Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NDAI0E002908.842ON52252227650.0
NCAS0B003008.842ON52352020020.0
YML115C (VAN1)8.842ON53554018230.0
Suva_13.288.842ON53051818090.0
KNAG0G034208.842ON51148917920.0
KAFR0A028308.842ON50749317900.0
Smik_13.198.842ON53653217890.0
Skud_13.268.842ON53951617470.0
ZYRO0G14234g8.842ON50948617270.0
TDEL0B005608.842ON50952917090.0
SAKL0D01430g8.842ON44742816970.0
Kpol_541.158.842ON49842016820.0
TPHA0C047808.842ON52552716170.0
TBLA0B032708.842ON52051516150.0
CAGL0B02321g8.842ON51250716040.0
KLLA0D01529g8.842ON50151315960.0
KLTH0C03828g8.842ON40440915580.0
Ecym_46138.842ON52449615500.0
ABL124W8.842ON48543414840.0
Kwal_27.102468.842ON33934013510.0
Ecym_35731.479ON4473699781e-127
YEL036C (ANP1)1.479ON5003579631e-124
NCAS0G041101.479ON4943669601e-124
Smik_5.571.479ON4913569581e-124
CAGL0L01331g1.479ON4473669511e-123
AFR357W1.479ON4343709501e-123
KNAG0I003001.479ON4573679491e-123
NDAI0G003401.479ON5043599511e-123
Suva_5.331.479ON4953579501e-122
Skud_5.541.479ON4913569491e-122
KLTH0C03432g1.479ON4893669471e-122
Kwal_27.101571.479ON4763669461e-122
KAFR0I027701.479ON4553579421e-122
SAKL0D11792g1.479ON4833659431e-122
NDAI0B012501.479ON4463689371e-121
TPHA0O004301.479ON5483569431e-121
TBLA0B021701.479ON5723669431e-120
Kpol_370.51.479ON6453579471e-120
KLLA0E22155g1.479ON4503579181e-118
TDEL0C026001.479ON4623589101e-117
ZYRO0F05170g1.479ON6083589131e-115
SAKL0H11110g8.500ON3933524691e-52
Kwal_27.118648.500ON4533494703e-52
KNAG0A021508.500ON3963524621e-51
KLTH0E11616g8.500ON3943524568e-51
NDAI0E030208.500ON3963584551e-50
KLLA0E12849g8.500ON3923584541e-50
TPHA0L013708.500ON3923584523e-50
NCAS0C023308.500ON3933584514e-50
TBLA0H033408.500ON3933554505e-50
Smik_16.1868.500ON3953584506e-50
KAFR0H013908.500ON3983584507e-50
TDEL0B013708.500ON3963614491e-49
Skud_16.2328.500ON3953584481e-49
YPL050C (MNN9)8.500ON3953584471e-49
Suva_16.2658.500ON3953584392e-48
Kpol_1031.788.500ON3923554374e-48
ZYRO0F08492g8.500ON3963764366e-48
CAGL0L12804g8.500ON3933604271e-46
AGL259C8.500ON3893514252e-46
Ecym_25508.500ON3903544148e-45
NCAS0B024408.500ON4003494112e-44
NDAI0C052508.500ON4023474079e-44
KNAG0A039908.500ON3573612986e-29
SAKL0H20438gsingletonON5652101277e-07
YLR173W1.386ON608127714.8
Skud_12.2381.386ON608115696.8
Kwal_47.176214.136ON144661699.4
AGL343C5.8ON30781679.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NDAI0E00290
         (522 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...  1069   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   775   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   706   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   701   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   694   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   694   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   693   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   677   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   669   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   662   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   658   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   652   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   627   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   626   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   622   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   619   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   604   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   601   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   576   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   525   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   381   e-127
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   375   e-124
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    374   e-124
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   373   e-124
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   370   e-123
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   370   e-123
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   370   e-123
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   370   e-123
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   370   e-122
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   370   e-122
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   369   e-122
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   369   e-122
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   367   e-122
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   367   e-122
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   365   e-121
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   367   e-121
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   367   e-120
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   369   e-120
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   358   e-118
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   355   e-117
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   356   e-115
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   185   1e-52
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   185   3e-52
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   182   1e-51
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   180   8e-51
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   179   1e-50
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   179   1e-50
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   178   3e-50
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   178   4e-50
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   177   5e-50
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   177   6e-50
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   177   7e-50
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   177   1e-49
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   177   1e-49
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   176   1e-49
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   173   2e-48
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   172   4e-48
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   172   6e-48
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   169   1e-46
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   168   2e-46
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   164   8e-45
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   162   2e-44
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   161   9e-44
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...   119   6e-29
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    54   7e-07
YLR173W Chr12 (502421..504247) [1827 bp, 608 aa] {ON} Putative p...    32   4.8  
Skud_12.238 Chr12 (449167..450993) [1827 bp, 608 aa] {ON} YLR173...    31   6.8  
Kwal_47.17621 s47 (486476..490816) [4341 bp, 1446 aa] {ON} YLR32...    31   9.4  
AGL343C Chr7 complement(72374..73297) [924 bp, 307 aa] {ON} Synt...    30   9.5  

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score = 1069 bits (2765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/522 (98%), Positives = 512/522 (98%)

Query: 1   MFGLLHKFGRNSRKDAKLELPISRNNSNVADELKKQRFIPKKKSTAKNVAIGSVVSFIIC 60
           MFGLLHKFGRNSRKDAKLELPISRNNSNVADELKKQRFIPKKKSTAKNVAIGSVVSFIIC
Sbjct: 1   MFGLLHKFGRNSRKDAKLELPISRNNSNVADELKKQRFIPKKKSTAKNVAIGSVVSFIIC 60

Query: 61  ALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKF 120
           ALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKF
Sbjct: 61  ALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKF 120

Query: 121 ENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLL 180
           ENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLL
Sbjct: 121 ENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLL 180

Query: 181 CVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLS 240
           CVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLS
Sbjct: 181 CVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLS 240

Query: 241 QVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRK 300
           QVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRK
Sbjct: 241 QVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRK 300

Query: 301 DFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIV 360
           DFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIV
Sbjct: 301 DFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIV 360

Query: 361 EDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEY 420
           EDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEY
Sbjct: 361 EDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEY 420

Query: 421 PTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGK 480
           PTWRVHLAYIREAQGDPTS          SILAKAKLFRSGVHFPAFTFENHAETEGFGK
Sbjct: 421 PTWRVHLAYIREAQGDPTSVVDLDGVGGVSILAKAKLFRSGVHFPAFTFENHAETEGFGK 480

Query: 481 MAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSRHKE 522
           MAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSRHKE
Sbjct: 481 MAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSRHKE 522

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/520 (71%), Positives = 428/520 (82%), Gaps = 5/520 (0%)

Query: 4   LLHKFGRNSRKDAKLE--LPISRNNSNVADE-LKKQRFIPKKKSTAKNVAIGSVVSF-II 59
           LL K  +  +  A+ E  LP SRNNSN  DE  KK  F+PK++ T  ++   +V S  II
Sbjct: 3   LLIKVKKGVQNKAQQEELLPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLLII 62

Query: 60  CALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGK 119
              I+ G S    TS      NL+A +N K + SYKT +L++ EYY++DFE+IE  V+ K
Sbjct: 63  IVYIFWGSSLTEMTSKYDSVTNLHAGQNTK-TASYKTKQLTENEYYDHDFEDIEPAVVKK 121

Query: 120 FENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLL 179
           F+NGVQHYLIS++GTDVLTP D E Y KEL M+LDASVEKYDL  F GS NGA NRDHLL
Sbjct: 122 FDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLL 181

Query: 180 LCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTL 239
           LCVPLRDAE VLPLMFKHLMN+TYPHELIDLAFLVSDCS+GD TL+ALL YS+HLQNGTL
Sbjct: 182 LCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTL 241

Query: 240 SQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFR 299
           SQVF +MD+Y+ +HS  ++GTKNLHLKYMN +YLK+V+T+F    H NYDKPFRS+Q+F+
Sbjct: 242 SQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQ 301

Query: 300 KDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTI 359
           KDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYH+WVYWRDADIELCPG++
Sbjct: 302 KDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSV 361

Query: 360 VEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAE 419
           +ED+M+ DYDV+VPNVWRPLPEFLD EQPYDLNSWIESDEALKLAKTL EDDVIVEGYAE
Sbjct: 362 IEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAE 421

Query: 420 YPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFG 479
           YPTWRVHLAYIR+A GDP            SILAKAK+FRSGV FPAFTFENHAETE FG
Sbjct: 422 YPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFG 481

Query: 480 KMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSR 519
           KMA++MG+RVGGLPHYTIWHIYEPSDDDL EIANKERQ++
Sbjct: 482 KMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNK 521

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/540 (63%), Positives = 421/540 (77%), Gaps = 27/540 (5%)

Query: 2   FGLLHKFGRNSRK---DAKLELPISRNNS--NVADE--------LK-KQRFIPKKKSTAK 47
            G+      N +K   D  L LPISRN S  N+ D+        LK K R+ P+   +  
Sbjct: 1   MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF 60

Query: 48  NVAIGSVVSFIICALI--YCGYSYF----FNTSPRLGKINLYANKNNKVSTSYKTTELSD 101
            + + S+ S II A++  Y   S+        S + G+  L ++K+   S +YKT +L D
Sbjct: 61  QLTV-SITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKS---SENYKTIDLED 116

Query: 102 KEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYD 161
           +EYY+YDFE+I+ +V+ KF++GVQHYLIS+FG++VLTPKD E+Y++EL ML D++VE+YD
Sbjct: 117 EEYYDYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYD 176

Query: 162 LKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGD 221
           L  F+G+ NG E RDH+LLC+PLR+A  VLPLMFKHLMN+TYPHELIDLAFLVSDCS+GD
Sbjct: 177 LSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGD 236

Query: 222 NTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFN 281
            TL+AL+ YSRHLQNGTLSQ+FQ++D         T+GT  L+LKYM++ Y+  V  AF+
Sbjct: 237 TTLDALIAYSRHLQNGTLSQIFQEIDAVI---DSQTKGTDKLYLKYMDEGYINRVHQAFS 293

Query: 282 TPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPY 341
            P HENYDKPFRSVQIF+KDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPY
Sbjct: 294 PPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY 353

Query: 342 HSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEAL 401
           HSWVYWRDAD+ELCPG++++D+M+ +YDV+VPNVWRPLP FL +EQPYDLNSW+ES EAL
Sbjct: 354 HSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEAL 413

Query: 402 KLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAKLFRSG 461
            LAKTL EDDVIVEGYAEYPTWRVHLAYIR+A+GDP            SILAKAK+FR+G
Sbjct: 414 ALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNG 473

Query: 462 VHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSRHK 521
           V FPAFTFENHAETE FGKMAK+MGYRVGGLPHYTIWHIYEPSDDDLKEIA++ER+ R +
Sbjct: 474 VQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRRQ 533

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/518 (64%), Positives = 410/518 (79%), Gaps = 16/518 (3%)

Query: 15  DAKLELPISRNNSNVADELKKQR-----------FIPKKKSTAKNVAIGSVVSFIICALI 63
           D  L LPISRN S+   + K+             + P+  S+   +A+ +V+S +I  ++
Sbjct: 17  DNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKFQLAV-NVISLVIIIVL 75

Query: 64  YCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFENG 123
                  F +  +LG I++        S +YKT +L D+EYYNYDFE+I+ +V+ KF++G
Sbjct: 76  SLYLMILFLSEMKLG-ISIQNGNPLLGSENYKTIDLEDEEYYNYDFEDIDPEVVSKFDDG 134

Query: 124 VQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVP 183
           VQHYLI++FG++VLTP D E+Y++E++MLLD++VEKYDL  F+G+ NG E RDH+LLC+P
Sbjct: 135 VQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLETRDHILLCIP 194

Query: 184 LRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVF 243
           LR+A  VLPLMFKHLMN+TYPHELIDLAFLVSDCS+GD TL+AL+ YSR LQNGTLS++F
Sbjct: 195 LRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSEIF 254

Query: 244 QDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFG 303
           Q++D         T+GT  L+LKYM+++Y+  V  AF+ P H+NYDKPFRSVQ+F+KDFG
Sbjct: 255 QEIDAVI---DSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFG 311

Query: 304 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDM 363
           QVIGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYHSWVYWRDAD+ELCPG++++D+
Sbjct: 312 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDL 371

Query: 364 MANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTW 423
           M+ +YDV+VPNVWRPLP FL+SEQPYDLNSW+ES EAL LAKTL EDDVIVEGYAEYPTW
Sbjct: 372 MSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTW 431

Query: 424 RVHLAYIREAQGDPTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAK 483
           RVHLAYIR+A GDP            SILAKAK+FR+GV FPAFTFENHAETE FGKMAK
Sbjct: 432 RVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAK 491

Query: 484 RMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSRHK 521
           +MGYRVGGLPHYTIWHIYEPSDDDLKEIA +ER+ R +
Sbjct: 492 KMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQ 529

