Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E003008.838ON66466429530.0
NCAS0B003108.838ON5645248071e-98
TDEL0B005908.838ON5414455659e-64
Kpol_1068.108.838ON6175105182e-56
ZYRO0G14146g8.838ON5074864991e-54
TPHA0I002308.838ON6144544925e-53
TBLA0D032508.838ON6835084524e-47
Smik_13.208.838ON5105224445e-47
YML114C (TAF8)8.838ON5105254234e-44
Skud_13.278.838ON5143563952e-40
Suva_13.298.838ON5093563934e-40
Kwal_27.102728.838ON5515153928e-40
Ecym_46098.838ON5203663882e-39
CAGL0B02299g8.838ON6432443897e-39
KAFR0A028208.838ON4533693762e-38
KLTH0C03916g8.838ON5702143424e-33
ABL128W8.838ON4743473323e-32
SAKL0D01518g8.838ON5742153114e-29
KLLA0D01617g8.838ON5624643105e-29
KNAG0G034108.838ON5262282402e-20
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E00300
         (664 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...  1142   0.0  
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   315   1e-98
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   222   9e-64
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   204   2e-56
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   196   1e-54
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   194   5e-53
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   178   4e-47
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   175   5e-47
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   167   4e-44
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   156   2e-40
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   155   4e-40
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   155   8e-40
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   154   2e-39
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...   154   7e-39
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   149   2e-38
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   136   4e-33
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   132   3e-32
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   124   4e-29
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   124   5e-29
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    97   2e-20

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/664 (86%), Positives = 575/664 (86%)

Query: 1   MASANETENYDMNEVQPPREIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLL 60
           MASANETENYDMNEVQPPREIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLL
Sbjct: 1   MASANETENYDMNEVQPPREIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLL 60

Query: 61  VDDQLNSLITELHRLSLLQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGK 120
           VDDQLNSLITELHRLSLLQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGK
Sbjct: 61  VDDQLNSLITELHRLSLLQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGK 120

Query: 121 EYRILRDLNEEVVKQRTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINI 180
           EYRILRDLNEEVVKQRTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINI
Sbjct: 121 EYRILRDLNEEVVKQRTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINI 180

Query: 181 SSWLPSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSI 240
           SSWLPSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSI
Sbjct: 181 SSWLPSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSI 240

Query: 241 APMTIPPSPSLSNEGPITDTDXXXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGT 300
           APMTIPPSPSLSNEGPITDTD               DTVIIPKDIDMNLANEETLAIYGT
Sbjct: 241 APMTIPPSPSLSNEGPITDTDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGT 300

Query: 301 KSQSYEIERDSSSKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFEN 360
           KSQSYEIERDSSSKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFEN
Sbjct: 301 KSQSYEIERDSSSKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFEN 360

Query: 361 KKLRLEKNPFLKLSKLVCLXXXXXXXXXXXXXXXXXRKXXXXXXXXXXRLSPIRKRAQIN 420
           KKLRLEKNPFLKLSKLVCL                 RK          RLSPIRKRAQIN
Sbjct: 361 KKLRLEKNPFLKLSKLVCLEKEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRKRAQIN 420

Query: 421 NEIISNLKRSFYSILNNYPXXXXXXXXXXXXXIEKRDQRLQELRKIQEEERKVKEQKLLT 480
           NEIISNLKRSFYSILNNYP             IEKRDQRLQELRKIQEEERKVKEQKLLT
Sbjct: 421 NEIISNLKRSFYSILNNYPKLKKAKKQRVKLAIEKRDQRLQELRKIQEEERKVKEQKLLT 480

Query: 481 KSENPLLSSNTSIVFSTHPTDIADVEAEGEDGLGLFAGLGSSXXXXXXXXXXXXXXQQTA 540
           KSENPLLSSNTSIVFSTHPTDIADVEAEGEDGLGLFAGLGSS              QQTA
Sbjct: 481 KSENPLLSSNTSIVFSTHPTDIADVEAEGEDGLGLFAGLGSSEEEEEEEEEEEEGEQQTA 540

Query: 541 TTHNVLQQLGSQRKEKEGTMTTTGNTSVKIGEKQTDISVEPNNHETTEGSTQDIRTTEEQ 600
           TTHNVLQQLGSQRKEKEGTMTTTGNTSVKIGEKQTDISVEPNNHETTEGSTQDIRTTEEQ
Sbjct: 541 TTHNVLQQLGSQRKEKEGTMTTTGNTSVKIGEKQTDISVEPNNHETTEGSTQDIRTTEEQ 600

Query: 601 TNVEQAKQKPTDGQGKXXXXXXXXXXXXXXXXXXXXVVTSEFDKPGEDNKSTIVPNTNAD 660
           TNVEQAKQKPTDGQGK                    VVTSEFDKPGEDNKSTIVPNTNAD
Sbjct: 601 TNVEQAKQKPTDGQGKEELEDEEEDDFDDHNFLFEDVVTSEFDKPGEDNKSTIVPNTNAD 660

Query: 661 IELI 664
           IELI
Sbjct: 661 IELI 664

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  315 bits (807), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 208/524 (39%), Positives = 289/524 (55%), Gaps = 108/524 (20%)

Query: 12  MNEVQPPREIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITE 71
           MNE+  P EI  N  D Q+ KLL KSIA+QLK   ++ S+LAFN+L+LLV+DQL+ LI+E
Sbjct: 30  MNELTNPTEIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFLISE 89

Query: 72  LHRLSLLQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEE 131
           LHR+S++QRRN+ AK D+EL +RG N+N S+L+YQ + S +++ K +GK+Y  L      
Sbjct: 90  LHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSK-NGKDYDTL------ 142

Query: 132 VVKQRTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDH 191
                  I +SST  D+ D      + S   + SNILIKP NPF+ I+I +WLP+FPPDH
Sbjct: 143 -------IKDSSTIFDSSDTMANPGHDSMVNNPSNILIKPNNPFE-ISIPNWLPAFPPDH 194

