 DKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFE----------------- 265
                  +L ++D           K  +  ++FHQCV L   E                 
Sbjct: 309 -------KLLQND-----------KQFISQVQFHQCVSLDSIEKVIKYAEEHSDELKTLK 350

Query: 266 -----TEKIITFIPPDGDFELMNYRLSTSIK--PLI-WCDMNVQVH-SNSRIEIHCRAKA 316
                 E  I FIPPDGDF L +Y L   I+  P++  C   +       +++I    + 
Sbjct: 351 HTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKKYKLKISAAVET 410

Query: 317 QIKKKSTATNVEILIPVPE-------DADTP-NFKYSHGSIKWVPEKSAILWKIRSFPGG 368
             K  ++ + +++ IP+ +       D   P  FK S+G + +      +LW+I    GG
Sbjct: 411 HFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLLWEIGVIKGG 470

Query: 369 KEY-------------SMAAELCLPS---------------------TSSKSEEVQ---- 390
           K +             +MAAE  L +                     T  K E++     
Sbjct: 471 KMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRTGPKLEDIYKETH 530

Query: 391 ---------NKKP------VQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQS 435
                     +KP      + + F+IPY T SG++V YLKI+E +LQY+S+PWVRY T +
Sbjct: 531 EENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFPWVRYKTIN 590

Query: 436 GDDYT 440
            D+Y 
Sbjct: 591 DDEYA 595

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 74/141 (52%), Gaps = 10/141 (7%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M+S+IY  D    PL+S+  +    L  +++   L      +S    P +   N ++++I
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKG---LPNVNELGDLFRYHVRQSQ--NPIIDVYNWRFVYI 55

Query: 61  QHSDIYLVAITNLLRTNIAEVFA---FLYKIIDVLGDYL--KTVEEESIRDNYVIIYELL 115
           +   +Y VA+ +     IA   A   +L ++  +  DY+  K ++   + DN +++ EL+
Sbjct: 56  KRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELI 115

Query: 116 DELMDYGIPQITETKMLKQYI 136
           DE +DYGI Q+TE  ++K YI
Sbjct: 116 DETLDYGIVQLTEPSIMKDYI 136

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  130 bits (326), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 100/342 (29%), Positives = 157/342 (45%), Gaps = 84/342 (24%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMT-QKGQILRSEILGVVKIKSRLSGMPDLKLGIN 222
           VSWR++GI Y KNE FLD++E +  LM    G+I ++ I G +K K  LSGMP LK+ +N
Sbjct: 216 VSWRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN 275

Query: 223 DKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETE------------KII 270
                  +L ++D    + S           KFHQCV ++  + E            K I
Sbjct: 276 -------KLIKNDEQFISNS-----------KFHQCVSINSLKREINNEEEENTYHGKEI 317

Query: 271 TFIPPDGDFELMNYRLSTSIK--PLIWCDMNVQVH---SNSRIEIHCRAKAQIKKKSTAT 325
            FIPPDG+F L  Y L   ++  P+I    N+++       +I+IH   +   KK+++ +
Sbjct: 318 EFIPPDGEFVLCKYELKRHVRDVPVIKLS-NIEIKPKLKKYKIQIHVTIETHFKKQNSTS 376

Query: 326 NVEILIPVP--------EDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYS---MA 374
            + I IP+         +    P FK   G + +      ++W++ S  GG   S   M 
Sbjct: 377 VLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNNMV 436

Query: 375 AELCL-------------------------PSTSSKSEEVQNKKP-----------VQVK 398
           AE  +                         P      E+  + +            + +K
Sbjct: 437 AEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLTMK 496

Query: 399 FQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 440
           F++PY T SG++V YLKI E ++ Y+S+PWVRY T + D+Y 
Sbjct: 497 FEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRYKTINDDEYA 538

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 75/141 (53%), Gaps = 10/141 (7%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M+S ++  D    PL+S+  +    LT I +F  L  + +E     PP  T     Y+FI
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKL--NYKENG---PPVFTVLEWHYVFI 55

Query: 61  QHSDI-YLVAI--TNLLRTNIAEVFAFLYKIIDVLGDYLK--TVEEESIRDNYVIIYELL 115
           +   + ++ AI  T+   TN+  +  +L ++  +L  Y    +++   + DN ++I EL+
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELI 115

Query: 116 DELMDYGIPQITETKMLKQYI 136
           DE MD+GI Q+T+  ++K YI
Sbjct: 116 DESMDFGIVQLTDPSIIKDYI 136

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  129 bits (324), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 102/356 (28%), Positives = 159/356 (44%), Gaps = 97/356 (27%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEIL-GVVKIKSRLSGMPDLKLGIN 222
           +SWR++GI Y KNE FLD++E +   M  K  ++R  ++ G +  +S LSGMP LK+ IN
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKF------------------ 264
                 K L            KQ+   L ++KFHQCV L                     
Sbjct: 310 ------KIL------------KQDVQFLSNVKFHQCVSLDSIRARSNPPAVEEDGKKKNE 351

Query: 265 ETEKI-----ITFIPPDGDFELMNYRLSTSIK--PLIWC---DMNVQVHSNSRIEIHCRA 314
           E + +     I FIPPDG+F L  Y L   +K  P+I     ++  ++H   +I+IH   
Sbjct: 352 EADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLHK-FKIKIHVII 410

Query: 315 KAQIKKKSTATNVEILIPVP--------EDADTPNFKYSHGSIKWVPEKSAILWKIRSFP 366
           +   K  ++ + + + IP+         + +  P FK   G++ +      +LW++ +  
Sbjct: 411 ETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEVGTMN 470

Query: 367 GG---KEYSMAAELCLPST----------------------------------SSKSEEV 389
           GG      SM AE  L +                                      S+EV
Sbjct: 471 GGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGDSDEV 530

Query: 390 QNKKP----VQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTI 441
             +K     + + F++PY T SG+++ YLKI E +LQY+S+PWVRY T S D+Y  
Sbjct: 531 STRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISDDEYAF 586

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 75/143 (52%), Gaps = 13/143 (9%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEE--ESSVIPPCLTYNNTQYL 58
           M+S+I+  D    P++ +  R      A+    SL+   +E   S+ + P    N+  + 
Sbjct: 1   MSSSIFILDETLEPIICKNIR------ALPNLPSLVTKFQELYRSNGVSPLPILNDIDWQ 54

Query: 59  FI---QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKT--VEEESIRDNYVIIYE 113
           F+   + S ++L  + N  R N+  VF +L +   +L DYL    +    + DN++++ E
Sbjct: 55  FLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIE 114

Query: 114 LLDELMDYGIPQITETKMLKQYI 136
           L+DE +D+G+ Q T++ ++K Y+
Sbjct: 115 LIDESLDFGVVQFTDSSLIKDYV 137

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  128 bits (322), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 107/362 (29%), Positives = 163/362 (45%), Gaps = 106/362 (29%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMT-QKGQILRSEILGVVKIKSRLSGMPDLKLGIN 222
           +SWR++GI Y KNE FLD++E +  LM  +KG I ++ I G +  +S LSGMP LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 223 DKGIFSKQLTEDD---TNNNATSKKQNKIELEDLKFHQCVRLSKFET------------- 266
                 K L  D    +N+N               FHQCV L    T             
Sbjct: 313 ------KILNRDPQFMSNSN---------------FHQCVSLDSINTIEKGQEKEQNTGD 351

Query: 267 ------EKIITFIPPDGDFELMNYRLSTSIK--PLIWC-DMNVQVH-SNSRIEIHCRAKA 316
                  + I F+PPDG+F L  Y L   +K  P+I   D  ++     S+I+I  + + 
Sbjct: 352 SQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQILTKIQT 411