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/489 (67%), Positives = 388/489 (79%), Gaps = 5/489 (1%)

Query: 34  KKQRFIPKKKSTAKNVAIGSVVSFIICALIYCGYSYFFNTSPRLGKINLYANKNNKVSTS 93
           K  +F+PK+K       I  +   +  A+     S +      + KI     K    + +
Sbjct: 27  KTAKFVPKRKRQTLLRLISLLGLVVFVAVSTVSLSRYLRGPASINKI---LKKLESGNHN 83

Query: 94  YKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLL 153
           YKT  L + EYYNYDFE ++  V+GKF+ GVQHYLISEFG DVLTPKD+E+YE E+  L 
Sbjct: 84  YKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQLF 143

Query: 154 DASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFL 213
           D++V++YDL +F GS +G  NRDH+L+CVPLRDAE VLPLMFKHLMN+TYPHELID+AFL
Sbjct: 144 DSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFL 203

Query: 214 VSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEY-QYEHSDDTRGTKNLHLKYMNQEY 272
           VSDCSD DNTLEAL+ YSR LQNGTLSQ+F +MD    Y ++ D +  K L+LKYM QEY
Sbjct: 204 VSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNK-LYLKYMKQEY 262

Query: 273 LKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 332
           L  VE AF  P HENYDKPFRSVQIF K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+RNW
Sbjct: 263 LNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNW 322

Query: 333 LMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLN 392
           L ANALKPYHSWVYWRDADIELCPG++++DMMA DYDVLVPNVWRPLPEFL+ EQPYDLN
Sbjct: 323 LTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLN 382

Query: 393 SWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSIL 452
           SW+ES EAL+LA+TL EDDVIVEGYAEYPTWRVHLAYIR+ +GDP+           SIL
Sbjct: 383 SWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSIL 442

Query: 453 AKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512
           A+AKLFR+GV FPAFTFENHAETE FGKMA+++G+RVGGLPHYT+WHIYEPSDDDL+EIA
Sbjct: 443 ARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIA 502

Query: 513 NKERQSRHK 521
           NKER+ R +
Sbjct: 503 NKEREKRRE 511

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/493 (67%), Positives = 393/493 (79%), Gaps = 18/493 (3%)

Query: 30  ADELKKQRFIPKKKSTAKNVA---IGSVVSFIICALIYCGYSYFFNTSPRLGKINLYANK 86
            D  KK  F PK +    N A    G  VSF+I  L+    ++ FN S    K+N     
Sbjct: 29  TDSEKKLNFTPKNRKRRLNYAKIIFGFFVSFLILFLML---NFEFNAS----KLN----- 76

Query: 87  NNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYE 146
              +  + KT  LSD+EYYN+DFE+I+  V+ KF+ G QHYLIS+FGTDVLTP+D+E YE
Sbjct: 77  KTIIDIAQKTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYE 136

Query: 147 KELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHE 206
           +E+ ML D+++E YDL+ F G+ NGAENRDH+LLC+PLRDA  VLPLMF+HLMN+TYPHE
Sbjct: 137 REMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHE 196

Query: 207 LIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLK 266
           LIDLAFLVSDCS+ DNTL+AL+++S++LQNGTLSQV  ++D +  E   +T    NLHLK
Sbjct: 197 LIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKE---ETSTKSNLHLK 253

Query: 267 YMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLM 326
           YM+ EYLK V+ AF+ P HE+YDKPFRSVQIF K+FGQ+IGQGFSDRHAVKVQGIRRKLM
Sbjct: 254 YMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLM 313

Query: 327 GRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSE 386
           GRARNWL ANALKPYHSWVYWRDADIELCPG+++ED+MA DYDV+VPNVWRPLP FL  E
Sbjct: 314 GRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGE 373

Query: 387 QPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXX 446
           QPYDLNSW ES EALKLA+TL EDDVIVEGYAEYPTWRVHLAYIR+ QG+P         
Sbjct: 374 QPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVVDIDGV 433

Query: 447 XXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDD 506
              SILAKAKLFRSGV FPAFTFENHAETE FGKMAK+MGY+VGGLPHYT+WHIYEPSDD
Sbjct: 434 GGVSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDD 493

Query: 507 DLKEIANKERQSR 519
           DLKE+ANKER+ R
Sbjct: 494 DLKEMANKEREER 506

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/532 (63%), Positives = 409/532 (76%), Gaps = 46/532 (8%)

Query: 10  RNSRK----DAKLELPISRNNSNVADELKKQRFI-------------PKKKSTAKNVAIG 52
           R++RK    D  L LPISRN S  ++++K +R +             P+ KS+   + + 
Sbjct: 8   RSNRKQKSVDNGLSLPISRNGS--SNDIKDKRTLHNSKSFKDKYVYQPRSKSSKFQMTVN 65

Query: 53  SV-------------VSFIICALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTEL 99
           ++             +SF+    I        N  P LG        ++K S +YKT +L
Sbjct: 66  AISLIIITILSLYLSISFLTGMSIGVPIQ---NGRPLLG--------SSKSSDNYKTIDL 114

Query: 100 SDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEK 159
            D+EYY+YDFE+I+ +V+ KF+NGV+HYLIS+FG+DVLTPKD E+Y+ EL+MLLD++VEK
Sbjct: 115 EDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEK 174

Query: 160 YDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSD 219
           YDL +F+G+ NG E RDH+LLCVPLR+A  VLPLMFKHLMN+TYPHELIDLAFLVSDCS+
Sbjct: 175 YDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 234

Query: 220 GDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETA 279
            D TL+AL+ YSR LQNGTLSQ+FQ++D         T+GT  L+L+YM+Q Y+  V  A
Sbjct: 235 DDTTLDALIAYSRQLQNGTLSQIFQEIDAVI---DSQTKGTDKLYLQYMDQNYINRVRQA 291

Query: 280 FNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALK 339
           F+ P HENYDKPFRSVQIF+KDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL ANALK
Sbjct: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351

Query: 340 PYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDE 399
           PYHSWVYWRDAD+ELCPG+I++D+M+ +YDV+VPNVWRPLP FL+SEQPYDLNSW+ES E
Sbjct: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411

Query: 400 ALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAKLFR 459
            L+LAKTL EDDVIVEGYAEYPTWRVHLAYIR+A+GDP            SILAKAKLFR
Sbjct: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471

Query: 460 SGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEI 511
           +GV FPAFTFENHAETE FGKMAK+MGYRVGGLPHYTIWHIYEPSDDDLKEI
Sbjct: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/516 (64%), Positives = 401/516 (77%), Gaps = 26/516 (5%)

Query: 15  DAKLELPISRNNS--NVADELKKQRFIPKK-------KSTAKNVAIG---------SVVS 56
           D  L LPISRN S  N+ ++  +  F   K       +ST   + +          +V+S
Sbjct: 17  DNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRSTLSKLQLSVSFISIIIITVLS 76

Query: 57  FIICALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADV 116
             +      G +   N S R GK        ++ S +YKT +L D+EYYNYDFE+I+ +V
Sbjct: 77  LYLLISRLAGLN--VNVSLRDGKS---LLSPSESSENYKTIDLEDEEYYNYDFEDIDPEV 131

Query: 117 LGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRD 176
           + KF+ G QHYLIS+FG++VL P+++E+Y+KEL MLLD++VEKYDL  F+G+ NG E RD
Sbjct: 132 ISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLETRD 191

Query: 177 HLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQN 236
           H+LLC+PLR+A  VLPLMFKHLMN+TYPHELIDLAFLVSDCS+GD TL+AL+ YSR LQN
Sbjct: 192 HILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQN 251

Query: 237 GTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQ 296
           GTLSQ+FQD+D         T+GT  L+LKYM+++Y+  V  AF+ P H+NYDKPFRSVQ
Sbjct: 252 GTLSQIFQDIDAII---DSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQ 308

Query: 297 IFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCP 356
           IF+KDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYHSWVYWRDAD+ELCP
Sbjct: 309 IFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCP 368

Query: 357 GTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEG 416
           G+++ED+M+ +YDV+VPNVWRPLP FL+SEQ YDLNSW+ES EAL+LAKTL EDDVIVEG
Sbjct: 369 GSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIVEG 428

Query: 417 YAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFENHAETE 476
           YAEYPTWRVHLAYIR+A+G+P            SILAKAK+FR+GV FPAFTFENHAETE
Sbjct: 429 YAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETE 488

Query: 477 GFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512
            FGKMAK+MGYRVGGLPHYTIWHIYEPSDDDLKEIA
Sbjct: 489 AFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/486 (66%), Positives = 386/486 (79%), Gaps = 6/486 (1%)

Query: 37  RFIPK-KKSTAKNVAIGSVVSFIICALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYK 95
           +  PK K+S+ +N  I   VS++I  ++       F+   R G+  +    +N  S   +
Sbjct: 29  KLSPKGKRSSWQNRKI---VSWVIITVMVLILYKAFSGVVRGGREVMKTVGSNTSSNDGQ 85

Query: 96  TTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDA 155
              L +  YY+YDFE+I+  V+ KF+ GVQHYLI++FG DVLTP+D E +E+E  MLL +
Sbjct: 86  V--LEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSS 143

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
           +VE YDL  F GS NGA N +H+LLCVPLRDAE VLPLMFKHLMN+TYPHELIDLAFLVS
Sbjct: 144 TVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVS 203

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           DC++ D TL+AL+ YSR LQ+GTLSQVF DMD+   E    ++GT+ L+LKYMN +YL+ 
Sbjct: 204 DCTEDDKTLDALIAYSRQLQSGTLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPDYLET 263

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
           V+ +F+ P HENYDKPFRSVQ+F+KDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL A
Sbjct: 264 VKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 323

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
           NALKPYHSWVYWRDAD+ELCPG+++ED+M+ DYDV VPNVWRPLP+FLD EQPYDLNSW+
Sbjct: 324 NALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWM 383

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES EAL LAKTL EDDVIVEGYAEYPT+RVHLAYIR+   DP            SILAKA
Sbjct: 384 ESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKA 443

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKE 515
           +LFR G+ FPAFTFENHAETEGFGKMAK+MGYRVGGLPHYT+WHIYEPSDDDL+EIANKE
Sbjct: 444 ELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKE 503

Query: 516 RQSRHK 521
           R+SR +
Sbjct: 504 RESRRE 509

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/529 (61%), Positives = 409/529 (77%), Gaps = 31/529 (5%)

Query: 4   LLHKFG--RNSRKDA-KLELPISRNNSNVADELKKQRFIPKKKSTA--------KNVAIG 52
           ++ ++G  R  RKD     LP+SR+  N           PK KS +        K +A  
Sbjct: 1   MMFRWGSKREKRKDDDNYRLPVSRSKLN-----------PKTKSASFTWNGSRVKRIANW 49

Query: 53  SVVSFIICALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENI 112
           +++S +IC L++      F ++  LG     +   +  + SY T  LSD+ YY+YDFENI
Sbjct: 50  ALIS-VICFLMFK-----FLSTVILGSSESSSPLPSIWTKSYDTITLSDEAYYDYDFENI 103

Query: 113 EADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGA 172
           + DV+ KF+NGV +Y I++FG + +T ++  ++E+E++MLLD++VEKYD+++F G+ N A
Sbjct: 104 DPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAA 163

Query: 173 ENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSR 232
           EN++H+LLCVPLRDAE+VLPLMFKHLMN+TYPHELIDLAFLVSDCS+GD+TL+AL+ YSR
Sbjct: 164 ENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSR 223

Query: 233 HLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPF 292
            LQNGTLSQVF +++  + E     +G +NL+L+YM+Q+YL+ V+ +F+ P HENYDK F
Sbjct: 224 QLQNGTLSQVFAEVEMSEKERK---KGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSF 280

Query: 293 RSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADI 352
           RSVQIF+KDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWL ANALKPYHSWVYWRDAD+
Sbjct: 281 RSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADV 340

Query: 353 ELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDV 412
           ELCPG++++D+MA DYDV+VPNVWRPLP FLD +QPYDLNSWIES EAL LAKTL EDDV
Sbjct: 341 ELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDV 400

Query: 413 IVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFENH 472
           IVEGYAEYPTWR HLAY R+A GDP            SILA+A+LFR G+HFPAFTFENH
Sbjct: 401 IVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENH 460

Query: 473 AETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSRHK 521
           AETE FGKMAK+MG+RVGGLPHYT+WHIYEPSDDDLKEI NKER+ R +
Sbjct: 461 AETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRRE 509

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/428 (71%), Positives = 360/428 (84%), Gaps = 2/428 (0%)

Query: 92  TSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAM 151
            +YKT  L D EYYNYDF+NI+ D++ K++ G +H+LIS+ G +VLTP+D E+YEKE+ M
Sbjct: 20  VNYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEM 79

Query: 152 LLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLA 211
           LL A+V+ YDL K++GS NGAENRDH+LLCVPLR+A +VLPLMFKHLMN+TYPHELIDLA
Sbjct: 80  LLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLA 139