Query: 192 TYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSL 251
           TYKFTPQFN PITD+ LIKQKL+EEG KSEK+LLN L +I+                 S+
Sbjct: 195 TYKFTPQFNKPITDQVLIKQKLIEEGKKSEKSLLNLLNDITEQS--------------SI 240

Query: 252 SNEGPITDTDXXXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDS 311
            NE                             + D  LA EE +AIYG  + S    R  
Sbjct: 241 ENEE--------------------------TSNFDSELAREENIAIYGYDAMS----RKK 270

Query: 312 SSKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFL 371
              P++ISIHD +  NFF H    K F+V  Y+H RVEL RK+VE FE ++L+ EKNPFL
Sbjct: 271 RKPPHLISIHDTE-QNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFL 329

Query: 372 KLSKLVCLXXXXXXXXXXXXXXXXXRKXXXXXXXXXXRLSPIRKRAQINNEIISNLKRSF 431
           +LS+++                               ++S    R+ +  EI ++L+RS+
Sbjct: 330 RLSRMI----------------------------NDKKVS----RSDLKLEIKNSLQRSY 357

Query: 432 YSILNNYPXXXXXXXXXXXXXIEKRDQRLQELRKIQEEERKVKEQKLL------TKSENP 485
            SI  NYP              +KR++++++L+   E+ +K ++ +LL      T  EN 
Sbjct: 358 KSIFRNYPKLKQERDRRLELARQKREEKIEKLKIQNEQLKKDRDAQLLAALSMETSGENT 417

Query: 486 LLSSNTSIV-------FSTHPTDIADVEAEGEDGLGLFAGLGSS 522
              SN + V       FST  T+I DVE   +DG+GLF  L SS
Sbjct: 418 KTESNLTGVNDQKLNEFSTIATNIEDVE---DDGIGLFGDLESS 458

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  222 bits (565), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 144/445 (32%), Positives = 216/445 (48%), Gaps = 103/445 (23%)

Query: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQ 79
           EI H   +  + K+L K++A+QLK  K D SK AF  L +L+DDQLN +I +LHR S +Q
Sbjct: 20  EIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDMIGQLHRFSNVQ 79

Query: 80  RRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHI 139
           RR S+AK D+ L+++G+N+ P+DL+ Q+++S+Y   K  GKE+  L  L E         
Sbjct: 80  RRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYS-KTYGKEFDSLHSLKETFT------ 132

Query: 140 MESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQF 199
            ++   +DN            + D  N L++P NP     I  W+P+FPPDHTYKFTPQ+
Sbjct: 133 -DAVVDEDN-----------GSEDVINELVRPNNPLIRY-IPKWMPAFPPDHTYKFTPQY 179

Query: 200 NNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITD 259
           N PITDE +I++++V+EG +SE ALL+ LKN++             PP+PS   +G    
Sbjct: 180 NQPITDETIIRRRIVDEGKQSEVALLHLLKNMN-------------PPTPSSDADG---- 222

Query: 260 TDXXXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIIS 319
                                     D  L  EET AIYG + +    +R  ++  +   
Sbjct: 223 -----------------------ASYDEALVREETAAIYGNEQK----KRKKNASSSSDL 255

Query: 320 IHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCL 379
           +      N          F + +Y+  RVE+ RKKV  +E ++++L++NPF+K SK+   
Sbjct: 256 LSKLPQTN----------FSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYSKIALS 305

Query: 380 XXXXXXXXXXXXXXXXXRKXXXXXXXXXXRLSPIRKRAQINNEIISNLKRSFYSILNNYP 439
                                          S    R Q   EI S L+RS   ++ + P
Sbjct: 306 NS-----------------------------SDKSGRRQATREIHSMLQRSLQHLIKSIP 336

Query: 440 XXXXXXXXXXXXXIEKRDQRLQELR 464
                         +KRD+RLQELR
Sbjct: 337 ELQMTKQDARRKAEQKRDERLQELR 361

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  204 bits (518), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 156/510 (30%), Positives = 240/510 (47%), Gaps = 128/510 (25%)

Query: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVDFS--KLAFNQLTLLVDDQLNSLITELHRLSL 77
           E  +   +  IEK+L K++A+QLK+   D S  K AF  L  LV  Q++ ++ ELHRLS 
Sbjct: 19  EYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQIDDMVLELHRLSS 78

Query: 78  LQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRT 137
           LQRRN++AK D+ +W+RGFN+ P DL  Q + S+Y+  KL  K+Y       E + K  T
Sbjct: 79  LQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLS-KLYDKDY-------ESLTKIAT 130

Query: 138 HIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTP 197
               + ++    DLT +      +T  ++ L+  +NP + + I SWLP FPPD+TYKFTP
Sbjct: 131 TTTRTLSTYQKLDLTHK----DTSTAQTSKLVPISNPLQKL-IPSWLPDFPPDYTYKFTP 185

Query: 198 QFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPI 257
           Q+N PITDE +I++K+VEEG +SEKALLN L+     +                      
Sbjct: 186 QYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDR---------------------- 223

Query: 258 TDTDXXXXXXXXXXXXXXXDTVIIPKDI-----DMNLANEETLAIYGTKSQSYEIERDSS 312
                                  I +D+     +M LA EETLA Y              
Sbjct: 224 -----------------------ISRDLKFSSSEMELATEETLATYSA------------ 248

Query: 313 SKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLK 372
                I++ ++ + +FF         +V +Y+  RVE+ RKKV  +E ++L++++NPFLK
Sbjct: 249 -----ITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQRNPFLK 303

Query: 373 LSKLVCLXXXXXXXXXXXXXXXXXRKXXXXXXXXXXRLSPIRKRAQINNEIISNLKRSFY 432
           +S+L+                                      ++  N EI   LKRS  
Sbjct: 304 ISRLISANNDNKVS-----------------------------KSVANTEIRKYLKRSLL 334