Query: 317 QIKKKSTATNVEILIP---VPED-----ADTPNFKYSHGSIKWVPEKSAILWKIRSFPGG 368
             K  ++ + + + IP   V +D     +    FK ++G + +      +LW+I++  G 
Sbjct: 412 NFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQTMKGH 471

Query: 369 KE----------------YSMAAELCLPS---------------------TSSKSEEVQN 391
           +E                 SM AE  L +                     T  K EE+ N
Sbjct: 472 RERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPKLEELYN 531

Query: 392 K-------------KPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDD 438
           +             + V + F+IPY T SG++V YLK+ EP+LQY+S+PWVRY T + ++
Sbjct: 532 QVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTVNDEE 591

Query: 439 YT 440
           Y 
Sbjct: 592 YA 593

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 79/142 (55%), Gaps = 12/142 (8%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEE-ESSVIPPCLTYNNTQYLF 59
           M+S+++  D    P++S+  R      A+   +S+L+  ++      PP L  N+  ++ 
Sbjct: 1   MSSSLFILDEDLEPVVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILFQNDWFFIH 54

Query: 60  IQHSDIYLVAI---TNLLRTNIAEVFAFLYKIIDVLGDY--LKTVEEESIRDNYVIIYEL 114
           ++   ++LV++   T+    ++  + AFL +   +L  Y  +K + ++ I DN +++ EL
Sbjct: 55  LKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVLEL 114

Query: 115 LDELMDYGIPQITETKMLKQYI 136
           +DE +D+GI Q+T+  ++K YI
Sbjct: 115 MDECIDFGIVQVTDPSIIKDYI 136

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  125 bits (313), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 118/466 (25%), Positives = 219/466 (46%), Gaps = 61/466 (13%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           M SAI     +G  ++S+ YR++I  +  + F   + +     +V  P LT  +T +  I
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVIN---NFNVRSPILTLGSTTFHHI 57

Query: 61  QHS-------DIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYE 113
           + +       +++LV + N    N A ++ FL K+  +L  Y  T  E  ++D ++ ++E
Sbjct: 58  RSTANDPTDDELWLVCV-NRNNANSAAIWEFLQKLNLILQQYGIT-SESKLKDEFMTVHE 115

Query: 114 LLDE-LMDYGIPQITETKML--KQYITQXXXXXXXXXXXXXXXXRPPSALTD-----SVS 165
           +LD  L+  GI Q T+ K +  K  +                  R  + LT      S+ 
Sbjct: 116 ILDNMLLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFSLI 175

Query: 166 WRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKG 225
             +    +KKNE F  + ES+N+L+++ G IL++ + G ++IKS L+G P  +       
Sbjct: 176 PTNRHDAHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQF------ 229

Query: 226 IFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYR 285
               +L +D T            ++ D KF QC+   +  T ++      DG+ E++NY 
Sbjct: 230 ----ELVDDQT------------KITDFKFDQCIEKVQSRTVRVA---ATDGELEIVNYH 270

Query: 286 LSTS-------IKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDAD 338
           +          I P++     V+   + RI +    K+   K  +AT+V + IPVP +  
Sbjct: 271 VRDDKINIPFKITPIV---STVKDTVDYRISL----KSLFPKNLSATDVVLTIPVPPNTI 323

Query: 339 TPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVK 398
                 S+G  K+  E++A++W    F G  E +++A          + E   +  +Q+ 
Sbjct: 324 DCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITIADGRQIMNLESWTRPSIQLT 383

Query: 399 FQIPYFTTSGIQVRYLKI-NEPKLQYKSYPWVRYITQSGDDYTIRL 443
           F+I  ++ SG+ +R L I ++ K +YK+  W++YI+++G  Y +R 
Sbjct: 384 FEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAG-SYEMRF 428

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  126 bits (317), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 102/359 (28%), Positives = 158/359 (44%), Gaps = 100/359 (27%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMT-QKGQILRSEILGVVKIKSRLSGMPDLKLGIN 222
           +SWR++GI Y KNE FLD++E +  LM  +KG I ++ I G +  +  LSGMP LK+ IN
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 223 DKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFET---------------- 266
                 K L  D               L +  FHQCV L   +T                
Sbjct: 320 ------KILNRDAQF------------LSNSSFHQCVSLDSIKTIEKREEKEDDDTGLQA 361

Query: 267 ---EKIITFIPPDGDFELMNYRLSTSIK--PLIWC-DMNVQVH-SNSRIEIHCRAKAQIK 319
               K + F+PPDG+F L  Y L   +K  P+I   D  ++      +I+I  + +   K
Sbjct: 362 AADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETKIQTNFK 421

Query: 320 KKSTATNVEILIPVP--------EDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEY 371
             ++ + + + IP+         + +    FK + G + +      +LW+I++  G +E+
Sbjct: 422 PTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMKGHREH 481

Query: 372 ----------------SMAAELCLPS---------------------TSSKSEEVQNK-- 392
                           SM AE  L +                     T  + EE+  +  
Sbjct: 482 NTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLEELYRQVH 541

Query: 393 -----------KPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 440
                      K V + F+IPY T SG+++ YLK+ EP+LQY+S+PWVRY T S D+Y 
Sbjct: 542 DQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTSDDEYA 600

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 58/95 (61%), Gaps = 5/95 (5%)

Query: 47  PPCLTYNNTQYLFIQHSDIYLVAI---TNLLRTNIAEVFAFLYKIIDVLGDY--LKTVEE 101
           PP L+ N+  ++ ++   ++ V++   T+    ++  + AFL +   +L +Y  +K + +
Sbjct: 42  PPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTK 101

Query: 102 ESIRDNYVIIYELLDELMDYGIPQITETKMLKQYI 136
           + I DN +++ EL+DE +D+GI Q+T+  ++K YI
Sbjct: 102 DVILDNVLLVLELMDECIDFGIVQVTDPSIIKDYI 136

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  123 bits (309), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 96/345 (27%), Positives = 150/345 (43%), Gaps = 87/345 (25%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEIL-GVVKIKSRLSGMPDLKLGIN 222
           +SWR++GI Y KNE FL+++E +   M     +++  ++ G ++ K  LSGMP+LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 DKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFET--EKIITFIPPDGDFE 280
                 K + ED            K  L + KFHQCV L+  E+   K + F+PPDG+F 
Sbjct: 313 ------KIVNED------------KQFLANCKFHQCVSLASLESSDHKDVEFVPPDGEFT 354

Query: 281 LMNYRLSTSIK--PLIWCDMNVQVH---------SNSRIEIHCRAKAQIKKKSTATNVEI 329
           L  Y L   ++  P++   +N +V              IE H +      K +    ++ 
Sbjct: 355 LCRYELKRHVRDEPMVKL-VNFEVKPKLKKFKLKLLLTIETHFKTTNATSKLALRVPIKQ 413

Query: 330 LIPVPEDADTPNFKY--SHGSIKWVPEKSAILWKIRSFPGGK---EYSMAAELCLPSTSS 384
           L        + N K     G+I +      +LW++ S  GG    + SM  E  L +   
Sbjct: 414 LFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLSMGVEFALFNQEE 473

Query: 385 KSEEVQ---------------------------------NKKPVQ--------------- 396
              E +                                 N +PV                
Sbjct: 474 YDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRLQPRTREIDKLL 533

Query: 397 -VKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 440
            + F++PY T+SG++V YLKI EP+L+Y+S+PWVRY T S  +Y 
Sbjct: 534 TMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDAEYA 578