Query: 212 FLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQE 271
           FLVSDCS+ D+TL+AL+ YS+ LQNGTLS++F + DE + + S   +G+ +L+LKYMNQ+
Sbjct: 140 FLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKAS--IKGSPDLYLKYMNQD 197

Query: 272 YLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARN 331
           YL MVE AF  P H++YDKPFRSVQ+F+KDFGQVIGQGFSDRHAV VQGIRRKLMGRARN
Sbjct: 198 YLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARN 257

Query: 332 WLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDL 391
           WL ANALKPYHSWVYWRD DIELCPG+++ED+M+ + DV VPNVWRPLPEFL  EQ YDL
Sbjct: 258 WLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDL 317

Query: 392 NSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSI 451
           NSW+ES EALKLA TL EDDVIVEGYAEYPTWRVHL YIR    +P            SI
Sbjct: 318 NSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSI 377

Query: 452 LAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEI 511
           LAKAKLFR+GVHFPAFTFENHAETE FGKMAK+M YRVGGLPHYT+WHIYEPSDDDLKEI
Sbjct: 378 LAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEI 437

Query: 512 ANKERQSR 519
           A KER+ R
Sbjct: 438 AKKEREKR 445

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/420 (70%), Positives = 364/420 (86%), Gaps = 5/420 (1%)

Query: 99  LSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVE 158
           L D EYY+YDF+N +  ++ KF++G +HYLIS++G++VLTP+DK +YE+EL  LL  +V+
Sbjct: 81  LEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQ 140

Query: 159 KYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCS 218
            YDL K+ G+ NG +NR+H+LLCVPLRDAE VLPLMFK++MN+TYPHELIDLAFLVSDC+
Sbjct: 141 NYDLSKYSGTENGIQNREHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCT 200

Query: 219 DGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVET 278
           +GD+TLE+L+ YSRHLQ+GTL+ +FQ+MD+      D  + ++ L+LKYMN++YLKMVE 
Sbjct: 201 EGDHTLESLIAYSRHLQDGTLAGLFQEMDK-----DDSKKDSEKLYLKYMNKDYLKMVED 255

Query: 279 AFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANAL 338
           A++ P H +Y+KPFRSVQIF+KDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWLM NAL
Sbjct: 256 AYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNAL 315

Query: 339 KPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESD 398
           KPYH+WVYWRDAD+ELCPGT++ED+M+ ++DV+VPNVWRPLPEFL+SEQPYDLNSW+ES+
Sbjct: 316 KPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESN 375

Query: 399 EALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAKLF 458
           EALKLAK L EDDVIVEGYAEYPTWRVHLAYIRE  G+P            SIL KAKLF
Sbjct: 376 EALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLF 435

Query: 459 RSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQS 518
           RSG+HFPAFTFENHAETE FGKMAK+MG+RVGGLPHYT+WHIYEPSDDDL EIA+KER++
Sbjct: 436 RSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKEREN 495

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/527 (58%), Positives = 387/527 (73%), Gaps = 26/527 (4%)

Query: 5   LHKFGRNSRKDAKLELPISRNNSNVADELKKQRFIPK-KKSTAKN----VAIGSVVSFII 59
           L +F RNS K     LP+S          +  R +PK  K    N    V+  +V   +I
Sbjct: 8   LFRFSRNSYK-----LPLSEKTKEKRKN-RDFRLLPKYSKFKVTNFRDKVSNFNVALSVI 61

Query: 60  CALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGK 119
              I+   +   N S  + K N + ++    + ++ T  L+  EYYNYDF +   D + K
Sbjct: 62  LLCIFIAKTISVNVS--IYKYNSFVHEEETETVTFDTQVLTAPEYYNYDFHDYNLDTISK 119

Query: 120 FENGVQHYLISEFGTD---VLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRD 176
           ++ GV+ YL+  + TD    L+ + KE Y+ EL  LL +SV+ YD+K F G+ +G  +R+
Sbjct: 120 YDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSRE 179

Query: 177 HLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQN 236
           H+LLC+PLRDAE VLPLMFK+LMN+TYPHELID+AFLVSDCS+ D+TLE+LLQY+R LQN
Sbjct: 180 HVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQN 239

Query: 237 GTLSQVFQDMDEYQ------YEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDK 290
           GTL  VF++MD+         E++DD++    L+LKYM +EYL+ V+ AF +P HENYDK
Sbjct: 240 GTLPDVFEEMDKLDEMTDKVVENADDSK----LYLKYMKKEYLQRVKEAFKSPFHENYDK 295

Query: 291 PFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDA 350
           PFRS+QI++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWLM NALKPYHSWVYWRDA
Sbjct: 296 PFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDA 355

Query: 351 DIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPED 410
           D+ELCPGT++ED+M+ D+DV+VPNVWRPLPEF++SEQPYDLNSW+ES EA+ LAK L ED
Sbjct: 356 DVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHED 415

Query: 411 DVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFE 470
           +VIVEGYAEYPTWRVHLAY+RE  GDP            SILA+A+LFR+GVHFPAFTFE
Sbjct: 416 EVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTFE 475

Query: 471 NHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQ 517
           NHAETE FGKMAK+MG+RVGGLPHYT+WHIYEPSDDDL  IA KE++
Sbjct: 476 NHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKE 522

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/515 (58%), Positives = 378/515 (73%), Gaps = 22/515 (4%)

Query: 13  RKDAKLELPISRNNSNVADELKKQRFIPKKKSTAKNVAIGSVVSFIICALIYCGYSYFFN 72
           ++  K ELP +R+      +L  ++ +  +K  +       +++  +   + C  +   +
Sbjct: 11  KQKQKDELPTTRS------KLYPKKSVYDRKRRSPAFYWTCILATCLAIYLLCKATLGDS 64

Query: 73  TSPRLGKINLY-----------ANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFE 121
           +   L  IN Y           +NKN K        EL D EYY+YDF +I+      F+
Sbjct: 65  SFDPLSAINNYNSYGSYPLSRSSNKNYK-----NAKELEDVEYYDYDFRSIDEMSFHNFD 119

Query: 122 NGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLC 181
            G QHYLI+++G DV+T KDKE+Y +E+  LL +SV+KYDL +F+G+ NGAENR+HLL  
Sbjct: 120 QGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYL 179

Query: 182 VPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQ 241
            PLRDAE VLP+MFKHLMN+TYPHELID+AFLVSDCS+GD TL+ L+ ++RHLQ+GTL  
Sbjct: 180 TPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVD 239

Query: 242 VFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKD 301
           +F+DMD    +           +LK+M+Q Y+KM + +F  P H  Y+KPFRSVQIF+KD
Sbjct: 240 IFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKD 299

Query: 302 FGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVE 361
           FGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYHSWVYWRDAD+ELCPG++++
Sbjct: 300 FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQ 359

Query: 362 DMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYP 421
           D+M+ +YDV+VPNVWRPLPEFL+ EQPYDLNSW+ES EAL+LAKTL EDDVIVEGYAEYP
Sbjct: 360 DLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYP 419

Query: 422 TWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKM 481
           TWRVHLAY+R+  GDP            SILAKAKLFR GVHFPAFTFENHAETE FGKM
Sbjct: 420 TWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKM 479

Query: 482 AKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKER 516
           AK+MGY VGGLP+Y +WHIYEPSDDDLK++A  ER
Sbjct: 480 AKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/507 (60%), Positives = 384/507 (75%), Gaps = 16/507 (3%)

Query: 11  NSRKDAKLELPISRNNSNVADELKKQRFIPKKKSTA-KNVAIGSVVSFIICALIYCGYSY 69
           ++++  +  LPISR  S  A   K  +FI KKK+   + +A G+++  +I ++       
Sbjct: 19  DNKRGGEYSLPISRTGSE-ATLSKHDKFIAKKKNFKFRKLATGAIIVIVIVSIFLV---- 73

Query: 70  FFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLI 129
           FFN    +  I+L ++  +K    Y   E  D  Y+++DFE+I+ D++ KF+ G+ +YLI
Sbjct: 74  FFNI--EVSPISLPSSFYHK---EYLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLI 128

Query: 130 SEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAES 189
           SE+GT+  +  D  +Y   L MLLD++VEKYDL  F GS +G E ++H+L+CVPLRDAE 
Sbjct: 129 SEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEE 188

Query: 190 VLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEY 249
           VLPLMFK+LMN+TYPHELIDLAFLVSDCS+GD TLEAL  YS+ LQ G L  +  DMD Y
Sbjct: 189 VLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNY 248

Query: 250 QYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQG 309
               S+++     +HLKYM  +YLK V+ A+  P H NY KPFRSVQIF+KDFGQVIGQG
Sbjct: 249 NKGKSNES-----IHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQG 303

Query: 310 FSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYD 369
           FSDRHAVKVQGIRRKLMGRARNWLM+NALKPYHSWVYWRDAD+ELCPG+++ED+M  DYD
Sbjct: 304 FSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYD 363

Query: 370 VLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAY 429
           V+VPNVWRPLP+FL+S QPYDLNSW+ES+EAL+LAKTL EDDVIVEGYAEYPT+RVHLAY
Sbjct: 364 VIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAY 423

Query: 430 IREAQGDPTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRV 489
           IRE  GDPT           SILA+A++FR GVHF AFTFENHAETE FGKMAK++G+RV
Sbjct: 424 IREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRV 483

Query: 490 GGLPHYTIWHIYEPSDDDLKEIANKER 516
           GGLPHYT+WHIYEPSDDDL  +A  E+
Sbjct: 484 GGLPHYTLWHIYEPSDDDLLAMAKLEK 510

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/513 (58%), Positives = 374/513 (72%), Gaps = 22/513 (4%)

Query: 14  KDAKLELPISRNNSNVADELKKQRFIPKKKST---AKNVAIGSVVSFIICALIYCGYSYF 70
           KD +LELP+  ++       K   F PK       AK   +    S I+        S F
Sbjct: 6   KDKRLELPMHHDSKQ-----KGNHFRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTF 60

Query: 71  FNTSPRLG-KINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLI 129
              S  +G  +NL           Y  T L ++EYY+YDF+ ++ D + K++ GV HY+I
Sbjct: 61  LLLSKLVGGNVNL---------MQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYII 111

Query: 130 SEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAES 189
           S+ G + L+ +DKE +E+E  MLL ++ + YDL +++G+ NGA NRDH+LLCVPLRDA S
Sbjct: 112 SKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAAS 171

Query: 190 VLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEY 249
           +LP++FK+LMN+TYPHELID+AFLVSDC+D   T+ +LL +S+ LQNGTLS+  QD +  
Sbjct: 172 LLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEA- 230

Query: 250 QYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQG 309
                D     + L+LKYM ++YLKMV+ AFN P H++YDKPFRS+QIF KDFGQ IGQG
Sbjct: 231 ---DKDKGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQG 287

Query: 310 FSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYD 369
           FSDRHAVKVQG+RRKLMGRARNWL ANALKPYHSWVYWRD D+ELCPGT++ED+M +DYD
Sbjct: 288 FSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYD 347

Query: 370 VLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAY 429
           V+VPNVWRPLP FL   Q YDLNSW+ES+EA+KLAKTL EDDVIVEGYAEYPTWRVHL Y
Sbjct: 348 VIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGY 407

Query: 430 IREAQGDPTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRV 489
           +R+  G+P            SILA+A+LFR G+HFPAFTFENHAETE FGKMAK+MG++V
Sbjct: 408 LRKDNGNPDDLLDLDGVGGVSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKV 467

Query: 490 GGLPHYTIWHIYEPSDDDLKEIANKERQSRHKE 522
           GGL HYT+WHIYEPSDDDL+EIA  ER+SR  +
Sbjct: 468 GGLMHYTLWHIYEPSDDDLREIAKLERESRRNQ 500

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/409 (69%), Positives = 335/409 (81%), Gaps = 12/409 (2%)

Query: 116 VLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENR 175
           +L KF+NG +HYLIS+ G ++L   DKE+YE+E+  LLD++VE YDL+ F+GS  G  NR
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 176 DHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQ 235
           +H+LL VPLR+AE VLPLMFK+LMN+TYPHELIDLAFLVSDCS+ D TLEALL+Y + LQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 236 NGTLSQVFQDMDEYQYEHSDDT-----RGTKNLHLKYMNQEYLKMVETAFNTPPHENYDK 290
           +GTLS VF         HS D      +GT +L LKYM   YLKMV+ A++ P H+ YDK
Sbjct: 121 SGTLSDVFA-------AHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDK 173

Query: 291 PFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDA 350
           PFRSVQIF+KDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYHSWVYWRDA
Sbjct: 174 PFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDA 233

Query: 351 DIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPED 410
           D+ELCPG++++D+M+ D+DV VPNVWRPLPEFL  EQPYDLNSWIESD AL+LA+TL ED
Sbjct: 234 DVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDED 293

Query: 411 DVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFE 470
           DVIVEGYAEYPTWRVHLAY+R+   +P            SILAKAKLFR+GVHFPAFTFE
Sbjct: 294 DVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFE 353

Query: 471 NHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSR 519
           NHAETE FGKMAK+MGYRV GLPHYT+WHIYEPSDDDL +IA +ER+ +
Sbjct: 354 NHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKK 402