Query: 433 SILNNYPXXXXXXXXXXXXXIEKRDQRLQELRKIQEEERKVKEQKLLTKSENPLLSSNTS 492
           + +++ P              E++++RL E++ ++EE  K+KE +    S+  LL     
Sbjct: 335 NFIHSIPKTQQERKEARERAEEEKERRLAEIKALKEE--KLKEMEAKKSSDFNLLD---- 388

Query: 493 IVFSTHPTDIADVEAEGEDGLGLFAGLGSS 522
              S +P D     + G    G FA L SS
Sbjct: 389 --LSNYPND-----SHG----GFFAALESS 407

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  196 bits (499), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 141/486 (29%), Positives = 224/486 (46%), Gaps = 106/486 (21%)

Query: 19  REIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLL 78
           +E+ H   +  + K+L KS+A+QLK      ++ AF++L  LVD QLN +I++LHR+S L
Sbjct: 14  QELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDMISQLHRMSNL 73

Query: 79  QRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEY---RILRDLNEEVVKQ 135
           QRR ++AK D+ + M GFNI+PS +  Q   S++  +K   KE+     LRDL   +  +
Sbjct: 74  QRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKY-FKEFNHLHSLRDLQSSLAHE 132

Query: 136 RTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKF 195
                +      N                S +L+ PTNP +   +  WLP FPPDHTYKF
Sbjct: 133 MVPFEDQEAVRQNV---------------STVLVPPTNPLQDF-LPKWLPDFPPDHTYKF 176

Query: 196 TPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEG 255
           TPQ+++PITDE  I++++VEE  +SE A    L ++S  K  T                 
Sbjct: 177 TPQYSHPITDETTIRRQIVEEAKQSELA----LSHLSQKKNPT----------------- 215

Query: 256 PITDTDXXXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKP 315
                                D ++     D  LA +ETLAIYG++ +  + +   ++  
Sbjct: 216 ---------------------DDIVNRSQYDSELAEQETLAIYGSQLKKRKTQHPQANSA 254

Query: 316 NIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSK 375
           +++S                  F V +Y+H+R+E+ RKKV  FE ++L+ +++PFLKLS+
Sbjct: 255 DLLS------------KLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKLSR 302

Query: 376 LVCLXXXXXXXXXXXXXXXXXRKXXXXXXXXXXRLSPIRKRAQINNEIISNLKRSFYSIL 435
           +                                       + Q++ E    L+RSF  ++
Sbjct: 303 IAFTQCNDKFT-----------------------------KKQVHREFQLALQRSFIHLV 333

Query: 436 NNYPXXXXXXXXXXXXXIEKRDQRLQELRKIQEEERKVKEQKLLTKSENPLLSSNTSIVF 495
            + P              E+R +RLQELR  +EE+ K  E+ +L   E   L  N    F
Sbjct: 334 KSIPELERNKLETEEKAKEERSKRLQELRAQREEQEKKGERDVLDLDE---LDQNQEDFF 390

Query: 496 STHPTD 501
           +   +D
Sbjct: 391 AMESSD 396

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  194 bits (492), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 145/454 (31%), Positives = 224/454 (49%), Gaps = 99/454 (21%)

Query: 30  IEKLLQKSIAIQLKAFKVD--FSKLAFNQLTLLVDDQLNSLITELHRLSLLQRRNSMAKV 87
           +E +L K+IA+QLK    D   +K AF  LT LVD+QL+ ++ ++ +L+ LQRR  +AK 
Sbjct: 66  MEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQLSDMVNQMEKLAALQRRKEVAKK 125

Query: 88  DLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEY---RILRDLNE--EVVKQRTHIMES 142
           D++LW+RGFN+ PSDL   ++ S+YI+EK  G+     R+  D NE   V K+    ++ 
Sbjct: 126 DIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLNRLATDTNEVLTVFKKTDKTLK- 184

Query: 143 STSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQFNNP 202
                            D+T  +  L+  TN  + I I  WLPSFPPD+TYKFTPQFN  
Sbjct: 185 ----------------DDSTLETLKLVPITNTLENI-IPDWLPSFPPDYTYKFTPQFNKH 227

Query: 203 ITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITDTDX 262
           ITD  +I++K+  EG KSEKALL+ L+    ++K T+   + +             D+D 
Sbjct: 228 ITDATVIRKKVAAEGKKSEKALLHLLE----SEKITTSKLLNLDK----------FDSD- 272

Query: 263 XXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIISIHD 322
                                  DM+ A  E  A+Y   S       D   +       +
Sbjct: 273 -----------------------DMDTAKLEMDALYSGGSC------DRKKRTAFFEDEE 303

Query: 323 EKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCLXXX 382
           +++V+  G+S+S+ KFD+ KY H R+ +VR KV+ +E+K+LRL+ +PFLK++ L+     
Sbjct: 304 DRMVDEHGNSTSN-KFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPFLKMTALLS---- 358

Query: 383 XXXXXXXXXXXXXXRKXXXXXXXXXXRLSPIRKRAQINNEIISNLKRSFYSILNNYPXXX 442
                                     ++S    R  IN  I + LKRSF  ++N+ P   
Sbjct: 359 ---------------------EQTDKKVS----REVINTNIENVLKRSFLQLINSIPTLN 393

Query: 443 XXXXXXXXXXIEKRDQRLQELRKIQEEERKVKEQ 476
                     + ++ +R  E  K +EE+ K  EQ
Sbjct: 394 QNKKDTRERAMVEKKRRHDEWLKRREEKLKKLEQ 427

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  178 bits (452), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 159/508 (31%), Positives = 243/508 (47%), Gaps = 57/508 (11%)

Query: 30  IEKLLQKSIAIQLKAFK--VDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQRRNSMAKV 87
           I +LL KSIA+QLK        S +AFN+L  LVD QLN +I +L RLS+ QRR ++A  
Sbjct: 60  IGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIASN 119

Query: 88  DLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHIMESSTSDD 147
           DL LW+R FN+NPSDL    E S +I+ K   K+Y +L +L  +   +  H  +    + 
Sbjct: 120 DLSLWLRSFNLNPSDLTLYLEESNFIKSKF-NKDYNLLYELLRDYNTETNHNFK----NP 174