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 72/140 (51%), Gaps = 10/140 (7%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLT-AIDKFASLLADLEEESSVIPPCLTYNNT-QYL 58
           M+S +Y  D     L+S+  +    L   I +F  L        S  PP + Y++   + 
Sbjct: 1   MSSVLYILDENLETLISKNIKAVPSLEYPIAQFKKLYG------SNAPPVIDYHDLFTFT 54

Query: 59  FIQHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYL--KTVEEESIRDNYVIIYELLD 116
           +IQ   +  V++ + + T + E   +L    +VL +YL  K +++  + DN V+I EL++
Sbjct: 55  YIQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNIVTDNSVLISELIE 114

Query: 117 ELMDYGIPQITETKMLKQYI 136
           E +D+G  Q+T++ +L  YI
Sbjct: 115 ETIDFGAIQVTDSGLLADYI 134

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  122 bits (306), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 102/363 (28%), Positives = 158/363 (43%), Gaps = 104/363 (28%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMT-QKGQILRSEILGVVKIKSRLSGMPDLKLGIN 222
           +SWR++GI Y KNE FLD++E +  LM  +KG I ++ I G +  +  LSGMP LK+ IN
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 223 DKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFET---------------- 266
                 K L  D    + +S            FHQCV L    T                
Sbjct: 318 ------KILNRDPQFMSNSS------------FHQCVSLDSINTIEKDEEKNSDDDAGLQ 359

Query: 267 ----EKIITFIPPDGDFELMNYRLSTSIK--PLIWC-DMNVQVH-SNSRIEIHCRAKAQI 318
                + I FIPPDG+F L  Y L   +K  P++   D  ++      +I+I  + +   
Sbjct: 360 AATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQIVTKIQTNF 419

Query: 319 KKKSTATNVEILIPVP--------EDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKE 370
           K  ++ + + + IP+         + +    FK + G + +      +LW+I++  G +E
Sbjct: 420 KPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEIQTMKGHRE 479

Query: 371 Y-------------------SMAAELCLPS---------------------TSSKSEEVQ 390
           +                   SM AE  L +                     T  + EE+ 
Sbjct: 480 HSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRTGPRLEELY 539

Query: 391 NK-------------KPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGD 437
            +             K V + F+IPY T SG++V YLK+ EP+LQY+S+PWVRY T S +
Sbjct: 540 RQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTVSDE 599

Query: 438 DYT 440
           +Y 
Sbjct: 600 EYA 602

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 78/142 (54%), Gaps = 12/142 (8%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEE-ESSVIPPCLTYNNTQYLF 59
           M+S+++  D    PL+S+  R      A+   +S+L+  ++      PP L+ N+  ++ 
Sbjct: 1   MSSSLFILDENLEPLVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILSQNDWFFIH 54

Query: 60  IQHSDIYLVAI---TNLLRTNIAEVFAFLYKIIDVLGDY--LKTVEEESIRDNYVIIYEL 114
           ++   ++ V++   T+    ++  + AFL +   +L  Y  ++ + +  I DN +++ EL
Sbjct: 55  LKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLEL 114

Query: 115 LDELMDYGIPQITETKMLKQYI 136
           +DE +D+GI Q+T+  ++K YI
Sbjct: 115 IDECIDFGIVQVTDPSIIKDYI 136

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  121 bits (304), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 109/361 (30%), Positives = 159/361 (44%), Gaps = 103/361 (28%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMT-QKGQILRSEILGVVKIKSRLSGMPDLKLGIN 222
           +SWR++GI Y KNE FLD++E +  LM  +KG I ++ I G +  +  LSGMP LK+ IN
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 223 DKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRL-----------------SKFE 265
                  +L   D    + S           KFHQCV L                 S+  
Sbjct: 312 -------KLLNRDPQFMSNS-----------KFHQCVSLDSINIIEEEGRDTDDAGSQTA 353

Query: 266 TE-KIITFIPPDGDFELMNYRLSTSIK--PLIWCDMNVQVH---SNSRIEIHCRAKAQIK 319
           T+ K I FIPPDG+F L  Y L   +K  P+I      ++       +I+I  + +   K
Sbjct: 354 TDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKL-QGFEIKPKLKKFKIQIITKIQTNFK 412

Query: 320 KKSTATNVEILIP---VPED-----ADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKE- 370
             ++ + + + IP   V +D     +    FK + G + +      +LW+I +  G +E 
Sbjct: 413 PTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEIGTMKGHRER 472

Query: 371 --------------YSMAAELCLPS---------------------TSSKSEEVQNK--- 392
                          SM AE  L +                     T  K EE+  +   
Sbjct: 473 NTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGPKLEELYKQVHE 532

Query: 393 -------------KPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDY 439
                        K V V F+IPY T SG++V YLK+ EP+LQY+S+PWVRY T S D+Y
Sbjct: 533 ERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTISDDEY 592

Query: 440 T 440
            
Sbjct: 593 A 593

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 76/142 (53%), Gaps = 12/142 (8%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEE-ESSVIPPCLTYNNTQYLF 59
           M+S+++  D    PL+S+  R      AI   +S+L+  ++      PP L+ N   ++ 
Sbjct: 1   MSSSLFILDEDLEPLVSKNIR------AIPNLSSILSSFKQCYHRDSPPILSQNGWFFIH 54

Query: 60  IQHSDIYLVAI---TNLLRTNIAEVFAFLYKIIDVLGDY--LKTVEEESIRDNYVIIYEL 114
           ++   ++ +++   T+    ++  + AFL +   +L  Y  +  + +  I DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 115 LDELMDYGIPQITETKMLKQYI 136
           +DE +D+GI Q+T+  ++K YI
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYI 136

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 90.9 bits (224), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 114/233 (48%), Gaps = 37/233 (15%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEIL-GVVKIKSRLSGMPDLKLGIN 222
           +SWR++GI Y KNE FLD++E    +M  K  ++R  ++ G +  +  LSGMP LK+ +N
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 223 DKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELM 282
                 K L +D               L  L+FHQCV L   + ++ I FIPPDG+F L 
Sbjct: 347 ------KLLQKDQQ------------FLSQLRFHQCVSLETIQNKE-IEFIPPDGEFILC 387

Query: 283 NYRLSTSIK-----PLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDA 337
            Y L   +K      LI  ++  ++    +I+I+       K +++ + + + IP+ +  
Sbjct: 388 EYELKRHVKDPPNIKLISFEIKPKLKK-FKIQINLSITTFFKVQNSTSILNLKIPLEKLF 446

Query: 338 D--------TPNFKYSHGSIKWVPEKSAILWKIRSFPGGKE---YSMAAELCL 379
           +        +P FK + G +K+      +LW+I S  GG      +M AE  L
Sbjct: 447 NDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKAMTAEFFL 499

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 50/90 (55%), Gaps = 14/90 (15%)

Query: 364 SFPGGKEYSMAAELCLPSTSS--KSEEVQNK----------KP--VQVKFQIPYFTTSGI 409
           S P     +  A +  P+++S  K++   NK          KP  + V F+IPY+  SG+
Sbjct: 564 SIPSTGTTNAGANIATPASTSVVKNDTSSNKEIPLKKALSNKPQYLTVDFEIPYYACSGL 623

Query: 410 QVRYLKINEPKLQYKSYPWVRYITQSGDDY 439
           +V YLKI E +L Y+S+PWVRY T +  DY
Sbjct: 624 KVEYLKIEEEQLLYQSFPWVRYKTTNDKDY 653