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/496 (59%), Positives = 362/496 (72%), Gaps = 6/496 (1%)

Query: 27  SNVADELKKQRFIPKKKSTAKNVAIGSVVSFIICALIYCGYSYFF--NTSPRLGKINLYA 84
           +NV    +  R+ PK K    N  +   +  +I +L+     +F    T  R G      
Sbjct: 30  TNVPLSPQNSRYHPKVKGKF-NFRLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSY 88

Query: 85  NKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQ 144
                +S SY T  L + EYYN+++  ++ D + ++++G +H LI + GT  L    +E 
Sbjct: 89  AGLLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LNSNQEEG 146

Query: 145 YEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYP 204
           +E+ L MLL  +VE YDL K+ G+ NGAENR+H+L+CVPLR+AE+VLPLMF+HLMN+TYP
Sbjct: 147 FEEHLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYP 206

Query: 205 HELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTK-NL 263
           HELIDLAFLVSDCS  D+T+++L+ Y+  LQ GTLS+  +  D Y+      ++  + +L
Sbjct: 207 HELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSKNKEGDL 266

Query: 264 HLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRR 323
           HLKYMN++YL MVE A   P H+NYDKPFRSVQIF+KDFGQ+IGQGFSDRH VKVQG RR
Sbjct: 267 HLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRR 326

Query: 324 KLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFL 383
           KLMG+ARNWL ANALKPYHSWVYWRDAD+ELCPG+++ED+M+  YDV+VPNVWRPLPEFL
Sbjct: 327 KLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFL 386

Query: 384 DSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXX 443
            SEQ YDLNSWIESD AL LAKTL EDDVIVEGYAEY TWR HLA  R+ QG+       
Sbjct: 387 GSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDL 446

Query: 444 XXXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEP 503
                 SILAKAKLFR+GVHF AF FENHAETE FGKMAK+MGYRVGGL HYT+WHIYEP
Sbjct: 447 DGVGGVSILAKAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEP 506

Query: 504 SDDDLKEIANKERQSR 519
           S+DDL EIA KER SR
Sbjct: 507 SNDDLMEIARKERSSR 522

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/434 (61%), Positives = 340/434 (78%), Gaps = 4/434 (0%)

Query: 87  NNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYE 146
           +++ +  ++   L D EYY+Y+F    A+ L K++ G +HY ++  G      +D  ++E
Sbjct: 53  DDERAAEWEPQVLDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFE 109

Query: 147 KELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHE 206
           +++  L+ A+VE+YDL+ ++G+ NGAENR+H+L+C+PLR+A  VLP+MFKHLMN+TYPHE
Sbjct: 110 EQMEELVSATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHE 169

Query: 207 LIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVF-QDMDEYQYEHSDDTRGTKNLHL 265
           LID+AFLVSDCS+ D TL++L++Y+ +LQ GTL+ V  ++  E +   +    G  +L+L
Sbjct: 170 LIDVAFLVSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYL 229

Query: 266 KYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKL 325
           KYM+QEYL+MV  AF+ P HENY+KPFRSVQ+F+KDFGQ IGQGFSDRH VKVQGIRR+L
Sbjct: 230 KYMDQEYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRL 289

Query: 326 MGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDS 385
           MGRARNWL ANALKPYHSWVYWRD D+ELCPG+++ED+M+  YDV+VPNVWRPLPEFL  
Sbjct: 290 MGRARNWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGG 349

Query: 386 EQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXX 445
           +Q YDLNSWIES +AL LAK L EDDVIVEGYAEY TWR HL   REA+G+P        
Sbjct: 350 KQGYDLNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDG 409

Query: 446 XXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSD 505
               SILAKAKLFR G HF AF FENHAETE FGKMAK+MGY+VGGLPHYT+WHIYEPSD
Sbjct: 410 VGGVSILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSD 469

Query: 506 DDLKEIANKERQSR 519
           DD+ +IA +ER++R
Sbjct: 470 DDIMDIARRERENR 483

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/340 (72%), Positives = 280/340 (82%), Gaps = 2/340 (0%)

Query: 182 VPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQ 241
           VPLR+A+ VLPLMFK+LMN+TYPHELIDLAFLVSDCS+ D T EALL+Y++ LQ+GTLSQ
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 242 VFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKD 301
           VF   +    E+     G+ +L LKYM   YLKMV+ AF  P H+NYDKPFRSVQIF+K+
Sbjct: 62  VFASHN--SGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKN 119

Query: 302 FGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVE 361
           FGQVIGQ FSDRHAVKVQG RRKLMGRARNWL ANALKPYHSWVYWRDAD+ELCPG+++E
Sbjct: 120 FGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE 179

Query: 362 DMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYP 421
           D+MA  YDV VPNVWRPLPEFL  EQ YDLNSW+ESD AL LAK L EDDVIVEGYAEYP
Sbjct: 180 DLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYP 239

Query: 422 TWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKM 481
           TWRVHL YIRE  GDP S          SILAKA+LFR+GVHFPAFTFENHAETE FGKM
Sbjct: 240 TWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKM 299

Query: 482 AKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSRHK 521
           AK+MGY V GLPHYT+WHIYEPSDDDL ++  +ER+S+ +
Sbjct: 300 AKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 190/369 (51%), Positives = 239/369 (64%), Gaps = 52/369 (14%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
            V+ YDL  + G+++G +  D +L CVPLRDA + LP+ FKHL +MTYPH LIDL+FLVS
Sbjct: 49  GVDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVS 108

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D +D  +T+  LL     LQ+                      GTK              
Sbjct: 109 DSTD--DTMGVLLNSLHDLQS-------------------QADGTKR------------- 134

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
                           F  ++IF+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 135 ----------------FGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 178

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            A+KPYHSWVYWRD D+E  P TI+ED+M +D D++VPNVWRPLP++L+  QPYDLNSW+
Sbjct: 179 AAIKPYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWV 238

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES+  L+LA +L EDDVIVEGY EY TWRVHLAY+R+  GDP +          SIL+KA
Sbjct: 239 ESEGGLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKA 298

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA--N 513
           K+FR+G HFPAF+FE HAETE FGK+++RM Y V GLPHY IWH+YEPS DDLK +A   
Sbjct: 299 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMA 358

Query: 514 KERQSRHKE 522
           +E Q + +E
Sbjct: 359 EEEQRKMEE 367

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  375 bits (963), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 189/357 (52%), Positives = 229/357 (64%), Gaps = 50/357 (14%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
           SVE YDL+ + G+++G +  D +L CVPLRDA   LP+ F HL  MTYPH LIDL+FLVS
Sbjct: 61  SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS 120

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D SD  NT+  LL       N  ++Q  QD                              
Sbjct: 121 DSSD--NTMGVLLS------NLQMAQSQQDKS---------------------------- 144

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
                         K F +++I+ KDFGQ+IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 145 --------------KRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGS 190

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            ALKPYHSWVYWRD D+E  P TI+ED+M +D DV+VPNVWRPLP++L + QPYDLNSW 
Sbjct: 191 VALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 250

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES+  L+LA +L ED VIVEGY EY TWR HLAY+R+  G+P            SILAKA
Sbjct: 251 ESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKA 310

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512
           K+FR+G HFPAF+FE HAETE FG++++RM Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 311 KVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  374 bits (960), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 189/366 (51%), Positives = 231/366 (63%), Gaps = 50/366 (13%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
            VE YDL  + G+++G +  D +L CVPLRDA   LP+ F HL  MTYPH LIDL+FLVS
Sbjct: 81  GVEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVS 140

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D SD  NT+  LL    +LQN    Q                                  
Sbjct: 141 DSSD--NTMGVLLS---NLQNAQSQQ---------------------------------- 161

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
                      +  K F +++IF KDFGQ+IGQ FSDRH  K QG RRKLM RARNWL +
Sbjct: 162 -----------DRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGS 210

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            A+KPYHSWVYWRD D+E  P TI+ED+M +D DV+VPNVWRPLP++L + QPYDLNSW 
Sbjct: 211 VAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQ 270

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES+  L+LA +L ED VIVEGY EY TWR HLAY+R+  G+P            SIL+KA
Sbjct: 271 ESEGGLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKA 330

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKE 515
           K+FRSG HFPAF+FE HAETE FGK+++RM + V GLPHY IWHIYEPS +DLK +A   
Sbjct: 331 KVFRSGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMA 390

Query: 516 RQSRHK 521
            + + K
Sbjct: 391 EEEKRK 396

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  373 bits (958), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 188/356 (52%), Positives = 226/356 (63%), Gaps = 50/356 (14%)

Query: 157 VEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSD 216
           VE YDL+ + G+++G +  D +L CVPLRDA   LP+ F HL  MTYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 217 CSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMV 276
            SD  NT+  LL                                 NLH     Q+     
Sbjct: 122 SSD--NTMGVLLS--------------------------------NLHKAQSQQDK---- 143

Query: 277 ETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 336
                        K F +++I+ KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 144 ------------SKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSV 191

Query: 337 ALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIE 396
           ALKPYHSWVYWRD D+E  P TI+ED+M +D DV+VPNVWRPLP++L + QPYDLNSW E
Sbjct: 192 ALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 251

Query: 397 SDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAK 456
           S+  L+LA  L ED VIVEGY EY TWR HLAY+R+  G+P            SILAKAK
Sbjct: 252 SEGGLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAK 311

Query: 457 LFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512
           +FR+G HFPAF+FE HAETE FG++++RM Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 312 VFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  370 bits (951), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 185/366 (50%), Positives = 231/366 (63%), Gaps = 52/366 (14%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
            VE YDL  + G  +G +  D +L CVPLRDA   LP+ F HL  MTYPH LIDL+FLVS
Sbjct: 53  GVEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVS 112

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D SD  NT+  L+    HLQ                                        
Sbjct: 113 DSSD--NTMGVLMH---HLQQA-------------------------------------- 129

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
                     ++ +K F +++IF KDFGQ+IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 130 ---------QKDKNKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 180

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            A+KPYHSWVYWRD D+E+ P +I+ED+M +D DV+VPNVWRPLP++L + QPYDLNSW+
Sbjct: 181 VAIKPYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWV 240

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES+  L+LA TL ED VIVEGY EY TWR HLAY+R+  G+P            SIL+KA
Sbjct: 241 ESEGGLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKA 300

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKE 515
           ++FR+G HFPAF+F+ HAETE FGK+++RMG+ V GLPHY IWHIYEPS DDLK +A   
Sbjct: 301 RVFRAGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMA 360

Query: 516 RQSRHK 521
            + + K
Sbjct: 361 EEEKRK 366

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  370 bits (950), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 191/370 (51%), Positives = 231/370 (62%), Gaps = 53/370 (14%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
            VE +DL    G  +G    D +L CVPLRDA   LP+ FKHL  MTYPH L+DL+FLVS
Sbjct: 41  GVEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVS 100

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D  D   T+  L Q+ R LQ+                  D+ R                 
Sbjct: 101 DSKD--ETMSVLRQHVRELQS----------------QPDNARQ---------------- 126

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
                           F +++IF+KDFGQ IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 127 ----------------FGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGS 170

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            ALKPYHSWVYWRD D+E  P TI+ED+M +D DV+VPNVWRPLP++L   QPYDLNSW+
Sbjct: 171 VALKPYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWV 230

Query: 396 ESDEALKLAKTLP-EDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAK 454
           ES+  L+LA   P ED VIVEGY EY TWRVHLAY+R+  GDP +          SIL++
Sbjct: 231 ESEGGLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSR 290

Query: 455 AKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA-- 512
           A++FRSG HFPAF+F+ HAETEGFGK+++ MGY V GLPHY IWHIYEPS DDLK +A  
Sbjct: 291 ARVFRSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWM 350

Query: 513 NKERQSRHKE 522
            +E Q R +E
Sbjct: 351 AEEEQRRLEE 360

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  370 bits (949), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 188/367 (51%), Positives = 230/367 (62%), Gaps = 50/367 (13%)

Query: 155 ASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLV 214
           A+ E YDLK + G+ NG +  D +L CVPLRDA   LP+ FKHL  MTYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 215 SDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLK 274
           SD  D                                    DT G             L 
Sbjct: 125 SDSKD------------------------------------DTMGV-----------LLS 137

Query: 275 MVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLM 334
            ++TA +    ++  K F +++ F KDFGQ+IGQ FSDRH    QG RRKLM RARNWL 
Sbjct: 138 NLQTAQS---QKDRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLG 194

Query: 335 ANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSW 394
           + A+KPYHSWVYWRD D+E  P TI+ED+M +  DV+VPNVWRPLPE+L + QPYDLNSW
Sbjct: 195 SVAIKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSW 254

Query: 395 IESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAK 454
            ESD  L+LA +L +D VIVEGY EY TWR HLAY+R+  GDP            SIL+K
Sbjct: 255 QESDAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSK 314

Query: 455 AKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANK 514
           A++FRSG HFPAF+FE HAETE FGK+++RMGY V GLPHY IWHIYEPS +DLK +A  
Sbjct: 315 ARVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWM 374