Query: 148 NYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQFNNPITDEK 207
           NY  +    N S  + SS I + P+N     ++  WLPS PPDHTYKFTP +N PITDE 
Sbjct: 175 NYSTSDLLNNKSSESSSSRI-VPPSNTILR-SMPEWLPSLPPDHTYKFTPLYNEPITDET 232

Query: 208 LIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPI-----TDTDX 262
           ++K+ LV EG  +E AL+  L       + ++ + +   P+P    E  +      DT+ 
Sbjct: 233 VMKKILVNEGKLAESALIKLL-------EASTTSEINSLPTPETDRENDLEQNINIDTNT 285

Query: 263 XXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIISIHD 322
                          T    +  D  LA +ET AIYG+  Q  +I++    +  I    +
Sbjct: 286 NGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKK--RFELMIDPKAE 343

Query: 323 EKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCLXXX 382
            ++   F + S+   F+V +Y+  +V+ +R++V  +E K+L+ +KNPF K SK++     
Sbjct: 344 TQLSEEFVYPST---FNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMIVGPSQ 400

Query: 383 ---XXXXXXXXXXXXXXRKXXXXXXXXXXRLSP-----IRKRAQINNEIISNLKRSFYSI 434
                            R             SP     + K+ QIN++I     RS  ++
Sbjct: 401 FHHGPHHHHHHHHHHHRRYSNSSTSSVSSSPSPGLFGGVSKK-QINHDIQQMFNRSLNNL 459

Query: 435 LNNYPXXXXXXXXXXXXXIEKRDQRLQELRKIQEEERKVKEQKLLTKSENPLLSSNTSIV 494
           +N+ P                        R+I E ER+ K Q++L K +  L    +   
Sbjct: 460 INSLPNLAKEKASA---------------REIAENEREKKVQEMLKKKQKELNEKQS--- 501

Query: 495 FSTHPTDIADVEAEGEDGLGLFAGLGSS 522
            S    D+ D++ E +   GLFA LGSS
Sbjct: 502 -SAGALDLHDLQKEND---GLFADLGSS 525

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  175 bits (444), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 150/522 (28%), Positives = 243/522 (46%), Gaps = 130/522 (24%)

Query: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQ 79
           EI+H  +D  + ++L+K++  QL +  +  S  A ++L  LV  Q++ +   LH L+LLQ
Sbjct: 27  EISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVAVQMDGMFRNLHNLTLLQ 86

Query: 80  RRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHI 139
           RR+  ++ DL+L  R FN++ + L  Q++ S++I+      EY        ++V+  +  
Sbjct: 87  RRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSN-HAVEYG-------KLVRLSSFP 138

Query: 140 MESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQF 199
             +   +D  D   +  NI +     N+L+ P+NP + + I SWLP+FPPDHTYKFTP+F
Sbjct: 139 ALAHNEEDEED---ELSNIEEQQSEINVLLPPSNPLEKL-IPSWLPNFPPDHTYKFTPEF 194

Query: 200 NNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITD 259
           N+PITD K IK+++V+E  +SEKALLN  K +S+     S A  T PP        P+ D
Sbjct: 195 NHPITDLKTIKKEIVKESEESEKALLNLNKRLSH----LSSASHTSPP--------PVLD 242

Query: 260 TDXXXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIIS 319
                                   D D   A E+ L I+G   Q    ER    KP I  
Sbjct: 243 ------------------------DAD---ATEQQLEIWGNALQ----ER----KPTIT- 266

Query: 320 IHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCL 379
                       ++S  + ++ +Y+ +RVEL R++V  FE  +L+  KNPFLKLS+ +  
Sbjct: 267 ------------ATSLNESNIEQYAKYRVELARERVAKFELNQLKRTKNPFLKLSETLYF 314

Query: 380 XXXXXXXXXXXXXXXXXRKXXXXXXXXXXRLSPIRKRAQINNEIISNLKRSFYSILNNYP 439
                                           P +    I + I    ++S    ++N P
Sbjct: 315 SE-----------------------------GPHQSHKTIQSAIDLQFRKSMTLFMHNLP 345

Query: 440 XXXXXXXXXXXXXIEKRDQRLQELRKIQEE---ERKVKEQ------KLLTKSEN------ 484
                           +++R + LR+ QEE   ERK +EQ      +LL  +E+      
Sbjct: 346 KVQKLKKERIRM---AKEERAKSLRRRQEELISERKKREQDEGHDLELLLNNEHAREATD 402

Query: 485 ----PLLSSNTSIVFSTHPTDIADVEAEGEDGLGLFAGLGSS 522
               P +++N++I+ + +  D        +D + LF  LGSS
Sbjct: 403 NNTTPNVANNSTIIINANAND-------EDDDMNLFGILGSS 437

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  167 bits (423), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 147/525 (28%), Positives = 240/525 (45%), Gaps = 136/525 (25%)

Query: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQ 79
           EI+H  +D  + ++L+K++  QL +  +  S  A ++L  LV  Q++ +   LH L+LLQ
Sbjct: 27  EISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVTVQMDGMFRNLHNLTLLQ 86

Query: 80  RRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHI 139
           RR+  ++ DL+L +R FN++   L  Q+++S++I+ K S  EY  L   +          
Sbjct: 87  RRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHST-EYEKLMSWSSL-------- 137

Query: 140 MESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQF 199
             ++   +  D   +  NI +  +  N+L+ P+NP +   I SWLP+FPPDHTYKFTP+F
Sbjct: 138 --AALPHNEEDEEDELNNIEEQQNEINVLLPPSNPLEK-QIPSWLPNFPPDHTYKFTPEF 194

Query: 200 NNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITD 259
           N+PITD K IK+++V+E  +SEKALLN  K++S+    ++      P  P L +E  I  
Sbjct: 195 NHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASN-----TPQPPGLDDEDAI-- 247

Query: 260 TDXXXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIIS 319
                                           E+ L I+G   +    ER    KP I  
Sbjct: 248 --------------------------------EQQLEIWGNALE----ER----KPTI-- 265