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 74/143 (51%), Gaps = 13/143 (9%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIP---PCLTYNNTQY 57
           M S I+  D    PL+S+  R      AI  F S++    +  S      P ++ N+  +
Sbjct: 1   MLSCIFILDENLEPLISKNIR------AIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 58  LFIQH-SDIYLVAIT-NLLRTNIAEVFAFLYKIIDVLGDYLKT--VEEESIRDNYVIIYE 113
           + I+  S I+L AI  N   +++  +  +L K   +L  +LKT  +    I DN ++I E
Sbjct: 55  IQIKRDSLIFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIME 114

Query: 114 LLDELMDYGIPQITETKMLKQYI 136
           L+DE +D+GI Q+T+  ++K Y+
Sbjct: 115 LIDESIDFGIIQMTDPNIIKDYV 137

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 113/256 (44%), Gaps = 61/256 (23%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMT-QKGQILRSEILGVVKIKSRLSGMPDLKLGIN 222
           +SWR++GI Y KNE FLD++E +   M  +KG I ++ I G +  K  LSGMP LK+ IN
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKF------------------ 264
                  ++ ++D+             L +  FHQCV L                     
Sbjct: 355 -------KILQNDSQ-----------FLSNAHFHQCVSLDSLHLQSAEDDDGDDNANVNE 396

Query: 265 -------ETEKIITFIPPDGDFELMNYRLSTSIK--PLI---WCDMNVQVHSNSRIEIHC 312
                  + +K I FIPPDGDF L  Y L   +K  P+I     D+  ++ S  +++IH 
Sbjct: 397 NENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL-SKYKLKIHV 455

Query: 313 RAKAQIKKKSTATNVEILIPVP--------EDADTPNFKYSHGSIKWVPEKSAILWKIRS 364
             +   K  +  + + + IP+         + +    FK   G + +    + ++W+I S
Sbjct: 456 IIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWEIGS 515

Query: 365 FPGGK---EYSMAAEL 377
             GG      SM AE 
Sbjct: 516 MKGGHGEVTMSMMAEF 531

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 38/46 (82%)

Query: 395 VQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 440
           +++ F+IPY+T SG+++ YLKI EP+LQY+S+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 51/84 (60%), Gaps = 3/84 (3%)

Query: 56  QYLFIQHSDIYLVAIT-NLLRTNIAEVFAFLYKIIDVLGDYLKT--VEEESIRDNYVIIY 112
           Q+L I+   +  V+I  N    ++  +F++L +   +L  YL    +++  + DN++++ 
Sbjct: 77  QFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLKSYLNVTKLDKGLLIDNFLLVM 136

Query: 113 ELLDELMDYGIPQITETKMLKQYI 136
           ELLDE +D+GI Q T++ ++K YI
Sbjct: 137 ELLDESLDFGIVQFTDSSLIKDYI 160

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 95/243 (39%), Gaps = 56/243 (23%)

Query: 77  NIAEVFAFLYKIIDVLGDYLK--TVEEESIRDNYVIIYELLDELMDYGIPQITETKMLKQ 134
           N  E F FL  +  +L  Y     ++   I  NY  +  L + ++D G P IT+   LK+
Sbjct: 91  NPVEPFVFLQTVDTILNQYFGKDVLKASKITKNYDRVTLLFNSMVDAGEPDITDLNRLKE 150

Query: 135 YI-------------------TQXXXXXXXXXXXXXXXXRPPSALT-----DSVSWRSEG 170
            +                   T                 R  S+++      +V WRS G
Sbjct: 151 IVPLKNNFARVINSTASSIGKTISNAEGNQMFSKHSSNSRIGSSVSYANRDRTVPWRSAG 210

Query: 171 IKYKKNEAFLDIVESINMLMTQKGQI-----LRSEILGVVKIKSRLSGMPDLKLGINDKG 225
           +KY  NE ++D+ E++N+++ +         +   I G V  K  LS  P ++L +N  G
Sbjct: 211 VKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSIDGEVGFKCYLSENPLVELDLNTNG 270

Query: 226 IFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRL--SKFETEKIITFIPPDGDFELMN 283
                                  +L    FH+CVR   S F     + FIPPDGDF LM 
Sbjct: 271 ----------------------HDLGIPAFHRCVRTEGSDFH-PGTLRFIPPDGDFCLME 307

Query: 284 YRL 286
           Y +
Sbjct: 308 YNI 310

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 87/337 (25%), Positives = 136/337 (40%), Gaps = 56/337 (16%)

Query: 1   MASAIYFCDIKGRPLLSRKYRDDIP------LTAIDKFASLLADLEEESSVIPPCLTYNN 54
           M  A Y CD K + L+ +   D I       LT I      + D+E   +V      Y  
Sbjct: 1   MYIAFYICDTKNQ-LVFQYLCDSIAPHFSKLLTRIHSLCPEVLDVETRGNVSKDLKIYR- 58

Query: 55  TQYLFIQHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLK--TVEEESIRDNYVIIY 112
               F   +++   A+T + R +  E    L  I  +L +Y     +    I +NY  + 
Sbjct: 59  ---YFSATNNLNYYALTIVSRHHDLEPHHVLESIDTLLVEYFNKTNLTTTKIMNNYDRMT 115

Query: 113 ELLDELMDYGIPQITETKMLKQY----ITQXXXXXXXXXXXXXXXXRPPSALTDS--VSW 166
            L D L+D GI       M K      +                  + PS   D+  V W
Sbjct: 116 ILFDLLIDGGIIDGNNFYMNKLRNQIPLKNDFSNFINDAAKSLQKGQAPSKTVDNEVVPW 175

Query: 167 RSEGIKYKKNEAFLDIVESINMLM------TQKGQILRSEILGVVKIKSRLSGMPDLKLG 220
           RS+ IK  +NE ++D+ E++ + +      + + ++L   I G V + S + G+P L++ 
Sbjct: 176 RSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPMLEVS 235

Query: 221 INDKGIFSKQLTEDDTNNNATSKKQNKIELEDL--KFHQCVRLSKFETE--KIITFIPPD 276
                                       + +D+  KFH CV +++F T    II FIPPD
Sbjct: 236 FGG------------------------CDFKDIIPKFHDCVEVNEFLTNDGNIIKFIPPD 271

Query: 277 GDFELMNYR--LSTSIKPLIWCDM-NVQVHSNSRIEI 310
           G F+LM Y   LS+    LI C+  N   +SN   EI
Sbjct: 272 GKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDEFEI 308

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 67/137 (48%), Gaps = 27/137 (19%)

Query: 155 RPPSALTDSVSWRSEGIKYKKNEAFLDIVESINMLMTQK---GQI--LRSEILGVVKIKS 209
           + P+A    V WRS G+KY  NE ++D+VE++++++ +    G++  +R  + GVV  +S
Sbjct: 177 KGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRS 236

Query: 210 RLSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKI 269
            LSG P + L +  +G                       +L     HQC   S       
Sbjct: 237 HLSGNPVIALNLRLRGH----------------------DLGMPALHQCCLDSYQGRPDQ 274

Query: 270 ITFIPPDGDFELMNYRL 286
           + F+PPDG F+LM+Y +
Sbjct: 275 LRFVPPDGKFQLMHYSI 291

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 75/161 (46%), Gaps = 40/161 (24%)

Query: 156 PPSALTD------SVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKS 209
           P S+L D       V WR  GI Y  NE F+D+ E IN ++ +KG++L   I G + + +
Sbjct: 196 PGSSLVDHSVDESGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNN 254

Query: 210 RLSGMP--DLKLGINDKGI------FSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRL 261
            LSG P  ++KLG+ D  +      F + + ED  N+           + DL   +  +L
Sbjct: 255 HLSGQPLVEMKLGLLDHKLSHLNTTFHRCILEDKANS-----------INDLIAGKFTKL 303