Query: 515 ERQSRHK 521
             + + K
Sbjct: 375 AEEEQRK 381

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  370 bits (951), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 187/359 (52%), Positives = 228/359 (63%), Gaps = 50/359 (13%)

Query: 154 DASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFL 213
           +  VE YDL  + G+++G +  D +L CVPLRDA   LP+ F HL  M+YPH  IDL+FL
Sbjct: 84  NPGVEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFL 143

Query: 214 VSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYL 273
           VSD SD  +T+  LL    +LQN    Q                                
Sbjct: 144 VSDSSD--DTMGVLLS---NLQNAQSQQ-------------------------------- 166

Query: 274 KMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 333
                        +  K F +++IF KDFGQVIGQ FSDRH    QG RRKLM RARNWL
Sbjct: 167 -------------DKSKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWL 213

Query: 334 MANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNS 393
            + A+KPYHSWVYWRD D+E  P TI+ED+M +D DV+VPNVWRPLP++L + QPYDLNS
Sbjct: 214 GSVAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNS 273

Query: 394 WIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILA 453
           W ES+  L+LA TL EDDVIVEGY EY TWR HLAY+R+  G+P            SILA
Sbjct: 274 WKESEGGLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILA 333

Query: 454 KAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512
           KAK+FR+G HFPAF+FE HAETE FGK++++M Y V GLPHY IWHIYEPS +DLK +A
Sbjct: 334 KAKVFRTGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  370 bits (950), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 185/357 (51%), Positives = 228/357 (63%), Gaps = 50/357 (14%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
            VE YDL+ + G+++G +  D +L CVPLRDA   LP+ F HL  M+YPH LIDL+FLVS
Sbjct: 61  GVEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVS 120

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D SD  NT+  LL                                            L+M
Sbjct: 121 DSSD--NTMGVLLSK------------------------------------------LQM 136

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
            ++       ++  K F +++I+ KDFGQ+IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 137 AQS------QQDKTKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGS 190

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            ALKPYHSWVYWRD D+E  P TI+ED+M +D DV+VPNVWRPLP++L + QPYDLNSW 
Sbjct: 191 VALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 250

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES+  L+LA  L ED VIVEGY EY TWR HLAY+R+  G+P            SILAKA
Sbjct: 251 ESEGGLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKA 310

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512
           K+FR+G HFPAF+FE HAETE FG++++RM Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 311 KVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  370 bits (949), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 183/356 (51%), Positives = 226/356 (63%), Gaps = 50/356 (14%)

Query: 157 VEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSD 216
           VE YDL+ + G+++G +  D +L CVPLRDA   LP+ F HL  M+YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 217 CSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMV 276
            SD  NT+  LL   +  Q+                                        
Sbjct: 122 SSD--NTMGVLLSSLQTAQS---------------------------------------- 139

Query: 277 ETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 336
                    ++  K F +++I+ KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 140 --------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSV 191

Query: 337 ALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIE 396
           ALKPYHSWVYWRD D++  P TI+ED+M +D DV+VPNVWRPLP++L + QPYDLNSW E
Sbjct: 192 ALKPYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 251

Query: 397 SDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAK 456
           S+  L+LA  L ED VIVEGY EY TWR HLAY+R+  G+P            SILAKAK
Sbjct: 252 SEGGLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAK 311

Query: 457 LFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512
           +FR+G HFPAF+FE HAETE FG++++RM Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 312 VFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  369 bits (947), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 184/366 (50%), Positives = 233/366 (63%), Gaps = 50/366 (13%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
           +V+ YDL+ + G  +G +  DH+L  VPLRDA   LP+ F H+  ++YPH LIDL+FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D SD  +T+  LL                                          EYL+ 
Sbjct: 112 DSSD--DTMGVLL------------------------------------------EYLQK 127

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
            ++        +  + F +++I+ KDFGQ IGQ FSDRH    QG RRKLMGRARNWL +
Sbjct: 128 AQSK------PDRTQRFGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGS 181

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            ALKPYHSWVYWRD D+E  P TI+ED+M +D DV+VPNVWRPLP++L + QPYDLNSW 
Sbjct: 182 VALKPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQ 241

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES+  L+LA++L ED VIVEGY EY TWR HLAY+R+  GDP            SIL+KA
Sbjct: 242 ESEGGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKA 301

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKE 515
           K+FR+G HFPAF+FE HAETE FGK+++R+GY V GLPHY IWHIYEPS DDLK +A   
Sbjct: 302 KVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMA 361

Query: 516 RQSRHK 521
            + + K
Sbjct: 362 EEEKRK 367

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  369 bits (946), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 185/366 (50%), Positives = 229/366 (62%), Gaps = 50/366 (13%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
            VE YDL+ + G+R+G +  D +L  VPLRDA   LP+ F H+  ++YPH LIDL+FLVS
Sbjct: 52  GVEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVS 111

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D SD                                    DT G    HLK    +    
Sbjct: 112 DSSD------------------------------------DTMGVLLDHLKKAQSK---- 131

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
                      +  K F +++IF KDFGQ IGQ FSDRH    QG RRKLMGRARNWL +
Sbjct: 132 ----------TDRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGS 181

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            ALKPYHSWVYWRD D+E  P TI+ED+M +D DV+VPNVWRPLP++L + QPYDLNSW 
Sbjct: 182 VALKPYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQ 241

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES+  ++LA++L ED VIVEGY EY TWR HLAY+R+  G+P            SIL+KA
Sbjct: 242 ESEGGMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKA 301

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKE 515
           K+FR+G HFPAF+FE HAETE FGK+++R+GY V GLPHY IWHIYEPS DDLK +A   
Sbjct: 302 KVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMA 361

Query: 516 RQSRHK 521
            + + K
Sbjct: 362 EEEKRK 367

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  367 bits (942), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 228/357 (63%), Gaps = 50/357 (14%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
            VE YDL+ + G+ +G +  D +L CVPLRDA   LP+ F+HL  MTYPH  IDL+FLVS
Sbjct: 61  GVEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVS 120

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D S  D+T+  LL    HLQ+         MD+                           
Sbjct: 121 DSS--DDTMGVLLS---HLQSAQ-----SQMDK--------------------------- 143

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
                         K F +++I+ KDFGQ+IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 144 -------------SKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 190

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            ALKPYHSWVYWRD D+E  P TI+ED+M +D DV+VPNVWRPLP++L + QPYDLNSW 
Sbjct: 191 VALKPYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQ 250

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES+  L+LA+ L ED VIVEGY EY TWR HLAY+R+  GDP            SIL+KA
Sbjct: 251 ESEGGLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKA 310

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512
           K+FR+G HFPAF+FE HAETE FG++++RM Y V GLPHY IWHIYEPS +DLK +A
Sbjct: 311 KVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMA 367

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  367 bits (943), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 182/365 (49%), Positives = 229/365 (62%), Gaps = 50/365 (13%)

Query: 157 VEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSD 216
           VE YDL  + G+ +G +  D +L CVPLRDA   LP+ FKH+  ++YPH LIDL+FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 217 CSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMV 276
            S                                    DDT G               ++
Sbjct: 142 SS------------------------------------DDTMGV--------------LL 151

Query: 277 ETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 336
            +      +++  + F +++IF KDFGQVIGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 152 SSLKKAQSNQDKSQRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 211

Query: 337 ALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIE 396
           ALKPYHSWVYWRD D+E  P TI+ED+M ++ DV+VPNVWRPLP++L + QPYDLNSW E
Sbjct: 212 ALKPYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKE 271

Query: 397 SDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKAK 456
           S+  L+LA +L ED VIVEGY EY TWR HLAY+R+  GDP +          SIL+KAK
Sbjct: 272 SEGGLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKAK 331

Query: 457 LFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKER 516
           +FR+G HFPAF+FE HAETE FGK+++RM Y V GLPHY IWH+YEPS DDLK +A    
Sbjct: 332 VFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAE 391

Query: 517 QSRHK 521
           + + K
Sbjct: 392 EEKRK 396

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  365 bits (937), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 185/368 (50%), Positives = 231/368 (62%), Gaps = 54/368 (14%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
           SVE YD+  + G ++G    + +L+CVPL+DA + LPL FK L  MTYPHELIDL+FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 216 DCSDGDNTLEALLQYSRHLQ--NGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYL 273
           D SD  NT+  LL   + LQ   GT  +                                
Sbjct: 114 DSSD--NTMYNLLNMLKRLQIDGGTSGK-------------------------------- 139

Query: 274 KMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 333
                             F +++I+ KDFGQVIGQGFSDRH    QG RRKLMG+ARNWL
Sbjct: 140 ------------------FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWL 181

Query: 334 MANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNS 393
              A+KPYHSWVYWRD D+E+ P TI+ED+M +D DV+VPNVWRPLP++L + QPYDLNS
Sbjct: 182 NTVAIKPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNS 241

Query: 394 WIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILA 453
           W ES+  L L+ +L ED VIVEGY EY TWR HLAY+R+  GDP            SIL+
Sbjct: 242 WKESEAGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILS 301

Query: 454 KAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIAN 513
           KA +FRSG HFPAF+F+ HAETE FGK++K M + V GLP+Y +WHIYEPS +DL+ +A 
Sbjct: 302 KANVFRSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAK 361

Query: 514 KERQSRHK 521
            E + R K
Sbjct: 362 LEEKERLK 369

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  367 bits (943), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 184/356 (51%), Positives = 224/356 (62%), Gaps = 50/356 (14%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
           +VE YDL+ + G+++G +  D ++ CVPLRDA   LP  F HL  M+YPH LIDL+FLVS
Sbjct: 64  NVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVS 123

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D SD                                    DT G             L  
Sbjct: 124 DSSD------------------------------------DTMGV-----------LLSN 136

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
           ++TA       +  K F +++I+ KDFGQVIGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 137 LQTA---QSQRDKSKRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGS 193

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            ALKPYHSWVYWRD DIE  P TI+ED+M +D D++VPNVWRPLP++L + QPYDLNSW 
Sbjct: 194 VALKPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQ 253

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES+  L+LA  L ED VIVEGY EY TWR HLAY+R+  GDP            SIL+KA
Sbjct: 254 ESEGGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKA 313

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEI 511
            +FRSG HFPAF+FE HAETE FGK+++RMGY V GLPHY +WHIYEPS +DLK +
Sbjct: 314 NVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDLKHM 369

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  367 bits (943), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 187/366 (51%), Positives = 225/366 (61%), Gaps = 50/366 (13%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
            V  YDL  + G+ +G +  D +L CVPLRDA   LP  F HL  MTYPH LIDL+FLVS
Sbjct: 71  GVHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVS 130

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D  D  +T+  LL    HLQ     Q                                  
Sbjct: 131 DSKD--DTMGVLLS---HLQTAQSQQ---------------------------------- 151

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
                      N  K F +++I+ KDFGQ+IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 152 -----------NKLKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 200

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            ALKPYHSWVYWRD D+E CP TI+ED+M +  DV+VPNVWRPLP++L + QPYDLNSW 
Sbjct: 201 VALKPYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQ 260

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES+  L+LA +L ED VIVEGY EY TWR HLAY+R+  GDP            SIL+KA
Sbjct: 261 ESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKA 320

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKE 515
           K+FRSG HFPAF+FE HAETE FGK+++RM Y V GLPHY +WHIYEPS +DLK +A   
Sbjct: 321 KVFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMA 380

Query: 516 RQSRHK 521
            + + K
Sbjct: 381 EEEKRK 386

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  369 bits (947), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 227/357 (63%), Gaps = 50/357 (14%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
            VE YDL  + G+++G +  D +L C+PLRDA   LP+ F H+  MTYPH L+DL+FLVS
Sbjct: 65  GVEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVS 124

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D SD  +T+  LL + + +Q+                                       
Sbjct: 125 DSSD--DTMGVLLSHLQTVQS--------------------------------------- 143

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
                     ++  K F +++I+ KDFGQ+IGQ FSDRH    QG RRKLM +ARNWL +
Sbjct: 144 ---------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGS 194

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            ALKPYHSWVYWRD DIE  P TI+ED+M +D D++VPNVWRPLP++L + QPYDLNSW 
Sbjct: 195 VALKPYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQ 254

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES+  L+LA  L E+ VIVEGY EY TWR HLAY+R+  GDP            SIL+KA
Sbjct: 255 ESEGGLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKA 314

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512
           K+FRSG HFPAF+FE HAETE FGK+++RM Y V GLPHY +WHIYEPS +DLK +A
Sbjct: 315 KVFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  358 bits (918), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 178/357 (49%), Positives = 225/357 (63%), Gaps = 50/357 (14%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
            VE YDL  + G+ NG +  D ++ CVPLRDA + L + F  L  +TYPH LIDL+FLVS
Sbjct: 56  GVEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVS 115

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D SD  +T++ LL + R  Q+                                       
Sbjct: 116 DSSD--DTMKTLLSHLRRAQS--------------------------------------- 134

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
                    +++  + F +++IF KDFGQ +GQ FSDRH    QG RRK M RARNWL +
Sbjct: 135 ---------NQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGS 185