Query: 320 IHDEKIVNFFGHSSSDKKFDVN---KYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKL 376
                         ++K F+ N   +Y+ +RVEL R++V  FE  +L+  KNPFLK+S+ 
Sbjct: 266 --------------TEKSFNENNIEQYAKYRVELARERVTKFEVNQLKRTKNPFLKISET 311

Query: 377 VCLXXXXXXXXXXXXXXXXXRKXXXXXXXXXXRLSPIRKRAQINNEIISNLKRSFYSILN 436
           + L                               SP +    I   I    ++S    ++
Sbjct: 312 LYLPE-----------------------------SPHQSHKTIQKTIELQFRKSMTLFMH 342

Query: 437 NYPXXXXXXXXXXXXXIEKRDQRLQELRKIQEE---ERKVKEQ------KLLTKSEN--- 484
           N P                +++R + L++ QEE   +R  +EQ      +LL  +E+   
Sbjct: 343 NLPKVQKLKKEKIRMA---KEERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARD 399

Query: 485 -------PLLSSNTSIVFSTHPTDIADVEAEGEDGLGLFAGLGSS 522
                  P   +N++IV +T+  D        +D + LF  LGSS
Sbjct: 400 AADDTTTPNALNNSTIVINTNAED-------EDDDINLFGILGSS 437

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  156 bits (395), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 113/356 (31%), Positives = 186/356 (52%), Gaps = 72/356 (20%)

Query: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQ 79
           EI+H  +D  + ++L+K++  QL +  +  S  A ++L  LV  Q++ +   LH L+LLQ
Sbjct: 27  EISHLKIDAPVVEILRKTVLFQLNSLDICISNFALDELVNLVAVQMDGMFRNLHNLALLQ 86

Query: 80  RRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHI 139
           RR+   + DL+L  + FN++P+ L  Q + S++I+   S  EY       E++V   +  
Sbjct: 87  RRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSV-EY-------EKLVSSSS-- 136

Query: 140 MESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQF 199
             S++S +  D   +  NI +  +  ++L+ P+NP + + + SWLP+FPPDHTY+FTP+F
Sbjct: 137 -FSASSHNEEDEEDELNNIEEQQNEISVLLPPSNPLEKL-MPSWLPNFPPDHTYRFTPEF 194

Query: 200 NNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITD 259
           N+PITD K IK+++V+E  +SEKALLN  K + +     S+A    PP            
Sbjct: 195 NHPITDLKTIKREIVKESKESEKALLNLNKRLLH----ISLASHAPPPR----------- 239

Query: 260 TDXXXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIIS 319
                                +P D D   A E+ L I+G   Q  E +R + SK     
Sbjct: 240 ---------------------LPDDAD---AGEQQLEIWGNALQ--EEKRTAISK----- 268

Query: 320 IHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSK 375
                         S  + ++ +Y+ +RVEL R++V  FE  +L+  KNPFL++S+
Sbjct: 269 --------------SFNENNIEQYAKYRVELARERVSKFEVNQLKRTKNPFLRISE 310

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  155 bits (393), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 116/356 (32%), Positives = 185/356 (51%), Gaps = 73/356 (20%)

Query: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQ 79
           E++H  +D  + ++L+KS+  QL +  +  S  A +++  LV  Q++ +   LH L+LLQ
Sbjct: 27  EVSHLEIDAPVLEILKKSVLFQLNSLNICISNFALDEMVNLVAVQMDGMFRNLHNLALLQ 86

Query: 80  RRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHI 139
           RR+ +++ DL+L  R FN+N + L  Q + S++I+ K S  EY       E++VK  +  
Sbjct: 87  RRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSV-EY-------EKLVKSSSF- 137

Query: 140 MESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQF 199
             ++ S    D   +  NI +  +  N+L+ P+NP + + I SWLP+FPPDHTYKFTP+F
Sbjct: 138 --TAVSHIEDDEEDEINNIEEQQNEINVLLPPSNPLEKL-IPSWLPNFPPDHTYKFTPEF 194

Query: 200 NNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITD 259
           N+PITD K IK+++V+E  +SE+ALLN        K+   I+  +  PSP L        
Sbjct: 195 NHPITDLKTIKREIVKESGESERALLNL------NKRLFRISSASHTPSPRL-------- 240

Query: 260 TDXXXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIIS 319
                                 P   D +    E L I+G        ER    KP II 
Sbjct: 241 ----------------------PDASDAS----ERLEIWGNTLH----ER----KPAII- 265

Query: 320 IHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSK 375
                       + S  + ++ +Y+ +R+EL R++V  FE  +L+  KNPFLK+S+
Sbjct: 266 ------------AKSFNEKNIEQYAKYRIELARERVSKFEVNQLKRTKNPFLKISE 309

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  155 bits (392), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 142/515 (27%), Positives = 238/515 (46%), Gaps = 138/515 (26%)

Query: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVD--FSKLAFNQLTLLVDDQLNSLITELHRLSL 77
           EI    MD  ++KLL+K+IAIQLK+   D   S+LAF  L +LV++ L++++ +LH+++ 
Sbjct: 29  EIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSNMLMDLHKMAN 88

Query: 78  LQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRT 137
           +QRR+ ++K DL L + G+N++ SDL  + E S+Y++ +   +  ++  D   + V+++ 
Sbjct: 89  IQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEED--SKYVEKQE 146

Query: 138 HI------MESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDH 191
           H       + SST  + + L K             + + P +     ++  WLP FPPDH
Sbjct: 147 HTPLTQNELLSSTHPEFFVLDKDV-----------LTLVPPSVKDTKHVPRWLPDFPPDH 195

Query: 192 TYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSL 251
           TY+FT Q+N PITDE+L+K+KL EE   SEKAL++ L  +S+ +  +             
Sbjct: 196 TYRFTAQYNKPITDERLMKRKLAEEANLSEKALIH-LSMLSHEEASS------------- 241