Query: 262 SKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQV 302
                    TF+PPDG   L  Y L     PL+  D N+ +
Sbjct: 304 ---------TFVPPDGRTRLCQYTL-----PLVKRDSNLGI 330

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 59/130 (45%), Gaps = 26/130 (20%)

Query: 163 SVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQ---ILRSEILGVVKIKSRLSGMPDLKL 219
           +V WR+   +Y  NE ++D+VE++N  + QKG    ++   + G + +K  LSG P ++L
Sbjct: 139 TVPWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQL 198

Query: 220 GINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDF 279
            +   G                        L++   H+CV L +      + F+PPDG F
Sbjct: 199 KLRTSG----------------------HPLDNSALHRCVELGEAGV-ATMNFVPPDGRF 235

Query: 280 ELMNYRLSTS 289
            L  Y +  S
Sbjct: 236 TLAEYAIDLS 245

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 68/141 (48%), Gaps = 38/141 (26%)

Query: 163 SVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQ----------ILRSEILGVVKIKSRLS 212
           +V WR   + +  NE +LD+VESI++++  K +          I+   I+G   +KS L+
Sbjct: 201 AVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLN 260

Query: 213 GMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRL------SKFET 266
           G P +++ I+  G                       +LE +  H+CV+        +FE 
Sbjct: 261 GNPIVEMKIDMAGN----------------------DLESIFLHECVKSKDVDKDQEFEN 298

Query: 267 EKIITFIPPDGDFELMNYRLS 287
            K+I F+PPDG F+L +Y ++
Sbjct: 299 TKLIKFLPPDGSFKLFDYNIN 319

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 85/325 (26%), Positives = 136/325 (41%), Gaps = 82/325 (25%)

Query: 162 DSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILR----------SEILGVVKIKSRL 211
           D V WR+ G+KY  NE ++D+ ESI+++  + G+  R            I G   +K  L
Sbjct: 209 DVVPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYL 268

Query: 212 SGMP--DLKLGI--NDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFE-- 265
           SG P  DL+L +  ND G+ +                          FH+CV L   +  
Sbjct: 269 SGNPTVDLQLDLAGNDLGVPA--------------------------FHECVELDNHQNP 302

Query: 266 TEKIITFIPPDGDFELMNY------------RLSTSIKPLIWCDMNVQVHSNS-RIEI-- 310
           +   + FIPPDG F LM Y            R       L+  D   Q+ + +   EI  
Sbjct: 303 SNCDLRFIPPDGRFNLMQYSIDLDTPRIQQTRRFNHTVGLVTIDFADQLGNKTDEFEITV 362

Query: 311 ---HCRAKAQIKKKSTATNVEILIPVPEDADTPNFKY-----SHGSI--KWVPEKSAILW 360
              + R  A I  +    +V++     ED++T +FK      +HG      VP + + ++
Sbjct: 363 NISNSREVANI--EDLRIDVQLQSNTDEDSET-DFKIKVLRNTHGRFDNSVVPGQGSWIF 419

Query: 361 KIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEPK 420
             +  P G    +    C+ ST  +   VQ    V   + +     SGI+V+ + I +  
Sbjct: 420 D-KDTPTGTLPVLRG--CVESTEPRLLRVQR---VTASYSLSGQLASGIRVKAINIGQ-- 471

Query: 421 LQYKS---YPWVRYITQSGDDYTIR 442
           L  KS   +  V+Y T++G D+ IR
Sbjct: 472 LTTKSNRPFKGVKYATKTG-DFEIR 495

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 27/128 (21%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLM--TQK-GQIL--RSEILGVVKIKSRLSGMPDLK 218
           V WR+ G+KY  NE ++D+VE+I++++  T+K GQ++  R  I G V  +S L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGD 278
           L +N  G                       +L     H C +     + + + F+PPDG 
Sbjct: 246 LKLNLHGH----------------------DLGVPALHPCCQAQYTGSPENLQFVPPDGK 283

Query: 279 FELMNYRL 286
           F LM Y +
Sbjct: 284 FRLMQYTI 291

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 63/136 (46%), Gaps = 28/136 (20%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINML-----MTQKGQILRSEILGVVKIKSRLSGMPDLK 218
           V WRS  +KY  +E ++DI+E+++++          Q++   I G V +KS LSG P ++
Sbjct: 192 VPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE 251

Query: 219 LGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGD 278
           + ++  G                       E+     HQCV + +      + FIPPDG+
Sbjct: 252 MDMDLAG----------------------NEMYAPSMHQCVEMPQGSPSS-LCFIPPDGN 288

Query: 279 FELMNYRLSTSIKPLI 294
             L+NY +   + P +
Sbjct: 289 CNLLNYTIDLDMNPKV 304

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 73/146 (50%), Gaps = 30/146 (20%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMTQKG------------------QILRSEILGVV 205
           V WRS  +KY  NE ++D++E I+++  ++                   +++R++I+G +
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 206 KIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFE 265
            ++S LS  P +++ + D+  +S Q T    N+     KQ  + L    FH CV +  +E
Sbjct: 316 NVRSYLSDNPMVEVTLVDRN-YSDQKTGWSEND---LFKQLNLGLP--MFHDCVEID-YE 368

Query: 266 TE-----KIITFIPPDGDFELMNYRL 286
                  + I FIPPDG F LM Y +
Sbjct: 369 KGINQDFRHIKFIPPDGKFSLMKYNI 394

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 69/133 (51%), Gaps = 30/133 (22%)

Query: 162 DSVSWR-SEGIKYKKNEAFLDIVESINMLMTQKGQILR---SEILGVVKIKSRLSGMPDL 217
           D V WR S+  K++ NE ++D++E+ ++++ +K   LR    +I G V ++S L+  P +
Sbjct: 197 DIVPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLV 256

Query: 218 KLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLS---KFETEKIITFIP 274
            + +N  G                    N+I +  L  H+CV ++   +F T   ITFIP
Sbjct: 257 SVKLNTMG--------------------NEIGIPSL--HECVEINDDGEF-TPSNITFIP 293

Query: 275 PDGDFELMNYRLS 287
           PDG F L+ Y ++
Sbjct: 294 PDGKFRLLEYSIN 306

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/319 (20%), Positives = 115/319 (36%), Gaps = 74/319 (23%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMTQKG---------------QILRSEILGVVKIK 208
           V WR  GIK  K E ++D+ E + +   +                 +++   I G + ++
Sbjct: 189 VPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVR 248

Query: 209 SRLSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLS------ 262
             L+G P + L      +F       DT  N         +L    FH CV         
Sbjct: 249 CYLNGNPTVSL------MF-------DTMGN---------DLGIPSFHACVEQEDQVQEQ 286

Query: 263 -------KFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMN----VQVH-------- 303
                   F+ ++++ F+PPDG F L  Y +    +  +   M+    +QV         
Sbjct: 287 KQEQEPESFQGKRLLRFLPPDGKFRLAQYVIDLDGQGGMSRRMDRDGLIQVSFEDGLGLN 346

Query: 304 -SNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKI 362
                + +H R    +        V +      D++    + +HG+     E     W+ 
Sbjct: 347 KDEFEVRLHVRESIAVVDPVEDLVVTLQFSNGNDSNVKMLRATHGTFVGQDEDRQCSWRF 406