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            ALKPYHS+VYWRD D++  P TI+ED+M +D DV+VPNVWRPLP++L + QPYDLNSW+
Sbjct: 186 AALKPYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWV 245

Query: 396 ESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAKA 455
           ES+  L+LA +L ED  IVEGY EY TWR HLAY+R+  GDP            SIL+KA
Sbjct: 246 ESEGGLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKA 305

Query: 456 KLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512
           K+FR+G HFPAF+FE HAETE FGK+++RM Y V GLPHY IWHIYEPS DDLK +A
Sbjct: 306 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMA 362

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  355 bits (910), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 181/358 (50%), Positives = 227/358 (63%), Gaps = 51/358 (14%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
            VE YDL+ + G R+G +  + +L  VPLRDA   LP  F H+  ++YPH LID++FLVS
Sbjct: 56  GVEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVS 115

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D SD  +T+  LL    HLQ   ++Q  +D +                            
Sbjct: 116 DSSD--DTMGELLH---HLQ---IAQSQKDRN---------------------------- 139

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
                         K F +++IF KDFGQ IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 140 --------------KRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGS 185

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
             LKPYHSWVYWRD D+E+ P +I+ED+M +D DV+VPNVWRPLP++L + QPYDLNSW 
Sbjct: 186 VTLKPYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWK 245

Query: 396 ESDEALKLAKTLP-EDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAK 454
           ES+  ++LA TL  ED VIVEGY E+ TWR HLAY+R+  G+P            SILAK
Sbjct: 246 ESEAGIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAK 305

Query: 455 AKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512
           AK+FR+G HFPAF+FE HAETE FGK+++RM Y V GLPHY IWHIYEPS +DLK +A
Sbjct: 306 AKVFRTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMA 363

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  356 bits (913), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 180/358 (50%), Positives = 226/358 (63%), Gaps = 51/358 (14%)

Query: 156 SVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVS 215
           +VE YDL+ + G  +G +  + +L  VPLRDA   LP  F H+  MTYPH LID +FLVS
Sbjct: 62  NVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVS 121

Query: 216 DCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKM 275
           D SD  +T+ ALL +    Q+                + D TR                 
Sbjct: 122 DSSD--DTMGALLSHLEKAQS----------------NKDKTRR---------------- 147

Query: 276 VETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMA 335
                           F +++I+ KDFGQ IGQ FSDRH    QG RRKLM RARNWL  
Sbjct: 148 ----------------FGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGT 191

Query: 336 NALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWI 395
            ALK YHSWVYWRD D+ELCP +I+ED+M +D DV+VPNVWRPLP++L + QPYDLNSW 
Sbjct: 192 VALKAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWK 251

Query: 396 ESDEALKLAKTLPEDD-VIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILAK 454
           ES+  ++LA +LP+DD VIVEGY +Y TWR HLAY+R+  G+P            SIL+K
Sbjct: 252 ESEVGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSK 311

Query: 455 AKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIA 512
            K+FR+G HFPAF+FE HAETE FGK+++RMGY V GLPHY IWHIYEPS +DL+ +A
Sbjct: 312 GKVFRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  185 bits (469), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 170/352 (48%), Gaps = 61/352 (17%)

Query: 157 VEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSD 216
           +  YDL K   ++N A N++ +L+  P+++        + +L+ +TYP ELI+L F+V  
Sbjct: 95  IAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YWDNLLQLTYPRELIELGFIVPR 151

Query: 217 CSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMV 276
              G+  LE L    + +Q G                  + R  K   L+  +Q + K++
Sbjct: 152 TGSGNVALEQLEAAVKKVQTG----------------KKEDRFGKITILRQASQSFDKLL 195

Query: 277 ETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 336
           E                                  +RHA++VQ  RR  M  ARN L+ +
Sbjct: 196 E---------------------------------KERHALEVQKERRAAMALARNELLFS 222

Query: 337 ALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ------PYD 390
            + PY SW+ W DADI   P +++EDM A++  VL  NV++    + D EQ      PYD
Sbjct: 223 TIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ---RYYDQEQKKESIRPYD 279

Query: 391 LNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXS 450
            N+W ESD  L+LA  +  D+++VEGY E  T+R  +A+  E     T            
Sbjct: 280 YNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEMELDGVGGGC 339

Query: 451 ILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
            L KA + R G  FP F F +  ETEGF KMAKR+GY V GLP+Y ++HI E
Sbjct: 340 TLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  185 bits (470), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 110/349 (31%), Positives = 169/349 (48%), Gaps = 55/349 (15%)

Query: 157 VEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSD 216
           +  YDL K   + N A N++ +L+  P++         + +L+ +TYP EL++L F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPR 211

Query: 217 CSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMV 276
            + GDN L  L                                 K   L   +Q +LK  
Sbjct: 212 TTSGDNALRKL-----------------------------EAAVKKTQLSKKDQRFLK-- 240

Query: 277 ETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 336
                             + I R+D          DRHA++VQ  RR  M  ARN L+ +
Sbjct: 241 ------------------ITILRQDSQSFDLLKEKDRHALEVQKKRRSAMALARNELLFS 282

Query: 337 ALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ---PYDLNS 393
            + PY SWV W DADI   P T+++DM A+D  VL  NV++   +    ++   PYD N+
Sbjct: 283 TIGPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNN 342

Query: 394 WIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSILA 453
           W +SD AL++A ++P+D V+ EGY E  T+R  +A+  +    P++            L 
Sbjct: 343 WADSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLV 402

Query: 454 KAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
           KA++ R G  FP+F F +  ETEGF KMA+R+ Y + GLP+Y ++HI E
Sbjct: 403 KAEVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  182 bits (462), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 172/352 (48%), Gaps = 61/352 (17%)

Query: 157 VEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSD 216
           +  YDL K   ++  A N++ +L+  P+   ++     + ++++MTYP ELI+L F+   
Sbjct: 97  IAHYDLNKLHSTKQAAVNKERVLILTPM---QTFHEQYWDNILHMTYPRELIELGFIAPR 153

Query: 217 CSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMV 276
              GD  L+ L    + +Q+G                  + R  K + L+  +Q +  + 
Sbjct: 154 TPTGDAALKKLEAAIKKIQSG----------------KKNERFAKIIILRQESQSFDMLA 197

Query: 277 ETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 336
           E                                  DRHA+ VQ  RR  M  ARN L+ +
Sbjct: 198 E---------------------------------KDRHALAVQKQRRSAMALARNELLFS 224

Query: 337 ALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSE------QPYD 390
            L P+ SWV W DADI   P T+++D+ A+D  VL  NV++    F + E      +PYD
Sbjct: 225 TLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKADIRPYD 281

Query: 391 LNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXS 450
            N+W ES+  L+LA +LP D++IVEGYAE  T+R  +A+  +     +            
Sbjct: 282 FNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGVGGGC 341

Query: 451 ILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
            L KA++ R G  FP F F +  ETEGF KMAKR+GY V GLP+Y ++HI E
Sbjct: 342 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  180 bits (456), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 104/352 (29%), Positives = 173/352 (49%), Gaps = 61/352 (17%)

Query: 157 VEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSD 216
           +  YDL K   +     N++ +L+  P+   ++     + +L+ +TYP +LI+L F++  
Sbjct: 96  ISHYDLNKLTSTDKAFANKEQVLILTPM---QTFHDQYWDNLLQLTYPRDLIELGFIIPR 152

Query: 217 CSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMV 276
            + GD  L  L    +  Q G                                       
Sbjct: 153 TATGDTALRKLEAAVKRTQLG--------------------------------------- 173

Query: 277 ETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMAN 336
                       D+ F  + I R+D          +RHA+KVQ  RR  M  ARN L+ +
Sbjct: 174 ----------KKDQRFSKITILRQDSQSFDSLQEKERHALKVQKERRAAMALARNELLFS 223

Query: 337 ALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLD------SEQPYD 390
            + P+ SW+ W DADI   P ++++DM A++  VL  NV++   ++++      +E+PYD
Sbjct: 224 TIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQ---KYMNEETKKIAERPYD 280

Query: 391 LNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXS 450
            N+W +S++AL++A  + +D+V+ EGYAE PT+R  +A++ +A G   +           
Sbjct: 281 FNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAEMSLDGVGGGC 340

Query: 451 ILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
            L KA++ R G  FP+F F +  ETEGF KMA+R+ Y + GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHIEE 392

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  179 bits (455), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 108/358 (30%), Positives = 173/358 (48%), Gaps = 61/358 (17%)

Query: 151 MLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDL 210
           ++ +  + ++DL K   +++ + N++ +L+  PL+         +++++ ++YP ELI+L
Sbjct: 91  IISEGHIAEFDLNKLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSYPRELIEL 147

Query: 211 AFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQ 270
            F+V     GD  L++L                                           
Sbjct: 148 GFIVPRTQTGDLALQSL------------------------------------------- 164

Query: 271 EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 330
                 E A      +  ++ F  V I R+D          +RHA+ VQ  RR  M  AR
Sbjct: 165 ------EKAVEKTQTDKKNQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALAR 218

Query: 331 NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ--- 387
           N L+ + + P+ SWV W DADI   P T+++DM A+D  VL  NV++    + D E+   
Sbjct: 219 NELLFSTIGPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQ---RYYDDEKKAS 275

Query: 388 ---PYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXX 444
              PYD N+W ES+  L+LA  + +D++IVEGY+E  T+R  +AY  +     +      
Sbjct: 276 ATRPYDFNNWQESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILD 335

Query: 445 XXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
                  L KA++ R G  FP+F F +  ETEGF KMAKR+GY + GLP+Y ++HI E
Sbjct: 336 GVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  179 bits (454), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 110/358 (30%), Positives = 172/358 (48%), Gaps = 61/358 (17%)

Query: 151 MLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDL 210
           ++ +  +  YDL K   + N   N++ +L+  P+   ++     + +L+++TYP  LI+L
Sbjct: 90  LIPEGHIAHYDLNKLKSTSNALVNKERVLILTPM---QTFHQQYWNNLLSLTYPRALIEL 146

Query: 211 AFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQ 270
            F++   + GD  L+ L                                           
Sbjct: 147 GFIIPRTASGDAALQKL------------------------------------------- 163

Query: 271 EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 330
                 E+A         DK F  + I R+        G  DRHA++VQ  RR  M  AR
Sbjct: 164 ------ESAVREVQTGKQDKRFAKITILRQASQSFDRLGEKDRHALEVQKERRAAMALAR 217

Query: 331 NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ--- 387
           N L+ + + P+ SW+ W DADI   P T+++D+ +++  VL  NV++   +F D +Q   
Sbjct: 218 NELLFSTIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQKKE 274

Query: 388 ---PYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXX 444
              PYD N+W ES+  LKLA+ L ++++IVEGY+E  T+R  +A+  +A G   S     
Sbjct: 275 SIRPYDFNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELD 334

Query: 445 XXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
                  L KA++ R G  F  F F +  ETE F KMAKR+GY V GLP+Y ++HI E
Sbjct: 335 GVGGGCTLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  178 bits (452), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 107/358 (29%), Positives = 169/358 (47%), Gaps = 61/358 (17%)

Query: 151 MLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDL 210
           ++ +  +  YDL K   +++  + ++H+L+  P++         + +L+ M+YP  L++L
Sbjct: 90  IIPEGHIAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLEL 146

Query: 211 AFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQ 270
            F++     GD T                                               
Sbjct: 147 GFIIPRTPTGDET----------------------------------------------- 159

Query: 271 EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 330
             LK +E A         +  F  + I R+D       G  +RH++ VQ  RR  M  AR
Sbjct: 160 --LKKLEAAVKNVQTGKVEDRFAKITILRQDSQSFDKLGEKERHSLAVQKERRSAMALAR 217

Query: 331 NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ--- 387
           N L+ +++ P  SWV W DADI   P T+++DM  ++  VL  NV++    F D E+   
Sbjct: 218 NELLFSSIGPSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQ---RFFDKEKNEN 274

Query: 388 ---PYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXX 444
              PYD N+W ES++ L++AK + ED++IVEGYAE  T+R  +A+  +  G   +     
Sbjct: 275 SIRPYDFNNWAESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALD 334

Query: 445 XXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
                  L KA++ R G  FP F F +  ETEGF KMAKR+ Y + GLP+Y ++HI E
Sbjct: 335 GVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  178 bits (451), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 112/358 (31%), Positives = 168/358 (46%), Gaps = 61/358 (17%)

Query: 151 MLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDL 210
           ++ +  +  YDL K   + + A N++ +L+  P++         +++L+ +TYP ELI+L
Sbjct: 88  IIPEGHIAHYDLNKLHSTSDAAINKEKILILTPIQKFHQE---YWENLLQLTYPRELIEL 144

Query: 211 AFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQ 270
            F+      GD  L AL                                           
Sbjct: 145 GFIAPRTPTGDQALAAL------------------------------------------- 161

Query: 271 EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 330
                 E A +    +  ++ F  V I R+D          +RHA++VQ  RR  M  AR
Sbjct: 162 ------EAAVDKVQSDKKNQRFSKVTILRQDSVGFNKLTEKERHALEVQKERRASMALAR 215