Query: 252 SNEGPITDTDXXXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDS 311
              GPI D+D                            A +ET  ++G            
Sbjct: 242 ---GPI-DSDTIYEE-----------------------AQQETQLLFG-----------P 263

Query: 312 SSKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFL 371
             K    +I++   VN    +   + F V +Y+ +RVE+ R++V  +E  +L+L+K  F+
Sbjct: 264 VKKKKTAAINE---VNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQLQLQKGAFI 320

Query: 372 KLSKLVCLXXXXXXXXXXXXXXXXXRKXXXXXXXXXXRLSPIRKR----AQINNEIISNL 427
           K + L                                 LSP  K+     Q+  EI + L
Sbjct: 321 KAAHL---------------------------------LSPFSKKRTSCKQVEKEIRTLL 347

Query: 428 KRSFYSILNNYPXXXXXXXXXXXXXIEKRDQRLQELRKIQEEERKVKEQKLLTKSENPLL 487
            RS   +L + P                +++R +E+  + EE R+++++KL  + E    
Sbjct: 348 HRSRIGLLKSAPSL--------------KERRKREI-ALAEENRRLRDEKLRKEREARSK 392

Query: 488 SSNTSIVFSTHPTDIADVEAEGEDGLGLFAGLGSS 522
           SSN          D+ D+    ED    F GLGSS
Sbjct: 393 SSNE--------FDVLDLNNLNED--PFFGGLGSS 417

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  154 bits (388), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 124/366 (33%), Positives = 188/366 (51%), Gaps = 66/366 (18%)

Query: 19  REIAHNHMDMQIEKLLQKSIAIQLKAFKVDFS--KLAFNQLTLLVDDQLNSLITELHRLS 76
           +E+A  H  MQI  LL +S+A+QLK  K DFS  +L FN +   ++ Q+N +   LHR +
Sbjct: 28  QEVA-KHNPMQI--LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMNDMFQILHRFA 84

Query: 77  LLQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILR---DLNEEVV 133
            +QRRN ++  DL+L+++G  I    L  ++E S+YI++    +   I R   DL E+  
Sbjct: 85  NIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIERQSLDLVEKWQ 144

Query: 134 KQ-RTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHT 192
           K  R   + SS   + +     F+++    D  N L+ PTN      + +WLP FPPDHT
Sbjct: 145 KPLRDEELLSSNHAEFF-----FKDV----DILN-LVPPTN-INNSYVPTWLPEFPPDHT 193

Query: 193 YKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLS 252
           YKFT  +N PI+DE+ +K+ L EEG  SEKALLN L        G++ A M       + 
Sbjct: 194 YKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNML--------GSAQAKML-----KVE 240

Query: 253 NEGPITDTDXXXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSS 312
           +E  I  T                             + EET  IYG + Q     R+++
Sbjct: 241 DEETIAQTYKE--------------------------SQEETQLIYGVEKQ--RPRRENA 272

Query: 313 SKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLK 372
                 + +D+  +N    SS  K F++ +Y+  R+ L R+KVE FEN KL+ +KNPF++
Sbjct: 273 YVGGNSTNNDDLPLN----SSHSKGFNIQEYARSRIGLARRKVEEFENHKLQAQKNPFIR 328

Query: 373 LSKLVC 378
            S  +C
Sbjct: 329 ASS-IC 333

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score =  154 bits (389), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 92/244 (37%), Positives = 138/244 (56%), Gaps = 20/244 (8%)

Query: 2   ASANETENYDMNEVQPPREIAHNHMDMQIEKLLQKSIAIQLKAFKVDFS--KLAFNQLTL 59
               E  + D+ E+      + N MD Q+ +LL++++ +QL+    D +  ++A +QL L
Sbjct: 11  GGVQENRDVDIKEIN-----SSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVL 65

Query: 60  LVDDQLNSLITELHRLSLLQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSG 119
             +DQLN+L+  LHR+SLLQRR S+A  DLE+WMRG+N+ PSDL    E SK+I+E    
Sbjct: 66  FAEDQLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIRENYRN 125

Query: 120 KEYRILRDLN----EEVVKQRTHI-----MESSTSDDNYDLTKQFRNISDATDSSNILIK 170
               + +D+N     E    R +I     +E + +D + D    +  I     +   L K
Sbjct: 126 DTSVVFKDINIDNPMESALGRINIQNKENIEPTDNDVDIDEDDDYELIELQQHAMEQLFK 185

Query: 171 PTNPFKGINIS---SWLPSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNF 227
            T+  +G N+     WLP FPPDHTYK+TP + N +  E  I+QKLVEEG  SEKAL+  
Sbjct: 186 -TDTGRGRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKL 244

Query: 228 LKNI 231
           + N+
Sbjct: 245 MSNL 248

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 3/89 (3%)

Query: 291 NEETLAIYGTKSQSYEIERDSSS--KPNIISIHDEKIVNFFGHSSSD-KKFDVNKYSHHR 347
           +EE LA    K+  Y IE +     +P  +S+    + +   + +S  K FDV  Y+  R
Sbjct: 348 SEEELADLEIKALLYRIENNKEYLIEPMRVSLLKGVLKDLDSNPTSKLKDFDVEAYARQR 407

Query: 348 VELVRKKVEAFENKKLRLEKNPFLKLSKL 376
           +E+ R+KV  FE ++L L+ NP L+L+K+
Sbjct: 408 IEIARRKVVDFEYEQLYLKYNPLLRLAKM 436

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  149 bits (376), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 172/369 (46%), Gaps = 87/369 (23%)

Query: 11  DMNEVQP---PREIAHNHMDMQIEKLLQKSIAIQLKAFKV--DFSKLAFNQLTLLVDDQL 65
           DMN V+P    R+I  N    Q++ LL KS+A++LK   +       AF+ L  L+D QL
Sbjct: 8   DMN-VEPLEIRRQITGNP---QLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQL 63