Query: 363 RSFPGGKEYSMAAELCLPSTSSKSEEVQNKK-----PVQVKFQIPYFTTSGIQVRYLKIN 417
            S     E S      L      S+ VQ KK      V V++  P    SG +V  L ++
Sbjct: 407 DS----DEISAGTLPVLRGCIDDSKHVQQKKRSCLTSVAVRYGYPGELASGCRVTRLDVD 462

Query: 418 --EPKLQYKSYPWVRYITQ 434
              P+++ K +  VR +T+
Sbjct: 463 VASPRVRGKVFKGVRCVTR 481

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 67/142 (47%), Gaps = 42/142 (29%)

Query: 166 WRSEGIKYKKNEAFLDIVESINMLMTQK--------------GQILRSEILGVVKIKSRL 211
           WRS+ +K+  NE ++D+VES++++   K               +I+   + G   ++S L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 212 SGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKF------E 265
           +G P ++L +        +L+ +D  + +              FH+CV + ++       
Sbjct: 263 NGNPLVELQL--------ELSGNDIGHPS--------------FHECVDIDEYLKNIDNS 300

Query: 266 TEKIITFIPPDGDFELMNYRLS 287
           +   + FIPPDG F LM+Y ++
Sbjct: 301 SISSLKFIPPDGKFTLMDYTIT 322

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 65/135 (48%), Gaps = 29/135 (21%)

Query: 164 VSWR-SEGIKYKKNEAFLDIVESINMLMTQKGQILR---SEILGVVKIKSRLSGMPDLKL 219
           V WR S   K++ NE ++D++E+ +++  +K   LR     I G+V ++S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 220 GINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLS-KFETEKIITFIPPDGD 278
            +N  G                    N I +  L  H CV ++    +   ITFIPPDG 
Sbjct: 259 KLNTMG--------------------NDIGIPSL--HDCVEINDGVFSPSNITFIPPDGK 296

Query: 279 FELMNYR--LSTSIK 291
           F L+ Y   LS+ +K
Sbjct: 297 FRLLEYSVDLSSQVK 311

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/324 (22%), Positives = 128/324 (39%), Gaps = 82/324 (25%)

Query: 164 VSWR-SEGIKYKKNEAFLDIVESINMLMTQKGQILR---SEILGVVKIKSRLSGMPDLKL 219
           V WR S   K++ NE +LD++E+ +++  +K   +R     I G + ++S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFE--TEKIITFIPPDG 277
            +N  G                    N I +  L  H+CV ++     +   ITFIPPDG
Sbjct: 259 KLNTMG--------------------NDIGIPSL--HECVEINDGGVFSPSNITFIPPDG 296

Query: 278 DFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKST----ATNVEILIPV 333
            F L+ Y +    + +      V++ S   + +H   +  + K S     + N+E L  V
Sbjct: 297 KFRLLEYCVDLDSQVI---KSGVRMKSIGLVSLH--FQNGLGKDSDEFELSLNIENLKNV 351

Query: 334 P-------------EDADTPNFKY-------SHGSI---------KWVPEKSAILWKIRS 364
                         E++D+    Y       +HG           +W+ +KS     +  
Sbjct: 352 SQVDDLKLDLQFNVENSDSNEVAYKIKILRNTHGRFENSIIMGQGQWIFDKSTATGTVPV 411

Query: 365 FPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYF--TTSGIQVRYLKINEP--- 419
             G          C+   + +S + +N     V  +  Y   + SGI V  + I      
Sbjct: 412 LHG----------CIEYETGRSNDQKNVDLQTVSLEYSYVGQSASGIYVEAIDILSGLTI 461

Query: 420 KLQYKSYPWVRYITQSGDDYTIRL 443
               K Y   +Y TQ+G DY +RL
Sbjct: 462 GKNTKLYKGAKYKTQTG-DYQVRL 484

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 63/130 (48%), Gaps = 30/130 (23%)

Query: 164 VSWR-SEGIKYKKNEAFLDIVESINMLMTQKGQILR---SEILGVVKIKSRLSGMPDLKL 219
           V WR S+  K++ NE ++D++E+ +++   K   LR     I G V ++S L+  P + +
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 220 GINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKFETEKI---ITFIPPD 276
            +N  G                    N I +  L  H+CV + K + E +   ITFIPPD
Sbjct: 259 KLNTMG--------------------NDIGVPTL--HECVEI-KDDGEFLPSNITFIPPD 295

Query: 277 GDFELMNYRL 286
           G F L+ Y +
Sbjct: 296 GKFRLLEYSV 305

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 65/129 (50%), Gaps = 8/129 (6%)

Query: 12  GRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFIQHSDIYLV 68
           G+PLLSR++R+   D  L  +  F SL+ +L  E + +      N+ +Y++    D Y++
Sbjct: 13  GKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFVEG----NHVRYVYRPFDDYYII 68

Query: 69  AITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYGIPQITE 128
            ITN  ++NI E  + L  +   + + L + +E  I D+   I    DE++  G  +   
Sbjct: 69  LITNR-QSNIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVIMGYKENLS 127

Query: 129 TKMLKQYIT 137
           +  +  Y+T
Sbjct: 128 STQVTTYLT 136

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 61/122 (50%), Gaps = 8/122 (6%)

Query: 4   AIYFCDIKGRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           A+     KG+PLLSR++RD   D  +  +  F +L+A+  ++ + +       + +Y++ 
Sbjct: 5   AVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSSKQHTFVED----EHVRYVYK 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
              D Y++ ITNL  +NI +    L   +  +   LK + EE + D+   I    DE++ 
Sbjct: 61  PFDDYYIILITNL-HSNIIQDMDTLNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDEIIT 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 67/150 (44%), Gaps = 46/150 (30%)

Query: 162 DSVS-WRS-EGIKYKKNEAFLDIVESINMLMTQK-----------------GQI--LRSE 200
           DSV+ WR+ + I   +NE + D+ E I ++  +K                 G +  +R  
Sbjct: 222 DSVAPWRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGN 281

Query: 201 ILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCV- 259
           I G V ++  L+G P +++ +                      KQ  +++    FH CV 
Sbjct: 282 ISGSVDMRCFLTGNPLVEIAL----------------------KQGGLDIGIPGFHDCVD 319

Query: 260 RLSKFETEKI--ITFIPPDGDFELMNYRLS 287
           + S  + EKI  ++FIPPDG F LM Y ++
Sbjct: 320 KTSLLKQEKISKLSFIPPDGRFTLMQYNIN 349

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 60/129 (46%), Gaps = 8/129 (6%)

Query: 12  GRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFIQHSDIYLV 68
           G+PLLSR++ D   D  +  +  F  L+A    E + +       + +YL+    D YL+
Sbjct: 13  GKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVED----EHVRYLYKPFDDYYLI 68

Query: 69  AITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYGIPQITE 128
            ITN  ++NI +  + L      +  YL + +E  I +N   I    DE++  G  +   
Sbjct: 69  IITNR-QSNIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDEIIVMGYKENLT 127

Query: 129 TKMLKQYIT 137
              ++ Y+T
Sbjct: 128 MAQVETYLT 136

>NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa]
           {ON} Anc_3.575 YFR051C
          Length = 540

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 12  GRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFIQHSDIYLV 68
           G+PLLSR++RD   D  +  +  F  L+A++  + + +       + +Y++    D Y++
Sbjct: 13  GKPLLSRQFRDLTKDRVMELLSNFQGLVANISSDHTFVED----EHVRYVYKPFDDYYII 68

Query: 69  AITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYG 122
            ITN  ++NI +  + L      +   L   +E  I DN   I    DE++  G
Sbjct: 69  LITNR-QSNIVQDLSTLNLFSQTVNSSLSNFDENEIYDNAFEILSSFDEIVVMG 121