Query: 331 NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ--- 387
           N L+ + + P+ SWV W DADI   P ++++DM A+D  VL  NV++    + D E+   
Sbjct: 216 NELLFSTIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQ---RYYDEEKKQK 272

Query: 388 ---PYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXX 444
              PYD N+W ESD  L+LA  + +D++IVEGYAE  T+R  +AY  +            
Sbjct: 273 AIRPYDFNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRLD 332

Query: 445 XXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
                  L KA++ R G  FP F F +  ETEGF KMAKR+ Y V GLP+Y ++HI E
Sbjct: 333 GVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  177 bits (450), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 112/355 (31%), Positives = 174/355 (49%), Gaps = 67/355 (18%)

Query: 157 VEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSD 216
           +  YDL K   + + A N++ +L+  P++         +++L+ +TYP ELI+L F++  
Sbjct: 94  IAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYPRELIELGFILPR 150

Query: 217 CSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMV 276
              GD  L+AL                                          +  +K V
Sbjct: 151 SDSGDAALKAL------------------------------------------EAAVKKV 168

Query: 277 ETAFNTPPHENYDKPFRSVQIFRKD---FGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 333
           +T       +  ++ F  + I R+D   FGQ++ +   +RHA+ VQ  RR  M  ARN L
Sbjct: 169 QT-------DKKNQRFSKITILRQDSQGFGQLMEK---ERHALHVQKERRAAMALARNEL 218

Query: 334 MANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ------ 387
           + + + P+ SWV W DADI   P T+++DM A+D  VL  NV++    + D E+      
Sbjct: 219 LFSTIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQ---RYFDEEKKEKSIR 275

Query: 388 PYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXX 447
            YD N+W ESD  L++A  + +D++IVEGY+E  T+R  +A+  +      S        
Sbjct: 276 AYDFNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEMMLDGVG 335

Query: 448 XXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
               L KA + R G  FP F F +  ETEGF KMAKR+ Y V GLP+Y ++H+ E
Sbjct: 336 GGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHMEE 390

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  177 bits (450), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 111/358 (31%), Positives = 175/358 (48%), Gaps = 61/358 (17%)

Query: 151 MLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDL 210
           ++ +  +  YDL K   + + A N++H+L+  P+   ++     + +L+ +TYP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTPDAAANKEHVLILTPM---QTFHQQYWDNLLQLTYPRELIEL 146

Query: 211 AFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQ 270
            F+    + GD  L+ L    + +Q    +Q F                +K   ++  +Q
Sbjct: 147 GFITPRTATGDLALKKLENAVKKVQADKKAQRF----------------SKITIMRQNSQ 190

Query: 271 EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 330
            + K++E                                  +RHA+ VQ  RR  M  AR
Sbjct: 191 SFDKLME---------------------------------KERHALDVQKERRAAMALAR 217

Query: 331 NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ--- 387
           N L+ + + P+ SWV W DADI   P T+++DM  ++  VL  N+++    F D E+   
Sbjct: 218 NELLFSTIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQ---RFYDQEKKQS 274

Query: 388 ---PYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXX 444
              PYD N+W ESD  L++A  + +D++IVEGYAE  T+R  +A+   A   P+      
Sbjct: 275 SIRPYDFNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLD 334

Query: 445 XXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
                  L KA++ R G  FP F F +  ETEGF KMAKR+ Y V GLP+Y ++HI E
Sbjct: 335 GVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  177 bits (450), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 109/358 (30%), Positives = 171/358 (47%), Gaps = 61/358 (17%)

Query: 151 MLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDL 210
           ++ +  +  YDL K   +   A N++ +L+  P+   ++     +++L+ +TYP ELI+L
Sbjct: 93  IIPEGHIAHYDLNKLRSTAYAAVNKERVLILTPM---QTFHKQYWENLLQLTYPRELIEL 149

Query: 211 AFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQ 270
            F++     G+N L                                              
Sbjct: 150 GFIIPRTKTGENAL---------------------------------------------- 163

Query: 271 EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 330
              K +E A      +  ++ F  + I R+D          DRH++ VQ  RR  M  AR
Sbjct: 164 ---KELEIAIKKVQSDKKNQRFAKITILRQDSQSFDQLAEKDRHSILVQKERRAAMALAR 220

Query: 331 NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ--- 387
           N L+ + L P+ +WV W DADI   P T+++DM ++D  VL  NV++   ++ D+++   
Sbjct: 221 NELLFSTLGPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQ---KYFDNDEKKM 277

Query: 388 ---PYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXX 444
              PYD N+W ESD  L++A  + E+++IVEGY+E  T+R  +A+   A G  T      
Sbjct: 278 AIRPYDFNNWRESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELD 337

Query: 445 XXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
                  L KA + R G  FP F F +  ETEGF KMAKR+ Y V GLP+Y ++HI E
Sbjct: 338 GVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  177 bits (449), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 113/361 (31%), Positives = 173/361 (47%), Gaps = 61/361 (16%)

Query: 151 MLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDL 210
           ++ +  +  YDL K   +   A N++ +L+  P+   ++     + +L+ +TYP ELI+L
Sbjct: 91  IIPEGHIAHYDLNKLHSTAKAALNKEQVLILTPM---QTFHEQYWDNLLQLTYPRELIEL 147

Query: 211 AFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQ 270
            F+V     GD  L  L                                          +
Sbjct: 148 GFIVPRTQSGDVALAKL------------------------------------------E 165

Query: 271 EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 330
           E +K V+T       +  ++ F  V I R+D          +RHA+ VQ  RR  M  AR
Sbjct: 166 EAVKKVQT-------DKKNQRFVKVTILRQDSKSFDKLQEKERHALAVQKERRAAMALAR 218

Query: 331 NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ--- 387
           N L+ + + P+ SWV W DADI   P  +++DM A++  VL  NV++    + D E+   
Sbjct: 219 NELLFSTIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQ---RYYDEEKKES 275

Query: 388 ---PYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXX 444
               YD N+W ES+  L+LA  + ED++IVEGY+E  T+R  +AY  +A G P +     
Sbjct: 276 SIRAYDFNNWAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALD 335

Query: 445 XXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPS 504
                  L +A + R G  FP F F +  ETEGF KMAKR+ + V GLP+Y ++HI E +
Sbjct: 336 GVGGGCTLVQADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWN 395

Query: 505 D 505
           D
Sbjct: 396 D 396

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  177 bits (448), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/358 (31%), Positives = 174/358 (48%), Gaps = 61/358 (17%)

Query: 151 MLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDL 210
           ++ +  +  YDL K   + + A N++H+L+  P+   ++     + +L+ ++YP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTSDAAVNKEHVLILTPM---QTFHQQYWDNLLQLSYPRELIEL 146

Query: 211 AFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQ 270
            F+    + GD  L+ L    + +Q    +Q F                +K   L+  +Q
Sbjct: 147 GFITPRTATGDLALKNLENAIKKVQTDKKTQRF----------------SKITILRQNSQ 190

Query: 271 EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 330
            + K++E                                  +RHA+ VQ  RR  M  AR
Sbjct: 191 SFDKLME---------------------------------KERHALDVQKERRAAMALAR 217

Query: 331 NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ--- 387
           N L+ + + P+ SW+ W DADI   P ++++DM  +D  VL  N+++    F D E+   
Sbjct: 218 NELLFSTIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ---RFYDQEKKQP 274

Query: 388 ---PYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXX 444
              PYD N+W ESD  L++A  + +D++IVEGYAE  T+R  +A+   A G P       
Sbjct: 275 SIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALD 334

Query: 445 XXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
                  L KA + R G  FP F F +  ETEGF KMAKR+ Y V GLP+Y ++HI E
Sbjct: 335 GVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  176 bits (447), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 110/358 (30%), Positives = 174/358 (48%), Gaps = 61/358 (17%)

Query: 151 MLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDL 210
           ++ +  +  YDL K   +   A N++H+L+  P+   ++     + +L+ + YP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTSEAAVNKEHILILTPM---QTFHQQYWDNLLQLNYPRELIEL 146

Query: 211 AFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQ 270
            F+    + GD  L+ L    + +Q    +Q F                +K   L+  +Q
Sbjct: 147 GFITPRTATGDLALKKLENAIKKVQTDKKTQRF----------------SKITILRQNSQ 190

Query: 271 EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 330
            + K++E                                  +RHA+ VQ  RR  M  AR
Sbjct: 191 SFDKLME---------------------------------KERHALDVQKERRAAMALAR 217

Query: 331 NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ--- 387
           N L+ + + P+ SWV W DADI   P ++++DM  ++  +L  N+++    F D E+   
Sbjct: 218 NELLFSTIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RFYDEEKKQP 274

Query: 388 ---PYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXX 444
              PYD N+W ESD  L++A  + +D++IVEGYAE  T+R  +A+  +A G P       
Sbjct: 275 SIRPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALD 334

Query: 445 XXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
                  L KA++ R G  FP F F +  ETEGF KMAKR+ Y V GLP+Y ++HI E
Sbjct: 335 GVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  173 bits (439), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/358 (30%), Positives = 174/358 (48%), Gaps = 61/358 (17%)

Query: 151 MLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDL 210
           ++ +  +  YDL K   + + A N++H+L+  P+   ++     + +L+ + YP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTPDAAVNKEHILILTPM---QTFHQQYWDNLLQLNYPRELIEL 146

Query: 211 AFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQ 270
            F+    + GD+ L+ L    + +Q    +Q F                +K   L+  +Q
Sbjct: 147 GFITPRTATGDSALKKLESAIKKVQTDKKTQRF----------------SKITILRQNSQ 190

Query: 271 EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 330
            + K++E                                  +RHA++VQ  RR  M  AR
Sbjct: 191 SFDKLME---------------------------------KERHALEVQKERRAAMALAR 217

Query: 331 NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ--- 387
           N L+ + + P+ SWV W DADI   P ++++DM  ++  VL  N+++    F D E+   
Sbjct: 218 NELLFSTIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ---RFYDQEKKQA 274

Query: 388 ---PYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXX 444
              PYD N+W ESD  L +A  + +D++IVEGYAE  T+R  +A+  +A           
Sbjct: 275 SIRPYDFNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALD 334

Query: 445 XXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
                  L KA++ R G  FP F F +  ETEGF KMAKR+ Y V GLP+Y ++HI E
Sbjct: 335 GVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  172 bits (437), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 107/355 (30%), Positives = 167/355 (47%), Gaps = 55/355 (15%)

Query: 151 MLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDL 210
           ++ +  +  YDL K   + +   +++H+L+  P+   ++     +++L+ ++YP ELI+L
Sbjct: 90  IIPEGHIAHYDLNKLHSTSDSISDKEHVLVLTPM---QTFHEKYWENLLKLSYPRELIEL 146

Query: 211 AFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQ 270
            F++     GD  L                                              
Sbjct: 147 GFIIPRSDAGDAAL---------------------------------------------- 160

Query: 271 EYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRAR 330
              K +ETA      +  +  F  + I R++          +RH++ VQ  RR  M  AR
Sbjct: 161 ---KKLETAVKNVQSDKKNNRFSKITILRQESQSFDKLEEKERHSLAVQKERRAAMALAR 217

Query: 331 NWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPL---PEFLDSEQ 387
           N L+ + L P+ SWV W D+DI   P T++E M  +D  VL  NV++      +  DS +
Sbjct: 218 NELLFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQRFFDNDKQQDSIR 277

Query: 388 PYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXX 447
           PYD N+W ESD  L+LA  + +D++IVEGYAE  T+R  +A+     GD           
Sbjct: 278 PYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMALDGVG 337

Query: 448 XXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
               L KA++ R G  FP F F +  ETEGF KMAKR+ Y V GLP++ ++HI E
Sbjct: 338 GGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  172 bits (436), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 113/376 (30%), Positives = 179/376 (47%), Gaps = 70/376 (18%)

Query: 142 KEQYEKELAMLLDASVE---------KYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLP 192
           K  Y+K+ + L +  VE          YDL K   +   A N++H+L+  P+   ++   
Sbjct: 73  KYSYKKKSSWLFNDRVEDIIPENHIAHYDLNKLHSTAEAALNKEHVLILTPM---QTFHQ 129

Query: 193 LMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYE 252
             + +L+ +TYP E  +L F++   S GD  L  L                         
Sbjct: 130 EYWDNLLQLTYPREFTELGFILPRTSSGDIALSKL------------------------- 164

Query: 253 HSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSD 312
                            +  +K V+T       +  ++ F  + I R++          +
Sbjct: 165 -----------------EAAVKKVQT-------DKKNQRFSKITILRQNSAGFDKLMEKE 200

Query: 313 RHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLV 372
           RHA++VQ  RR  M  ARN L+ ++L P  SWV W DADI   P  +++DM +++  VL 
Sbjct: 201 RHALEVQKERRSAMASARNELLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLS 260