Query: 66  NSLITELHRLSLLQRRNSMA-KVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRI 124
           N LI +L RLSLLQRRNS A K D+ L ++GFN++ S+LN + E S +I+   S  E ++
Sbjct: 64  NDLIKQLGRLSLLQRRNSNATKSDILLLLKGFNLSESELNTELEISNHIKRLYSEDEKKL 123

Query: 125 LRDLNEEVVKQRTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWL 184
                               S+D+    +    +     SS  L+ PTNP K   I SW 
Sbjct: 124 --------------------SEDSIHYNQHTDFVGPVETSSFQLLNPTNPLKDA-IPSWF 162

Query: 185 PSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMT 244
           PS PPDHTYKFTP++NN I D K+IKQK  +E    + AL N +  I + ++   +    
Sbjct: 163 PSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVKTALFNLINKIESNEERNDLH--- 219

Query: 245 IPPSPSLSNEGPITDTDXXXXXXXXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQS 304
                                                    D  LA  E+ A++GT    
Sbjct: 220 ----------------------------------------YDETLAKLESQALFGT---- 235

Query: 305 YEIERDSSSKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLR 364
             +E   ++   +    +  IV          KFD+ +YSH RV + R KV  FENK L 
Sbjct: 236 --VEEKMNTNKKVYKSLNSIIVPI-------TKFDIEEYSHKRVNIARNKVSKFENKMLA 286

Query: 365 LEKNPFLKL 373
           L+ NPF+ L
Sbjct: 287 LKYNPFINL 295

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  136 bits (342), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 128/214 (59%), Gaps = 13/214 (6%)

Query: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFK--VDFSKLAFNQLTLLVDDQLNSLITELHRLSL 77
           EI    +D  + KLL+K++AIQLKA    V  S+ AF  L +LV+  L++++ +LH++  
Sbjct: 29  EIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSNMLVDLHKMVN 88

Query: 78  LQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEV-VKQR 136
           +QRR+ ++K DL L + G+N+  +DL  + E S+Y++   + +  R +R+ +E V  K++
Sbjct: 89  IQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSH-NLERVRKVREESEVVEAKEK 147

Query: 137 THIMESSTSDDNY-DLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKF 195
           T + E    +  + +   Q + I        + + P  P     +  WLP FPPDHTY+F
Sbjct: 148 TPLSEKELLESKHLEFFIQDKEI--------LTLVPPTPKNTKYVPRWLPEFPPDHTYRF 199

Query: 196 TPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLK 229
           T QFN PITDE+L+K+KL EE   SEKAL++  K
Sbjct: 200 TSQFNRPITDERLMKRKLAEEADLSEKALIHLSK 233

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 83/188 (44%), Gaps = 61/188 (32%)

Query: 338 FDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCLXXXXXXXXXXXXXXXXXR 397
           ++V +Y+ +RVE+ R+KVE +E  +L L+K  F+K + L                     
Sbjct: 287 YNVEEYARNRVEIARRKVEEYERHQLLLQKGAFIKAAHL--------------------- 325

Query: 398 KXXXXXXXXXXRLSPIRKR---AQINNEIISNLKRSFYSILNNYPXXXXXXXXXXXXXIE 454
                       LSP  K+    Q+  E+ + L RS+  +L + P               
Sbjct: 326 ------------LSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLL------------- 360

Query: 455 KRDQRLQELRKIQEEERKVKEQKLLTKSENPLLSSNTSIVFSTHPTDIADVEAEGEDGLG 514
            R+QR +E+ ++ EE R+++E+++  + E  L +S           D+ D++   ED   
Sbjct: 361 -REQRKREV-ELAEENRRLREEQIRQEREERLKNSKD--------YDVLDLDNLNED--P 408

Query: 515 LFAGLGSS 522
            F GLGSS
Sbjct: 409 FFGGLGSS 416

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  132 bits (332), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 94/347 (27%), Positives = 159/347 (45%), Gaps = 73/347 (21%)

Query: 30  IEKLLQKSIAIQLKAFKVD--FSKLAFNQLTLLVDDQLNSLITELHRLSLLQRRNSMAKV 87
           ++KLL +++ + LK  + D   ++L F  L   V+ QL+ ++  LHR + +QRRN ++  
Sbjct: 36  MQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDDMLQILHRFANVQRRNEVSLK 95

Query: 88  DLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHIMESSTSDD 147
           D+ L++ G  +    L  +Y  S+Y++++ +G     +R + E+      H  +  + ++
Sbjct: 96  DVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGA----VRSIEEQSASLMGHWHQPMSEEE 151

Query: 148 NYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQFNNPITDEK 207
               +       D  D  N L+ PTN      +  WLP FPPDHTYKFT  +N PITDE+
Sbjct: 152 LLSSSHAEFFFKD-VDILN-LVPPTN-NNNHYVPKWLPEFPPDHTYKFTSIYNQPITDER 208

Query: 208 LIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITDTDXXXXXX 267
            +K+KL EE   SEKALL+ L   +   +                               
Sbjct: 209 QMKRKLFEESKLSEKALLHMLGTATKKPRA------------------------------ 238

Query: 268 XXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIISIHDEKIVN 327
                    D   +P+ I  +   +E L IYG + +    E                   
Sbjct: 239 ---------DDAQLPQII--SDGQQENLLIYGPERRRLAPE------------------- 268

Query: 328 FFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLS 374
                +  + F++  Y+  RVEL R++VE FE +KL+++KNPF++ +
Sbjct: 269 ----PAPTRGFNIEDYARCRVELARRRVEEFEQQKLQVQKNPFIRAA 311

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  124 bits (311), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 127/215 (59%), Gaps = 19/215 (8%)

Query: 23  HNHMDMQIEKLLQKSIAIQLKAFKVD--FSKLAFNQLTLLVDDQLNSLITELHRLSLLQR 80
           H+ ++  + K+L +++AI+LK    D   S+ AF  L  LV + L+ ++T LHR   +QR
Sbjct: 32  HDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSFMLTTLHRFVDIQR 91

Query: 81  RNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRIL---RDLNEEVVKQRT 137
           R  ++K DL L ++G++++ S+L  + ESS+YI      K  +I    ++L  +++K  T
Sbjct: 92  RREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQKSKELKSKLLKPMT 151