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 4   AIYFCDIKGRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           A+      G+PLLSR++RD   D  +  +  F +L+A    E + +       + +Y++I
Sbjct: 5   AVSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHTFV----EEEHVRYIYI 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
              D Y++ ITN  ++NI +    L      +   LK   EE + ++   I    DE++ 
Sbjct: 61  PFDDYYIILITN-RQSNIIQDMDTLNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDEIIS 119

Query: 121 YG 122
            G
Sbjct: 120 LG 121

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 64/137 (46%), Gaps = 8/137 (5%)

Query: 4   AIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLE---EESSVIPPCLTYNNTQYLFI 60
           A+     +G+PLLSR++RD     + D+   LL++ +    +SS     +   + +Y++ 
Sbjct: 101 AVSIVTRQGKPLLSRQFRD----ISKDRVTELLSNFQGLVAKSSSQHTFVEDEHVRYVYK 156

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
              D Y++ ITN  ++NI +    L      +  YL + +E  I +N   I    DE++ 
Sbjct: 157 PFDDYYIILITNR-QSNIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDEVIT 215

Query: 121 YGIPQITETKMLKQYIT 137
            G  +      +  Y++
Sbjct: 216 MGYKENLSISQINTYLS 232

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 63/129 (48%), Gaps = 8/129 (6%)

Query: 12  GRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTY---NNTQYLFIQHSDIYLV 68
           G+PLLSR++R+   LT  D+   LL++ +   S I    T+    + +Y++    D Y++
Sbjct: 13  GKPLLSRQFRE---LTK-DRVMELLSNFQGLVSSISSDHTFVEDEHVRYVYKPFDDYYII 68

Query: 69  AITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYGIPQITE 128
            ITN  ++NI +  + L      +  YL + +E  + DN   I    DE++  G  +   
Sbjct: 69  LITNR-QSNIIQDLSTLNLFSQTVNSYLSSYDETELYDNAFEILSSFDEIVVMGYKENLT 127

Query: 129 TKMLKQYIT 137
              +  Y++
Sbjct: 128 AAQVSTYLS 136

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 59/115 (51%), Gaps = 8/115 (6%)

Query: 11  KGRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFIQHSDIYL 67
           +G+PLLSR+++D   D  L  +  F +L++++  + + +       + +Y++    + Y+
Sbjct: 12  QGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYRPFDNYYI 67

Query: 68  VAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYG 122
           + ITN  ++NI +  A L      +  YL + +++ I  N   I    DE++  G
Sbjct: 68  ILITNR-QSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 121

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 59/115 (51%), Gaps = 8/115 (6%)

Query: 11  KGRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFIQHSDIYL 67
           +G+PLLSR+++D   D  L  +  F +L++++  + + +       + +Y++    + Y+
Sbjct: 12  QGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYRPFDNYYI 67

Query: 68  VAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYG 122
           + ITN  ++NI +  A L      +  YL + +++ I  N   I    DE++  G
Sbjct: 68  ILITNR-QSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 121

>Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)
          Length = 546

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 58/115 (50%), Gaps = 8/115 (6%)

Query: 11  KGRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFIQHSDIYL 67
           +G+PLLSR+++D   D  L  +  F +L+A++  + + +       + +Y++    + Y+
Sbjct: 12  QGKPLLSRQFKDLSKDRVLELLANFQNLVAEISSDHTFVED----KHVRYVYRPFDNYYI 67

Query: 68  VAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYG 122
           + ITN  ++NI +  A L      +  YL +  ++ I  N   I    DE++  G
Sbjct: 68  ILITNR-QSNIIKDLATLNLFSQTINSYLSSFHDQEIFHNAFEILSSFDEIVSMG 121

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 61/151 (40%), Gaps = 52/151 (34%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESI-----NMLMTQKGQ-------------------ILRS 199
           V WR+  IK  KNE ++D+ E I     N +  +KG+                   ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 200 EILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCV 259
            I GV+ ++S L+G P +++ +N  G           N+  T              H CV
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLNTCG-----------NDMGTP-----------SLHPCV 356

Query: 260 RLS---KFETEKI---ITFIPPDGDFELMNY 284
            L      + +K+   + FIPPDG F L  Y
Sbjct: 357 ELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR051C
           (RET2)
          Length = 532

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 4   AIYFCDIKGRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           A+      G+PL+SR+++D   D  +  +  F  L+A+   + + +       + +Y++ 
Sbjct: 5   AVSITTRSGKPLVSRQFKDISRDRIMELLSNFQGLVANSSRQHTFVEE----EHVRYVYK 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
              D Y++ ITN  ++NI +    L      +  +LK   E+ I DN   I    DE++ 
Sbjct: 61  PFDDYYIILITNR-QSNIIQDMDTLNLFSQTVNSHLKGFSEDEILDNAFDILGSFDEIIS 119

Query: 121 YG 122
            G
Sbjct: 120 LG 121

>Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]
           {ON} YFR051C (RET2) - vesicle coat component [contig
           344] FULL
          Length = 538

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 64/137 (46%), Gaps = 8/137 (5%)

Query: 4   AIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLE---EESSVIPPCLTYNNTQYLFI 60
           A+     +G+PLLSR++R+     + D+   LL++ +    +SS     +   + +Y++ 
Sbjct: 5   AVSIVTRQGKPLLSRQFRE----ISKDRVTELLSNFQGLVAKSSSQHTFVEDEHVRYVYK 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
              D Y++ ITN  ++NI +    L      +  YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYIILITNR-QSNIIQDLDTLKIFSQTMNTYLSSFDEHEIFENAFEILSSFDEVIT 119

Query: 121 YGIPQITETKMLKQYIT 137
            G  +      +  Y++
Sbjct: 120 MGYKENLSMTQINTYLS 136

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query: 12  GRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFIQHSDIYLV 68
           G+PLLSR++R+   D  L  +  F SL+ ++  + + +       + +Y++    D Y++
Sbjct: 13  GKPLLSRQFREITKDRVLELLSNFQSLVTNISSDHTFVED----EHVRYVYRPFDDYYII 68

Query: 69  AITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYG 122
            ITN  ++NI    + L      +  YL + +E  I +N   I    DE++  G
Sbjct: 69  LITNR-QSNIIMDLSTLNLFSQTVNSYLSSYDEAEIFENAFEILSSFDEIVVMG 121

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query: 172 KYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQL 231
           K   N   + I E++N  +T+ G I  SE+ GV            L+L +ND+ +   +L
Sbjct: 276 KPANNGILISIKETVNAEITRDGAISSSELKGV------------LELRVNDRSLAHAKL 323

Query: 232 TEDDT 236
           T DD+
Sbjct: 324 TLDDS 328

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 50/128 (39%), Gaps = 27/128 (21%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLMTQKG----QILRSEILGVVKIKSRLSGMPDLKL 219
           V WR   +    NE ++D+VE++ + + Q       +    I G + +K  L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 220 GINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVR-LSKFETEKIITFIPPDGD 278
            ++  G                         +    H+C+   S       + FIPPDG 
Sbjct: 255 NLHSAGH----------------------AFKPSALHRCLDPSSSSFDSSSLRFIPPDGK 292

Query: 279 FELMNYRL 286
           F L+ Y +
Sbjct: 293 FTLLEYTI 300

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 58/115 (50%), Gaps = 8/115 (6%)

Query: 11  KGRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFIQHSDIYL 67
           +G+PLLSR+++D   D  L  +  F +L+ ++  + + +       + +Y++    + Y+
Sbjct: 65  QGKPLLSRQFKDLSKDRVLELLSNFQNLVTEISSDHTFVED----KHVRYVYRPFDNYYI 120