Query: 373 PNVWRPLPEFLDSE------QPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVH 426
            NV++   ++ D +      +PYD N+W ESD AL+LAK + +D+++VEGY +  T+R  
Sbjct: 261 ANVYQ---KYYDDQAKKVQIRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRAL 317

Query: 427 LAYIREAQGDPTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMG 486
           +AY  +A G   +            L KA + R G  FP F F +  ETEGF KMA+R+ 
Sbjct: 318 MAYFYDATGATNAEMNLDGVGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLN 377

Query: 487 YRVGGLPHYTIWHIYE 502
           Y + GLP+Y ++HI E
Sbjct: 378 YDIFGLPNYLVYHIEE 393

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  169 bits (427), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 110/360 (30%), Positives = 166/360 (46%), Gaps = 65/360 (18%)

Query: 154 DASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFL 213
           +  V KYDL K   + + A N++ +L+  P++         + +L+ +TYP +L++L F+
Sbjct: 91  NGHVAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELGFI 147

Query: 214 VSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYL 273
           +   + GD  L                                                 
Sbjct: 148 IPKSASGDAAL------------------------------------------------- 158

Query: 274 KMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGF-----SDRHAVKVQGIRRKLMGR 328
           K +E A      +  +  F  V I R+D      +GF      +RHA+ VQ  RR  M  
Sbjct: 159 KQLEAAVKRAQTDKKNNRFGKVTILRQD-----SKGFDKLQEKERHALAVQKERRSAMAL 213

Query: 329 ARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPL---PEFLDS 385
           ARN L+ + + P+ SWV W DADI     ++++DM A +  VL  NV++      E   S
Sbjct: 214 ARNELLFSTIGPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRYFDEAENKPS 273

Query: 386 EQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXX 445
            +PYD N+W +S  A +L   + +D++IVEGYAE  T+R  +A+     G P        
Sbjct: 274 IRPYDFNNWADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDG 333

Query: 446 XXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSD 505
                 L KA++ R G  FP F F +  ETEGF KMAKR+ Y V GLP+Y ++HI E +D
Sbjct: 334 VGGGCTLVKAEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  168 bits (425), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 107/351 (30%), Positives = 162/351 (46%), Gaps = 60/351 (17%)

Query: 154 DASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFL 213
           D  + +YDL     +   A N + +L+  P++         + +L+ +TYP + I L FL
Sbjct: 91  DDRLREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFL 147

Query: 214 VSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYL 273
           +   S G+  L  L +  R +Q G                                    
Sbjct: 148 LPRTSSGNTALRKLEKAVRKVQTGP----------------------------------- 172

Query: 274 KMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 333
                          D+ F  + I R+DF        S RH   VQ  RR  M  ARN L
Sbjct: 173 --------------KDQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNEL 218

Query: 334 MANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQP----Y 389
           + + + PY SWV W D+DI   P T++EDM +++  +L  NV++    ++++ +P    Y
Sbjct: 219 LFSTIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQ---RYVENGEPAIRAY 275

Query: 390 DLNSWIESDEALKLAKTLPEDDVIVEGYA-EYPTWRVHLAYIREAQGDPTSXXXXXXXXX 448
           DLN+W ES+  LK+A  LPED +IVEGY  E+ T+R  +A++   +              
Sbjct: 276 DLNNWAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGG 335

Query: 449 XSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWH 499
              L KA++ R G  FP F F +  ETEGF KMAKR+ Y + GLP+Y ++H
Sbjct: 336 GCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  164 bits (414), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 101/354 (28%), Positives = 166/354 (46%), Gaps = 60/354 (16%)

Query: 154 DASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFL 213
           +  + KYD+     + +   N++ +L+  P++         +++L+++TYP +L  L F+
Sbjct: 92  EGRIMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFI 148

Query: 214 VSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYL 273
           +     GD  ++ L    + +Q+G                               NQ +L
Sbjct: 149 IPRTPTGDVAMKRLEDAVKKVQSGK-----------------------------ENQRFL 179

Query: 274 KMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 333
           K                    + I R+D          +RHA  VQ  RR  M  ARN L
Sbjct: 180 K--------------------ITILRQDSQSFNKLDEKERHAFNVQKERRAAMALARNEL 219

Query: 334 MANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSE-----QP 388
           + + + P  SW+ W DADI   P T+++DM A+D  +L  NV++    ++D +     +P
Sbjct: 220 VFSTIGPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQ---RYIDDQNQENIRP 276

Query: 389 YDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXX 448
           YD N+W ES   L++A ++ +D++IVE Y E  T+R  +A + +  G P++         
Sbjct: 277 YDFNNWQESQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGG 336

Query: 449 XSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYE 502
              L KA++ R G  FP F F +  ETEGF  MAKR+ Y V GLP+Y ++H  E
Sbjct: 337 GCTLVKAQVHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  162 bits (411), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/349 (29%), Positives = 163/349 (46%), Gaps = 54/349 (15%)

Query: 154 DASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFL 213
           +  +  YDL K   S N AEN++H+L+  PL+  E      + +L+ ++YP + I+L F+
Sbjct: 100 EGHIAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPRDAIELGFI 156

Query: 214 VSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYL 273
           +     GD++L+ L    + +Q       F  +                          L
Sbjct: 157 IPRTKKGDHSLKKLESAIKKVQTAKQGDKFSKIT------------------------IL 192

Query: 274 KMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 333
           +     F T P              +K+  ++           + +   R  M  ARN L
Sbjct: 193 RQNSKGFETVPE-------------KKEVSEI-----------EYEKQIRAEMALARNEL 228

Query: 334 MANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSE---QPYD 390
           +A+ L P  +W+ W D+DI   P ++++DM  +D  VL  NV+    +    E   +PYD
Sbjct: 229 LASTLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSIRPYD 288

Query: 391 LNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXS 450
             +WIES EAL+LA  + ED++IVEG A   T R  + +  +  G P+S           
Sbjct: 289 FRNWIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGVGASC 348

Query: 451 ILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWH 499
           +L K+++ R G  FP F F +  E+EGF KMAKR+ Y V GLP+Y ++H
Sbjct: 349 LLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  161 bits (407), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 105/347 (30%), Positives = 171/347 (49%), Gaps = 47/347 (13%)

Query: 154 DASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFL 213
           +  +  YDL K   S N  EN++H+L+  PL+  +      +++L+N++YP +LI+L F+
Sbjct: 99  EGHIAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFM 155

Query: 214 VSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYL 273
           V +   GD  L+ L    +++Q                   D   G+     K+     L
Sbjct: 156 VPNTKKGDQILKQLENAVKNVQG-----------------IDKKLGSN----KFAKITIL 194

Query: 274 KMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 333
           +  ++ F    H+  D         RKD  ++        + ++++  +R  M  ARN L
Sbjct: 195 RQKDSGF----HKFND---------RKDKKEM--------NDIELEKEKRAEMALARNEL 233

Query: 334 MANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSE--QPYDL 391
           +++ L    +W+ W D+++   P T+++DM  +D  VL  NV+       D    +PYD 
Sbjct: 234 LSSTLSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYDF 293

Query: 392 NSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSXXXXXXXXXXSI 451
            +WIESD AL+LA  +PED++IVEG A   T R  +    E+ G PT             
Sbjct: 294 RNWIESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACT 353

Query: 452 LAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIW 498
           L K+++ R G  FP F F +  E+EGF KMAKR+ Y V GLP+Y ++
Sbjct: 354 LVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score =  119 bits (298), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 95/361 (26%), Positives = 153/361 (42%), Gaps = 66/361 (18%)

Query: 138 TPKDKE-QYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFK 196
           +P  KE QY+     +    +  Y+L +   S +   + +H+L+ +PL +  S     F+
Sbjct: 59  SPFTKEYQYKDNRGAVETGGISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFE 115

Query: 197 HLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDD 256
           +L  +TYP +LIDL  +V D  +    L+AL +        TL++V         + +D 
Sbjct: 116 NLFALTYPKQLIDLGVIVPDSKNATGILQALQE--------TLAKV---------QANDS 158

Query: 257 TRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAV 316
           TR  K   LK  N+                N D P                         
Sbjct: 159 TRYNKITVLKDDNK--------------WGNTDDPVA----------------------- 181

Query: 317 KVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVW 376
                 RK +   +N L+ + L PY SWV W D+ I   P T+V+D+  +   +L  +++
Sbjct: 182 -----YRKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHIF 236

Query: 377 RPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGD 436
                  DSE    LN+W+ SD    LA  +P   V++EG +   T R  +    +A   
Sbjct: 237 NNSDGSPDSET---LNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAAS 293

Query: 437 PTSXXXXXXXXXXSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYT 496
             +            L KA++ R G  FP F F +  ETEGF +MA+ + ++  GLP+Y 
Sbjct: 294 VLTEMELDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYV 353

Query: 497 I 497
           +
Sbjct: 354 V 354

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 84/210 (40%), Gaps = 35/210 (16%)

Query: 312 DRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVL 371
           DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  ++E  +    +++
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFLY-NRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 372 VPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVH--LAY 429
           VP + R     + S++ YD N+WI         +T PED      Y  Y    V+    +
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGE-------RTKPEDTSKQNNYESYVPRPVNGKTKF 474

Query: 430 IREAQGDPTSXXXXXXXXXXSILAKA----------KLFRSGVHFPAFTF---------- 469
           +++   +  +           +   +          K+F  G+ FP F            
Sbjct: 475 LQDCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEG 534

Query: 470 ENHAETEGFGKMAKRMGYRVGGLPHYTIWH 499
            +  ETEG    AK +GY+  G+P+    H
Sbjct: 535 YDGVETEGLCYQAKTLGYKCYGVPNVICRH 564

>YLR173W Chr12 (502421..504247) [1827 bp, 608 aa] {ON} Putative
           protein of unknown function
          Length = 608

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 55/127 (43%), Gaps = 16/127 (12%)

Query: 218 SDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVE 277
           SD +N     LQ S H      SQ++ D D++    +D    ++   ++Y+N++ LK + 
Sbjct: 111 SDLNNDTGKYLQVSIH------SQIWFDYDKWPGTENDSDARSQRDWIRYINEKVLKTIC 164

Query: 278 TAFNTPPHENYDKPFRSVQIFRKDFGQVIGQ---GFSDRHAVKVQGIRRKLMGRARNWLM 334
              N          F    +F+   G V+G     F+  H  ++  ++ K++ +   W +
Sbjct: 165 IDLNNV------TTFDGDLVFKNKLGDVVGMEPICFNLAHR-QINNLQFKILVKPSIWKI 217

Query: 335 ANALKPY 341
              LK +
Sbjct: 218 VKVLKKF 224

>Skud_12.238 Chr12 (449167..450993) [1827 bp, 608 aa] {ON} YLR173W
           (REAL)
          Length = 608

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 53/115 (46%), Gaps = 10/115 (8%)

Query: 232 RHLQNGTLSQVFQDMDEYQYEHSD-DTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDK 290
           ++LQ    SQ++ D D +   ++D D R  ++L ++Y+N++ LK +    N         
Sbjct: 119 KYLQVTIHSQLWFDYDNWPGAYNDSDARSQRDL-VRYVNEKVLKTICINLNNV------T 171

Query: 291 PFRSVQIFRKDFGQVIGQG--FSDRHAVKVQGIRRKLMGRARNWLMANALKPYHS 343
            F    +F+   G V+G      D    K+  ++ K++ +   W +   LK + S
Sbjct: 172 TFDGDLVFKDKLGDVVGMDPICLDLTHRKINELQFKVLVKPSIWKIVKVLKKFWS 226

>Kwal_47.17621 s47 (486476..490816) [4341 bp, 1446 aa] {ON} YLR320W
           (MMS22) -  [contig 206] FULL
          Length = 1446

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 331 NWLMANALKPYHSWVYWR---DADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQ 387
           NW +A     Y S V W    +  I++C   +  D++ + YD+L    ++   E L +E+
Sbjct: 756 NWQIAEVENSYSSMVEWLAFIEFAIQVCEWKVNTDLLMSFYDILKSRKFQDFDEELTNEE 815

Query: 388 P 388
           P
Sbjct: 816 P 816

>AGL343C Chr7 complement(72374..73297) [924 bp, 307 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR282C
           (BGL2) Newly annotated start codon according to
           experimentaly determined 5' end of mRNA using 5' RACE.
          Length = 307

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%)

Query: 284 PHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHS 343
           P E+  K    V+ F KD   + G  FS +    V      + GR+R  + A+ L   ++
Sbjct: 128 PAEDLAKRINEVRNFVKDIKDINGNSFSGKPVGTVDSWNVIVDGRSRPVIEASDLVMANA 187

Query: 344 WVYWRDADIELCPGTIVEDMM 364
           + YW+   ++    +  +D+M
Sbjct: 188 FSYWQGQTMQNASYSFFDDIM 208

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,229,969
Number of extensions: 2875039
Number of successful extensions: 9046
Number of sequences better than 10.0: 92
Number of HSP's gapped: 9234
Number of HSP's successfully gapped: 136
Length of query: 522
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 408
Effective length of database: 40,409,475
Effective search space: 16487065800
Effective search space used: 16487065800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)