Query: 138 H--IMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKF 195
              ++ S+ S+        F    D  D    L+ PTN      I  WLP FPPDHTY+F
Sbjct: 152 EKELLNSAHSEF-------FFKDMDILD----LVPPTNK-NNQYIPKWLPEFPPDHTYRF 199

Query: 196 TPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKN 230
           T Q+N P+ DE+ +++KLVEEG +SE+AL+N LK+
Sbjct: 200 TSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKH 234

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 80/188 (42%), Gaps = 59/188 (31%)

Query: 336 KKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCLXXXXXXXXXXXXXXXX 395
           K F V +Y+ +RVE+ R+KV  +E  +LRL+KNPF+K + L C                 
Sbjct: 288 KNFSVEEYARNRVEIARRKVLEYEQYQLRLQKNPFIKAANL-C----------------- 329

Query: 396 XRKXXXXXXXXXXRLSPIRK----RAQINNEIISNLKRSFYSILNNYPXXXXXXXXXXXX 451
                          SP++K    R  I+ E+ S L+RS+  +L + P            
Sbjct: 330 ---------------SPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVKAREREL 374

Query: 452 XIEKRDQRLQELRKIQEEERKVKEQ-------KLLTKSENPLLSSNTSIVFSTHPTDIAD 504
             E+R + L+   K+ EE ++  E         L   +E+PLL+   S            
Sbjct: 375 ANERRREMLE---KLNEERQRQAEAGGGDEVLDLNNLNEDPLLAGFDS------------ 419

Query: 505 VEAEGEDG 512
            ++EGEDG
Sbjct: 420 SDSEGEDG 427

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  124 bits (310), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 126/464 (27%), Positives = 207/464 (44%), Gaps = 101/464 (21%)

Query: 30  IEKLLQKSIAIQLKAFK--VDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQRRNSMAKV 87
           +E+L  +++ +QLK     V  S+LAF+ L  +   QL+ L+  L +++ +QRR  ++K+
Sbjct: 38  MERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQLDDLLQSLKKITQVQRRTKISKL 97

Query: 88  DLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHIMESSTSDD 147
           DL L+ +G  ++  DLN Q E S ++  K   +       LNE V+K +   M+     +
Sbjct: 98  DLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEA----NALNETVLKVKQQFMKELEEKE 153

Query: 148 NYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQFNNPITDEK 207
               +K         D  N+L  P++      + SWLP  PPDHTYKFT  +  PITDE+
Sbjct: 154 LLS-SKHSEFFVQDVDILNLL--PSSNKSNKYVPSWLPELPPDHTYKFTSLYKRPITDER 210

Query: 208 LIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITDTDXXXXXX 267
           L+K+KL+EEG  SEKALLN L  +                     N+ P+          
Sbjct: 211 LMKKKLLEEGRLSEKALLNMLSQVV--------------------NQDPL---------- 240

Query: 268 XXXXXXXXXDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPN-IISIHDEKIV 326
                      V + KD D + AN   L+ +  +SQ   +E D    P+  I    E   
Sbjct: 241 -----------VALNKDSDQS-ANNAALSEHIKESQ---LETDLIFDPHKTIPTDKEWGT 285

Query: 327 NFFGHS------SSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCLX 380
               H       S  K F+V +Y   R  +V+++ E  EN+     +NPF++   ++C  
Sbjct: 286 TTVLHGIESFNLSPVKNFNVLEYCKKRDAIVKRRAERAENQVSNKRRNPFIR-GAMIC-- 342

Query: 381 XXXXXXXXXXXXXXXXRKXXXXXXXXXXRLSP-----IRKRAQINNEIISNLKRSFYSIL 435
                                         SP      + R  + N++ + L+RS+  ++
Sbjct: 343 ------------------------------SPYGQGSTKSRKSVENQLKTMLRRSYLGLI 372

Query: 436 NNYPXXXXXXXXXXXXXIEKRDQRLQELRKIQEEERKVKEQKLL 479
           ++ P              E+R++ LQE R+I E+E+K+ EQ++L
Sbjct: 373 DSIPRVKEVRERARKEA-EERERLLQEQRRI-EKEKKMAEQEIL 414

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 120/228 (52%), Gaps = 22/228 (9%)

Query: 12  MNEVQPPREIAHNHMDMQIEKLLQKSIAIQL--------KAFKVDFSKLAFNQLTLLVDD 63
           + +V  P E+ H   D +++++L  S+A Q+            V  +  AF  L  LV++
Sbjct: 17  VGDVSAPVELPHEPWDARVDQMLANSVAFQMSAGLARGGGGGGVGMAGQAFQLLLQLVEE 76

Query: 64  QLNSLITELHRLSLLQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYR 123
           QL+ ++TELHR++ +QRR      D+ L ++GF + P D+  Q     Y+ +K+     +
Sbjct: 77  QLSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQM----YLSKKIGYNRMQ 132

Query: 124 ILRDLNEEVVKQRTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSW 183
           + R+       Q   + +++ S D + L +  + I+     S++      P     I +W
Sbjct: 133 VPRE-------QTVQLQDATGSYDRFKLVENQQLIASGLSGSDM--SQELPI-AEKIPAW 182

Query: 184 LPSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNI 231
           LP  PP+HTYKFT ++N  + DEK++K+K+++E  + E +L N ++N 
Sbjct: 183 LPKLPPNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNC 230

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%)

Query: 336 KKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFL 371
           K FDV  YS  RV+L R  V+ FE +     +NPFL
Sbjct: 286 KSFDVQAYSLGRVKLARNAVQRFEWETKYRPRNPFL 321

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,790,529
Number of extensions: 2683633
Number of successful extensions: 12007
Number of sequences better than 10.0: 87
Number of HSP's gapped: 12384
Number of HSP's successfully gapped: 111
Length of query: 664
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 548
Effective length of database: 40,180,143
Effective search space: 22018718364
Effective search space used: 22018718364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)