Query: 68  VAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYG 122
           + ITN  ++NI +  + L      +  YL + +++ I  N   I    DE++  G
Sbjct: 121 ILITNR-QSNIIKDLSTLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 174

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 545

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 56/122 (45%), Gaps = 8/122 (6%)

Query: 4   AIYFCDIKGRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60
           A+      G+PLLSR++RD   D     +  F  L+A+   + + +       + +Y++ 
Sbjct: 5   AVSITTRSGKPLLSRQFRDISKDRVTELLSNFQGLVANSSSQHTFVED----EHVRYVYK 60

Query: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120
              D Y++ ITN  ++NI +    L      +   L++ +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYIILITN-RQSNIIQDLDTLNLFSQTVNSSLRSFDENEIFENAFEILGSFDEIIA 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 62/129 (48%), Gaps = 8/129 (6%)

Query: 12  GRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFIQHSDIYLV 68
           G+PLLSR++ +   D  +  +  F  L+A++  + + +       + +Y++    D YL+
Sbjct: 13  GKPLLSRQFVEMSKDRVMELLSNFQGLVANISSDHTYVED----EHVRYVYKPFDDYYLI 68

Query: 69  AITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYGIPQITE 128
            +TN  ++NI +  + L      +  YL + +E  I +N   I    DE++  G  +   
Sbjct: 69  LMTNR-QSNIIQDLSTLNLFSQTVNYYLNSFDENEIFENAFEILSSFDEIIVMGHKENLT 127

Query: 129 TKMLKQYIT 137
            + +  YI+
Sbjct: 128 IQQVNNYIS 136

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 58/140 (41%), Gaps = 38/140 (27%)

Query: 164 VSWRSEGIKYKKNEAFLDIVESINMLM-------TQKG-----QILRSEILGVVKIKSRL 211
           V WRS  +  ++NE ++D+ ES+ +++       T +G     Q++   I GVV  +  L
Sbjct: 206 VPWRSAKVNSRRNEFYVDVRESVEVVVERAAHRSTSRGTPAPLQLVTGCITGVVDCRCYL 265

Query: 212 SGMPDLKLGINDKGIFSKQLTEDDTNNNATSKKQNKIELEDLKFHQCVRLSKF----ETE 267
           S  P +++  N+ G                       +L     H CV L          
Sbjct: 266 SRDPIVEVTFNNHG----------------------CDLGTPALHDCVELDGVPEGPADH 303

Query: 268 KIITFIPPDGDFELMNYRLS 287
             + FIPPDG F LM Y ++
Sbjct: 304 TTLKFIPPDGKFRLMEYSVT 323

>CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051c RET2
          Length = 536

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 62/129 (48%), Gaps = 8/129 (6%)

Query: 12  GRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFIQHSDIYLV 68
           G+PLLSR++R+   +  +  +  F  L++++  + +     L   + +Y++    + Y++
Sbjct: 13  GKPLLSRQFRELTKERTMELLSNFQGLVSNISSDHTF----LEDEHVRYVYRPFDNYYII 68

Query: 69  AITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYGIPQITE 128
            ITN  ++NI +  + L      +  YL + +E  I DN   I    DE++  G  +   
Sbjct: 69  LITNR-QSNIIQDLSTLNLFSSTVNSYLASYDELEIFDNSFEILSSFDEIVTMGYKENLS 127

Query: 129 TKMLKQYIT 137
              ++ Y+ 
Sbjct: 128 ISQVETYLA 136

>KNAG0D03000 Chr4 complement(537905..539596) [1692 bp, 563 aa] {ON}
           Anc_3.575 YFR051C
          Length = 563

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 66/133 (49%), Gaps = 10/133 (7%)

Query: 4   AIYFCDIKGRPLLSRKYRD---DIPLTAIDKFASL-LADLEEESSVIPPCLTYNNTQYLF 59
           A     + G+ LLSR+++D   D  L  +  F++L LA    + + +       + ++++
Sbjct: 5   AASITTLGGKALLSRQFKDLSRDRVLELLSNFSNLALASSGTDHTYVED----EHVRFVY 60

Query: 60  IQHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELM 119
               D Y+V +TN  ++NI    A L    + +G Y+  V E+ + DN   I    DE++
Sbjct: 61  KPLDDYYIVLVTNR-QSNIIRDLATLNLFAETVGVYVSGVPEDGVFDNAFEILSAFDEIV 119

Query: 120 DYGI-PQITETKM 131
             G   Q+++T++
Sbjct: 120 VMGHKEQLSQTQV 132

>Kwal_0.348 s0 (164816..165214) [399 bp, 132 aa] {OFF} [contig 88]
           FULL
          Length = 132

 Score = 35.4 bits (80), Expect = 0.070,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 15/92 (16%)

Query: 257 QCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEI------ 310
           QC R SK    K++ ++    +F  M YR S++      C  N +V +++RI+I      
Sbjct: 36  QCARKSKATVAKLVNWLIFSTEFTSMRYRKSSN------CKENSKVCNSTRIDIRLLGWS 89

Query: 311 HCRAKAQIKKKSTATNVEILIPVPEDADTPNF 342
           H    ++  K S    + + IP PE    P+F
Sbjct: 90  HRSQSSKFIKMSKMQLMALFIPTPE---KPSF 118

>Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}
           complement(21263..22870) [1608 nt, 536 aa]
          Length = 535

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query: 12  GRPLLSRKYRD---DIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFIQHSDIYLV 68
           G+PLLSR++ +   D  +  +  F  L+A++  + + +       + +Y++    D YL+
Sbjct: 13  GKPLLSRQFTEITKDRVMELLSNFQGLVANISSDHTYVES----EHVRYVYKPFDDYYLI 68

Query: 69  AITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYG 122
            +TN  ++NI +  + L      +  YL + +E  I +N   I    DE++  G
Sbjct: 69  LVTNR-QSNIIQDLSTLNLFSQTVNYYLNSFDEGEIFENAFEILSSFDEIIVMG 121

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 33.9 bits (76), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 57/114 (50%), Gaps = 8/114 (7%)

Query: 12  GRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTY---NNTQYLFIQHSDIYLV 68
           G+PLLSR++++   LT  ++   LL++ +   S      TY    + +Y++    D YL+
Sbjct: 13  GKPLLSRQFKE---LTK-ERVIELLSNFQGLVSKSSSDHTYVEDEHVRYVYRPFDDYYLI 68

Query: 69  AITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMDYG 122
            +TN  ++NI +  + L      +  YL + +EE I  N   I    DE++  G
Sbjct: 69  LVTNR-QSNIIQDLSTLNLFSQSVNYYLNSFDEEEIFINAFEILSSFDEIIVMG 121

>TBLA0B00370 Chr2 (68828..69868) [1041 bp, 346 aa] {ON} 
          Length = 346

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 15/76 (19%)

Query: 171 IKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQ 230
           ++   +E F+D+V           QILR E+    ++  R  G   +  G+N++   S+ 
Sbjct: 153 LRSNVDEVFVDLVR----------QILRDELAAQQEV--RTHGHSAIGNGVNNRSNSSRS 200

Query: 231 LTEDDTNNNATSKKQN 246
           +    TNNNA+S++QN
Sbjct: 201 VL---TNNNASSRQQN 213

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,784,857
Number of extensions: 2032603
Number of successful extensions: 7035
Number of sequences better than 10.0: 119
Number of HSP's gapped: 6988
Number of HSP's successfully gapped: 176
Length of query: 444
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 331
Effective length of database: 40,524,141
Effective search space: 13413490671
Effective search space used: 13413490671
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)